2AN5A

Structure of human pnmt complexed with s-adenosyl-homocysteine and an inhibitor, trans-(1s,2s)-2-amino-1-tetralol
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
258
structure length
258
Chain Sequence
VASAYQRFEPRAYLRNNYAPPRGDLCNPNGVGPWKLRCLAQTFATGEVSGRTLIDIGSGPTVYQLLSACSHFEDITMTDFLEVNRQELGRWLQEEPGAFNWSMYSQHACLIEGKGECWQDKERQLRARVKRVLPIDVHQPQPLGAGSPAPLPADALVSAFCLEAVSPDLASFQRALDHITTLLRPGGHLLLIGALEESWYLAGEARLTVVPVSEEEVREALVRSGYKVRDLRTYIMPAHLQTGVDDVKGVFFAWAQKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mode of binding of methyl acceptor substrates to the adrenaline-synthesizing enzyme phenylethanolamine N-methyltransferase: implications for catalysis
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Phenylethanolamine N-methyltransferase
total genus 90
structure length 258
sequence length 258
chains with identical sequence B
ec nomenclature ec 2.1.1.28: Phenylethanolamine N-methyltransferase.
pdb deposition date 2005-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01234 NNMT_PNMT_TEMT NNMT/PNMT/TEMT family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2an5A00
1VP3A 1ZGAA 2AN4A 3MERA 3MTIA 5GOZA 5GIPE 2Z6AA 2OKCA 1KXZA 3AJDA 3G5LA 3PS9A 2NNWB 4PWYA 1X1CA 5F2KA 5DM1A 5K01A 2P7IA 1KHHA 4PYMA 3NVKI 2QM3A 2JJQA 3A4TA 3C0KA 2ZBPA 2AOWA 3L8DA 4RTLA 1HNNA 4DCMA 2CKDA 2ESRA 2PXXA 5CCXA 3GCZA 3P8ZA 1ORIA 5DT2A 5GP1A 2AOUA 3A25A 1L3CA 1VP9A 3DXXA 2VS1A 1IXKA 3P2EA 3FZGA 3MGGA 2PX2A 2UYQA 1UIRA 3NDIA 4RTPA 5GM1A 3K6RA 2XBMA 5IH3A 4QTTB 1N2XA 1VBFA 1EAMA 3GRYA 2G70A 5EKXA 4QTUB 1DCTA 3DP7A 4BLVA 4KRGA 5BP7A 1SUSA 2O57A 3FPJA 3PVCA 2AOUB 1BC5A 2ZZKA 2PWPA 3KR1A 4PGHA 2DPMA 3NMUF 3KPYA 4ER7A 4DMGA 1JG3A 3EMBA 4WXHA 5GWXA 3TM5A 3UWPA 4CTKA 4X60A 2OB2A 5T67A 1P1BA 5HIKA 5KQRA 3G89A 3UBTA 3TOSA 3MHTA 4POOA 2WA1A 2YTZA 3DTNA 1NW5A 4FP9A 5GINE 1INLA 1YFLA 1G55A 5JUWA 1R00A 1P39A 4P7JA 1KPIA 5CIYA 1Z3CA 3AXSA 4KDRA 7MHTA 3BUSA 3UA3A 4RX1A 3C3PA 4C06A 2B25A 2C7PA 3OU6A 2UZ4A 2NXJA 1JG4A 2R3SA 5K0FA 3G5TA 2O05A 1R8XA 3T7TA 2ZZMA 1RJFA 2ZCJA 2PX8A 4PYJA 2GA9A 3E7PA 3KQOA 3DXYA 4A6EA 3ELYA 2IP2A 2CL5A 1YZHA 3R6TA 3A7DA 4P7FA 5EGSA 5KS2A 4RTKA 2JHAA 1YFJA 3ER9A 3BWCA 4IKPA 4QPPA 4MHTA 2R6ZA 3G7UA 3CVOA 3MCTA 1AQJA 4IV8A 5E1BA 4RTJA 1QAMA 3LL7A 2JG3A 3CBGA 2IBSA 5EG5A 5T6BA 2QE6A 3HVJA 2IFTA 2HNKA 2E5WA 1NW3A 2ADMA 4V0QA 5KYGA 5EZSA 1VLMA 5EHGA 3DMHA 1JQEA 3A7EA 2P35A 3CKKA 2IIPA 4QDKA 4Y30A 5HOQA 4PYIA 2EJUA 2P3OA 3ID6C 2YXDA 3NWEA 2IH4A 2P40A 4CTJA 4ER6A 3OE5A 3BT7A 3WSTA 2GS9A 1R6AA 4BY9E 3UZUA 1VL5A 4RTOA 5IKMA 2A14A 1OR8A 3BKXA 3CGGA 1N7JA 3OU2A 3B5IA 3ELUA 5EMMA 5K0LA 2O07A 2QRVB 3T7RA 3GXOA 1FPQA 2ZW9A 2UYOA 3SSMA 4K6MA 3T0IA 4GOMD 2ZBQA 3SVZA 3PFGA 4KIGA 3GJYA 2NP7A 4M37A 2JH9A 4HTFB 3SM3A 4KDCA 4EVIA 3TFWA 1YB2A 4Z2YA 3TM4A 2PT9A 5E2AA 2AOXA 2IH5A 4B17A 1WXXA 1NT2A 2BZGA 2VDWA 4HSGA 4RVFA 5HIMA 3TKAA 4C08A 1Y8CA 2FK8A 2Z6QA 2WK1A 1UWVA 2AOTB 2GH1A 4GOLD 4OA5A 2HR1A 2I7CA 3F4KA 1I4WA 2PXAA 4QVKA 3EVAA 4XUDA 4LG1A 1NV9A 1XDUA 3HVIA 3NVMB 2VZ9A 4GEKA 5DM4A 3V8VA 4E2XA 5HFJA 3EVZA 5DX0A 4EQZA 5FCDA 1SVUA 2ZULA 3DXZA 4YV0A 2BM9A 3GNLA 3LHDA 3B89A 4F84A 5CM2Z 2N47A 1NBHA 3OU7A 4U7TB 1AV6A 3Q7EA 1KIAA 5FULA 2P8JA 4E70A 1ZHFA 2IPXA 3TPZA 4YV2A 3I64A 3PT9A 2PX5A 4GBED 1KPHA 1SUIA 4LWPA 5CVUA 3TLJA 1VPTA 3GIWA 3O31A 2AN3A 5ERGB 4UOEA 4NECA 3DUWA 3DMFA 1I9GA 1AF7A 2Y1XA 4QPNA 3BZBA 5E9QA 1H1DA 3FPEA 4X1OA 3UJ6A 3K0BA 3HEMA 5B1SA 2OY0A 2ONYA 5LQRA 3PTAA 1YF3A 3DLIA 4P58A 1XXLA 3E23A 2YUIA 4R05A 2P3LA 2XYRA 3EVDA 3R9XB 3HCBA 1D2GA 4YUYA 4LECA 2H11A 1PJZA 3QOXA 2QY6A 1V39A 3I5UA 1G60A 3LDGA 4AZTA 4MIKA 3KQWA 4FZVA 4RTQA 4EK9A 1I1NA 4PYQA 2G1PA 1JTFA 1X1DA 1G6Q1 3GRUA 3NTVA 3R3HA 5DXJA 3EGEA 5LQNA 3EEYA 3M6XA 5K0BA 4KVZA 3LX6A 2UYHA 2B78A 3FRHA 3HCAA 4CKBA 1U2ZA 3B3JA 4C05A 1QAQA 5FHRA 5BXYA 4U7PB 4HRAA 4PINA 3CJQA 3G2MA 3I53A 3UJAA 1JG2A 3FUUA 4PNEA 10MHA 1M0EA 4BP3A 3KQMA 3SR4A 5DPMA 5G02A 2LD4A 3GWZA 1VIDA 3FPFA 4MTLA 4OBWA 4RV9A 3LDFA 5CVDA 4CKCA 2OBFA 3KHKA 1NBIA 3DMGA 3LPMA 3NJRA 5DM0A 5E1OA 4F86A 1WS6A 4A6DA 1FP2A 3BWYA 3UJ8A 2CMHA 1EJ6A 4PYOA 3S68A 5ICFA 3CCFA 3SSOA 4C07A 2ZWVA 4PGGA 5GM2A 4FR0A 1XTPA 2AR0A 3NDJA 4M38A 1JG1A 4KW7A 1L1EA 3JWGA 4PIPA 4KWCA 1UFKA 5E1DA 4RVDA 4PIMA 1NW8A 2FYTA 1JTEA 3DR5A 4OQDA 5H02A 3KKZA 3UJCA 3G2PA 2V74B 2Y1WA 3LCCA 1BKYA 4QQKA 5CUQA 3HNRA 3KPVA 1M6EX 4BP1A 2PBFA 3CC8A 5D1HA 3FTDA 3HA5A 4PYKA 5LQKA 1WG8A 1WY7A 3SSNA 5CVVA 5P8WA 1YZ3A 2P1DA 4R6XA 3REOA 2IBTA 2GLUA 1QZZA 4AZWA 2PX4A 2JH8A 2BM8A 2BR3A 3LECA 2PVCA 5DRTA 5EOVA 5HEKA 1KP9A 3OZSA 2OZVA 2IDKA 2ZBRA 4DF3A 3JWIA 4FGZA 5BW5A 2HMYB 2IH2A 3GGDA 3KPJA 3P9CA 3FPGA 4YUVA 1KR5A 3OFJA 3V97A 1ZG3A 3CJTA 3ER8A 1JQDA 1KYWA 2FHPA 3EGIA 3KPUA 3FUTA 1QANA 3EVFA 3Q87B 5E2BA 3JWHA 1D2HA 3RW9A 4E31A 1NKVA 1SG9A 3P9NA 1IY9A 4DM3A 1ZKDA 3LKZA 4HG2A 5KQSA 4X41A 3SXJA 5F2NA 1IM8A 3EMDA 3HCFA 4GOND 2O06A 3THRA 1WZNA 4EKIA 3RIEA 4OBXA 4FT4A 4PYNA 1SQFA 3M6VA 3FYDA 2HTEA 3JWJA 3D2LA 4RVGA 5EIWA 4ER0A 4L7VA 4Y2HA 1YUBA 2AS0A 3UJ9A 2CWWA 5EVJA 1AQIA 1R74A 3G2OA 5EHIA 1N7IA 3SMQA 2ONZA 1PRYA 2I62A 3PX3A 4JXJA 2PV0A 3RODA 5C9ZA 3PFHA 3TRKA 2BH2A 4AZSA 1XJ5A 2EJTA 1RJGA 3PB3A 5DLYA 2EX4A 4RYLA 4DKJA 1MJFA 4BLWA 1XCJA 2ZIGA 3ME5A 2ZTHA 3U81A 3TQSA 5K0GA 3DULA 3FTCA 5CCBA 3AY0A 4YV1A 1JQ3A 3HVKA 3OPNA 3ORHA 4HH4A 3AWIA 2FPOA 3GRRA 5ICEA 2GAFA 2XVAA 3LDUA 3HCEA 4EKGA 3HP7A 1EQAA 1T43A 5EEGA 3G8BA 3MTEA 5FTWA 4X63A 3QOWA 3E05A 2PWYA 5K0CA 4RTRA 5LQJA 4DCGA 2G8NA 2ERCA 2P7HA 2ZWAA 3ERCA 1L3IA 3UJ7A 2IGTA 3E8SA 1O54A 2GPYA 3KR2A 3LCVB 4XUEA 1G8AA 2P41A 1TW3A 2ORED 3R0QA 3G8AA 4ZTBA 4HTFA 4AX8A 5E1MA 4E30A 5C1IA 3UJDA 5EPEA 2B9EA 2PJDA 1XDZA 2VDUE 4OA8A 1O9GA 3THSA 1EJ0A 1FJXA 3OZRA 5LSAA 2PLWA 3C6KA 3R24A 5FUBA 1B42A 5HIIA 3IYLW 1XCLA 3GRVA 4P7KA 3HM2A 2NXEA 2PXCA 4C03A 4DA4A 1RI4A 1NW7A 4GOOD 4ATNA 1ORHA 5DSTA 3TMAA 4E2YA 4YUXA 4E2WA 4ISCA 3P71T 4BLUA 4RTMA 1L9KA 2YVLA 3TKYA 1X1AA 3HVHA 2PT6A 2YQZA 4R6WA 4E33A 2NP6A 1P91A 1R8YA 3X0DA 2WA2A 2ZFUA 2NYUA 2XVMA 3AXTA 1R18A 3B7PA 5CVEA 3PX2A 2NXNA 4HGZA 5HZMA 1ZGJA 3M6UA 1RJDA 2B3TA 2O0LA 2QRVA 3LGAA 4M36A 5E9JA 1NE2A 4GF5A 2NXCA 3IEIA 3LBYA 3HA3A 4GUAA 3VYWA 3FUWA 5LQAA 2EFJA 5C0OE 3I58A 3SX0A 2OYRA 1KPGA 2AVDA 4MQ4A 4YMGA 4QQNA 1EIZA 2ZVJA 1KYZA 1P1CA 4PONA 3M70A 2DULA 2OO3A 3ANXA 3OCJA 2GB4A 5EIFA 5ICGA 2XYQA 5LQCA 4YUWA 1DUSA 3KQSA 2KW5A 3EVEA 3FRIA 5HILA 2AN5A 3O4FA 2AOTA 3ELWA 1RI2A 3EVCA 3GO4A 2C7OA 2ZSUA 4G56A 3KQVA 2YX1A 1NV8A 2PGXA 2Z6UA 2FRXA 3EVGA 3P97A 5K0NA 3FUVA 3VC1A 1BHJA 3BKWA 3LSTA 3G88A 3MB5A 1EG2A 3CJRA 3M6WA 3OZTA 4RSRA 3UA4A 3KQYA 5DSXA 2XYVA 3B3FA 2H1RA 4H0NA 4E2ZA 5K0JA 4C4AA 4OX9Y 1M6YA 2G71A 1VE3A 2JHPA 4R8RA 3BGIA 3HA7A 4GQBA 2HWKA 1VQ1A 3ELDA 3KPWA 4R8SA 1XDSA 1NW6A 9MHTA 1FP1D 1X1BA 1F38A 1JSXA 2YXEA 5T64A 3BGVA 3LKDA 1RJEA 2H00A 3C3YA 3EGVA 2OB1A 2I9KA 3C6MA 2PKWA 1WXWA 2VDVE 3A27A 2UYCA 1X19A 5K0EA 2AVNA 4IV0A 3A26A 2PSSA 3HCCA 3KR9A 1D2CA 5K05A 5CD1A 2FCAA 1Q0SA 3NW9A 3KR0A 5KVAA 8MHTA 1BOOA 3UJBA 4XUCA 5DTRA 4DZRA 5FQNA 3KU1A 5MHTA 3DLCA 3EVBA 3KQQA 2BR5A 2K4MA 5DX1A 3VC2A 2FK7A 4RVHA 1RI3A 3KQPA 5EQJB 3GU3A 3SGLA 4CKEA 2ZZNA 5DWQA 3HTXA 5HIJA 3IV6A 3OFKA 3MCZA 5EMJA 5DM2A 3FYCA 4E32A 2OPBA 5FADA 3PLAE 1G38A 4GC9A 4RTNA 1FBNA 2F8LA 2Q41A 4RWZA 3UFBA 2HV9A 2ZLBA 2IDJA 5DRYA 4CWAA 3P2KA 4V0RA 1XVAA 4ER5A 5GIOE 3FTEA 1F3LA 3T7SA 1RI1A 3EPPA 4HGYA 3NWBA 5LR6A 3IHTA 3M4XA 5U4XA 5DTQA 4AUKA 1DL5A 3KQTA 4GC5A 3P9IA 4QVGA 2CMGA 4QDJA 2YR0A 2I6GA 3DOUA 4P7GA 3MAGA 5DXAA 5E8JA 1JSZA 3FUXA 3P9KA 5EZQA 4CXMA 1TW2A 4PCAA 5K03A 1SKMA 3GDHA 1SQGA 4OQEA 5CVJA 5DTMA 1Q0TA 5FWAA 4PYLA 1RI5A 5FA5A 4DQ0A 3BWBA 4RTSA 3LBFA 4HC4A 3BXOA 4FSXA 4FT2A 1QAOA 3HCDA 2OXTA 5F2OA 3I9FA 3LCUA 2ZIEA 3B3GA 3M33A 2C7RA 3GRZA 2B2CA 4AZVA 4MWZA 3EEOA 4XCXA 5DX8A 5BW4A 3FPHA 2EG5A 2ZIFA 4M7RA 4KIFA 2AZTA 2YXLA 3P2IA 5FHQA 1ZQ9A 4YUZA 1TPYA 4PCLA 4O29A 1O9HA 3TR6A 1JR4A 4FSDA 4YMHA 5D1NA 4X61A 3G2QA 2C7QA 5EC8A 2BR4A 5FA8A 4EMSA 4F85A 5M5BA 5EKUA 3QV2A 3VSEA 2PY6A 4C04A 3O7WA 2AOVA 5E8RA 3OE4A 1L3BA 5EMKA 4WVLA 5JR3A 4ER3A 3BGDA 4FS8A 1MHTA 5K8VA 5K09A 3DH0A 5EEHA 1HMYA 1QYRA 2G72A 1G8SA 5LQUA 3BWMA 3MQ2A 3FTFA 5FWDA 5EMLA 2JHCA 5ICCA 2V7EA 4IWNA 4LWOA 5E9WA 2P3QA 3H2BA 2QYOA 5FQOA 2VP3A
chains in the Genus database with same CATH superfamily
2DYKA 4OATA 3MERA 4A8PA 1YL5A 5HZKA 3AJDA 2A9OA 5LLTA 3R1IA 2ROQA 4JX8A 1CR0A 4BZXA 1TD9A 1YKSA 1X15A 3ANLA 4YCLA 5E4YA 5ISMA 3H42B 2O8BA 4AJ9A 1WF3A 4YP0A 4Z7JA 4ZVRA 1GGNA 2H52A 1KKUA 2JJQA 5B3LA 2HDNB 4L22A 4KQXA 3F0TA 4O0LA 2JFZA 1N2CE 1XMPA 3DNMA 3F1KA 4R5HA 4Y6LA 1WXIA 4D81A 3FJYA 4XFJA 4XWOA 4DUZB 4B2LA 1UKBA 2P6NA 3KOOA 2APJA 3DE4X 1EGQA 2QSJA 3QBTA 4CKXA 3C87A 2PE5A 1CR2A 2UYQA 3QI7A 3IAFA 4TMTA 5ECDA 4TRRA 2W90A 3VZQA 2ZYIA 1X1RA 1OFUA 4V24A 3AFMA 4YHBA 4X3CA 2HN9A 4ECAA 1AQLA 2XUGA 4Q4JA 1DP4A 3VOSA 4AO8A 5L51A 1XKTA 3A4LA 1Y34E 2I2DA 4XTCS 1JG3A 1CDOA 1NA5A 3SKVA 3TXXA 1P6XA 4Q18A 3HM9A 4HAIA 4FFBA 4YAOA 4QLBA 3MHTA 1J1UA 1R16A 2O1EA 3NT5A 4R01A 5LB2A 3DTTA 5KKAA 1MTOA 1ILWA 4DM7A 5AI6A 2CXHA 4RZ3A 5I7HA 1X7HA 4WLFA 5JW6A 3L77A 2NQ2C 5TQ0A 5CW2A 1Y3FE 3D2CA 2IOYA 2F9LA 2QTAA 1KZYC 1U94A 4KQKA 4MW9A 1YKFA 4ML3A 1STOA 1U04A 3VR4H 1ESDA 4J0CA 1K8ZB 1T1EA 3ZU6A 2HNAA 3Q7PA 3PEYA 3KG2A 4ZALA 1JN0A 4KP7A 5CIWA 1UEXC 1RTKA 4HDAA 3VGPA 1WOYA 3CRZA 1NZDA 3KKMA 1QGZA 1YVRA 3AB7A 3EAQA 1W47A 1K63A 4BV9A 2JFXA 1WB5A 3PIDA 5KSYA 1LNQA 4TS4A 5ERXA 2OZPA 5BVHB 1G8MA 2IW1A 2QAGA 1P1FA 1T2UA 3GZNA 5T57A 1ZMXA 4RZ2A 3IP5A 3ZI7A 3B3AA 5HOQA 1OC2A 3ADDA 4KVFA 2W93A 3ND9A 2YZ7A 1PDVA 3B6JA 4NCHA 3SBDA 3U0VA 2JZNA 3W5VA 4JVSB 3NFRA 1UFOA 3OE5A 1R6AA 3EOBI 4FGJA 3PQ3A 4NFYA 4D92A 4QEDA 1RWQA 1OV4A 3N87A 1UT5A 3OM1A 4LF9B 3IBGA 1N7JA 4OLAA 3PLRA 4HJRA 5EMMA 4BZWA 1EUDA 5AXAA 3V8EA 4B3CA 5F9HA 2ZBQA 4MVJI 5KINB 2IPOA 4FX5A 1TK3A 3OM9A 2RMKA 3OURA 4GX0A 4ID9A 3B82A 3K0SA 4KDCA 2HV8A 1H4VB 2FZKA 4DUYB 2G9VA 2Q27A 3TKAA 3TTVA 4IOLA 2O8EA 3AC0A 3WYGA 5B57C 2CLIB 4P82A 1Z75A 3RQSA 4X94A 3BMOB 1J8YF 2R6JA 2VJPA 3A4YA 3IDZA 3RVKA 4R1OA 5BNWA 1JHYA 2FGKA 2JIBA 4HEJA 4MSUA 5ICSA 2PMEA 3UWSA 3W9SA 4Z49A 4IDQA 3TGLA 4PHTA 2ONKA 1UC4B 4DLTA 1GM5A 2I8CA 3WIOA 1KA9H 4CETA 1YVUA 3HL4A 5EJ9A 2XV1A 3HV0A 1NVUQ 5GONF 2AFIB 2ZRAA 3IT3A 4GYWA 1P31A 2RC5A 4BLRA 3O3MB 3C3AA 1D4AA 1XEXA 3H6GA 1F2VA 3OU7A 4LXXA 3WLSA 2EFDB 1M1YE 1NQXA 4RH1A 4M0DA 1WDTA 3WL6A 4NEHB 4RA9B 3PXGA 2COEA 2IIVA 2WV9A 3O3OB 4LXQA 1E6LA 4UAVA 3UMSA 1JFLA 2PYDA 4C0QC 1BE8A 3W0LB 3N76A 4NY1A 2I3ZA 4BNWA 5BW6B 2IYEA 3NETA 1M6VB 2OV2A 4MRVA 1RM5A 2A4KA 2CLKB 2XOEA 4HOYA 3DFKA 2FB9A 2YV1A 2HSDA 4JC8A 4TKUB 3DUWA 4XD2A 1ZSNA 3DMFA 4EJ0A 4XQ0A 1PWEA 1EFKA 5AKGA 2QNRA 4BNHA 1NM5C 4R8LA 1XTIA 4RNCA 2OSVA 4Q4DA 4MTCA 3O8CA 1F60A 4Z3OA 1X1QA 4FBMA 4II3A 5JDCC 1TF2A 1W25A 3ESYA 2V4ZA 1J20A 2QRZA 4KR9A 1FFYA 3ESRA 1IXYA 1UJBA 3OQPA 4D1YA 1VDMA 4LECA 3W78A 1DXQA 4OOFA 3C7CB 4FSHA 4RPLA 4XEUA 4PLWA 5J9FA 5JROA 4OUKX 3KSRA 2QB5A 5EP1A 1DDOA 3GZTB 2RGNA 3QVUA 1HEUA 4M1SA 2O1SA 2P6RA 2V54A 2WT9A 3U4HA 1CF9A 3IE2A 2FY8A 2H1CA 3AIMA 3T0FA 1D1TA 5HF5A 6Q21A 3OJOA 4TX1A 4AAYA 4DDKA 1CFJA 3IIIA 1PSWA 4GYYA 4QJ4A 2JFYA 4RV4A 2V0CA 4UTVA 1PNQA 1M0EA 2HHHB 1X0VA 2IY9A 3KTAA 2VDPB 4YK7A 1O58A 2HA4A 1QTRA 1XMOB 2XUQA 3AR5A 5EWMB 3UGTA 1MUUA 2X14A 1QQAA 1MT0A 3LTEA 3NPAA 1RQNA 2XNSA 1MENA 2XBLA 4G65A 4OXNA 2GRJA 2FE1A 2PSJA 1SZJG 4W63A 1UL1X 3EDYA 2J9GA 1QKKA 5DHQA 1DC5A 1U9JA 4IIHA 5KI6A 1DQRA 3W8NA 2JBWA 4NDZA 1DNPA 3VPGA 2BT4A 3DBIA 1E64A 3PI6A 1SXHA 3UMVA 4B3MB 2YIDA 5CGZA 4L74A 3H1BA 4KFCA 1ZGGA 2OAEA 3SX4A 3U6KA 5GVRA 2PO5A 2D2IA 1H8HA 2OHGA 2GFIA 3NHRA 1E0KA 3WNVA 5CBPA 4C3OB 5C1DA 4LX0A 3CMCO 4Q9AA 3ZCSA 3WMXA 2O3SA 2BGWA 4XQGA 2VDMB 5P8WA 5B37A 3SQNA 3QEMB 4N5IX 1F0PA 2JCVA 1XMVA 4D8WA 4NQRA 4HGPA 1XLTA 4LBWA 2ATEA 1MGPA 1TLLA 1ENZA 2BZSA 3MT7A 3IVRA 4JEHA 3G1WA 2QTCA 3Q7IA 4IHQA 2IH2A 3FPGA 3OF5A 3ZHOA 4EFMA 3S40A 2J9XB 1G6HA 4JU8A 2DLCX 4P4LA 1K27A 1TO6A 1MAUA 3HFSA 1XALA 2EKQA 4KQ2A 4M9ZA 1ZK4A 4Q16A 1XDDA 1OZ0A 5I7EA 5DTIA 3T3NA 3LUHA 3MWEB 3Q2IA 4DANA 1EDOA 1RNLA 3QLEA 2AXPA 4BO9A 5CB6A 3C7DB 1FMLA 2WZBA 5K3FA 4OQMA 4K0RA 3NC0C 2YDYA 1IM8A 1GV1A 4KR7A 3J7TA 4KQ9A 4X64B 1H9BA 1NUAA 2A7XA 1GNPA 3TZHA 3EZ2A 1WMAA 2AXQA 3ZN2A 2HTEA 3KQLA 1SD5A 4TS3A 4Y2HA 5K8TA 1X9GA 2JLUA 1C2YA 1PT6A 5IUKC 4PQRA 4QUDA 3LG2A 4L08A 3GP5A 4FFRA 2I62A 3NTUA 1KMHB 1NT4A 1WZIA 3OLVA 4QUAA 3AVTA 2QVLA 3QEKA 5FD8A 3SOZA 2JJ1A 4ZYXA 2DT8A 4BNTA 1EE2A 4FCTA 5JEDA 4WCDA 2IZOA 2OENG 3LW7A 1U2DC 3R4CA 4M9CA 5JYCA 4D46A 3F97A 4FE3A 3H5IA 4YXWA 2FKNA 2WYOA 3RUAA 4J91A 5C8ZA 3X1KA 1JQAA 2OO7A 3QA3E 1S4MA 1AZWA 1CUBA 2P5YA 1NU6A 2P2GA 5ICEA 2BTEA 2H5EA 3ROGA 2PKQP 2XCSB 1IBRA 1A4XA 3OT1A 4EA8A 1Y1KE 1FX0A 4C0LA 1Z0IA 2OVFA 3WMRA 3SJAA 4PNHA 4YRQA 1PFUA 1PQPA 1OYOA 2FZWA 2I7DA 2QL6A 2WHXA 3GEBA 4I1SA 1GD1O 3LNTA 3QBVA 5FTWA 4E5MA 3RTBA 5C5CA 1YI1A 3ZDZB 4OYHA 4PC1A 1L7AA 1QUFA 1SM4A 3THYB 1ANKA 1BX3A 2Z5GA 4Y9DA 5FFFA 4EFNA 2AUMA 2Q4BA 3KR2A 1T4MA 3NH9A 2FPUA 4TWRA 4UMEA 4RTMA 3G8AA 1W5FA 2VTBA 1SUAA 2VEOA 1G5TA 1P8JA 4XGQA 2VXYA 2XADA 2JCBA 4W1RA 2R6R1 3IKTA 5KVVA 4GO1A 3JQEA 4K9MA 1DAEA 3FR8A 1E2NA 3L7BA 2NXEA 2XUZA 1Q50A 3UXHA 4BKQA 4YNBA 2JFWA 4HNRA 1OE0A 2CZQA 1HMPA 1PV2A 3PENA 4EIWA 1TEZA 5LXTA 3UMMA 1WQ4A 1DINA 3RYIA 3X0DA 3SK0A 2E6UX 1SG0A 2FEAA 3HWSA 5DM70 3JD3A 4YC7A 4KV7A 1QK3A 4TTQA 5H3LA 1GFZA 4X93A 3ZUGA 3CLRC 5AOAA 1VMIA 3T8YA 3QWFA 3H13A 3QUQA 1NBEA 3QKSB 2BZ1A 1VRCA 2BDTA 4M36A 4MPTA 4OHXA 4H27A 4KE9A 2EFYA 1SY7A 3DHVA 4LDPA 4DBLC 5LQMA 3VYWA 5G0SA 4JUIA 4V0ME 2UZAA 1T0UA 2QTVB 3RHZA 3RROA 1HL7A 3L7KA 5BV7A 4CIYA 1BCSB 1EIZA 4WXPA 1E0SA 3QFTA 4JI6B 5KREA 3OCJA 1DCKA 1U1GA 3NX4A 1KU6A 4KFUA 2AYYA 1PG2A 5DMHA 4L27A 1P6QA 1R8JA 4URHA 1KTVA 3HDJA 2C2OA 1MXFA 5KJ6A 1LQ2A 4G56A 4FWIB 4KO2S 2G9ZA 5IT4A 1T13A 1Z12A 3HWX1 3P97A 3G5UA 1RZ3A 1S2IA 1BHJA 4L8LA 5JMTA 4JJGA 1GTVA 1PTKA 4PR3A 5EFOA 5FOTA 1VE5A 4CQMA 3VH2A 5C32A 3VISA 5K0JA 5LIRA 3R7SA 4C4AA 2HO4A 2NSDA 4P2BA 5FRDA 4EUNA 4ZK2A 3EZ7A 5AQ1A 3GV0A 4F96A 1QWSA 1CJUC 3HA7A 3Q12A 1TU3A 3QOYA 4X5OA 1Y7HA 2C1XA 3ZCRA 1Y8QA 4AB1A 1F38A 3D3JA 1L1FA 1O6GA 5IBCA 4O8ZA 2I80A 1M6NA 3C3YA 3DFUA 2OORC 2RD2A 1VIMA 1X7YA 2VKTA 3ZNOA 2GXUA 1FFBA 4B48A 1YB7A 2HMWA 4XIFA 3A26A 4YBRA 1NBAA 3T1YB 1D2CA 2VZEA 1OA1A 3HNPA 4PLYA 3JAWA 1XCBA 2JFUA 4WESB 5T3UA 4EG0A 1RYHA 1PZEA 4EHDA 2QYSA 1OKKA 3FPKA 2YYAA 3DEFA 3VC2A 2QTGA 1JPUA 1II8B 4TQGA 2MCFA 1U9IA 2PWBA 3ZX4A 2WHEA 5DIFA 3U7IA 3RSHA 4JJFA 1PJQA 2ID8A 2VEDA 3DLTA 1S4QA 4L4XA 4Q1EA 1ODFA 1JR3D 1EX7A 2P67A 4MW1A 1R50A 5DRYA 5GJWC 1PWYE 1KZ4A 3AK4A 2C2KA 4KI0A 4ER5A 4M88A 5DI9A 2KE5A 2V7GA 3D31A 2QD1A 3PKJA 2JJ2A 1IJKA 1RWWA 1UBTS 3MB8A 3NIDB 3PEUA 4MB0A 5HUQA 2NLOA 1H0HA 1RM4A 1YRHA 3DBVO 3HU5A 3KP1A 3LWZA 1QGED 2A1UA 2RIPA 3BJRA 4TV9F 4C4XA 2YASA 2XWBF 2B99A 1D6JA 1MKYA 2BL4A 2BFFB 4P7GA 5HS6A 3W6ZA 4UM9D 5J47A 3ESQA 3LUJA 2C57A 2JJ1D 3PFWO 4BATA 4F56A 3AF1A 3S1LA 4YAIA 4GI1A 2HU5A 2D5LA 2IYPA 4JI1B 4A5SA 4AQDA 1DOZA 3PIRA 3JQAD 3HJTA 1FUEA 3AINA 5THXA 2HK8A 5F2OA 3GQVA 1J2TA 2FGJA 3P0HA 3WIUA 2V65A 3EIFA 1I10A 4IAOA 4YR7A 5JD5A 3T7KA 1KF0A 1YR3A 3RLFA 4NJOA 5F7JA 2CFTA 1AS0A 4IIFA 4OMUA 5K2MA 2JFGA 3E7FA 1J99A 3ETLA 3WL8A 1EFAA 1FVHA 1WLYA 2YNMC 1N5JA 4LY3A 4RMJA 5AJYA 2WB2A 1ZJYA 3N8HA 4X6LA 3RABA 1WHTA 4PR0A 2QY9A 3G2QA 1RACA 3JALB 5FBKA 3L93A 4N41A 4NYIR 4ZOAA 2IL1A 3A6EA 1W5BA 3DZCA 4Q7LA 5F73A 3GPLA 2XRFA 4D43A 3U4QA 1E96A 4Z0PA 3WYAA 2EATA 3LU1A 3OIUA 3PGMA 1MAVA 4G09A 4OKNA 3OE7D 4BN5A 2A8YA 2PS0A 1M5RA 2OD9A 1US8A 3ANTA 3QXCA 4I4TF 4O0MA 2YS7A 1BQ3A 3H17A 3VV2A 4Y67A 1ZOLA 4NBTA 4Q21A 1QG2A 4R40A 2HU2A 1KI4A 1N1MA 4WINA 2VHXA 4F1JA 5TMPA 1LLDA 2Z43A 4Q6WA 1W36D 5AXBA 1TTTA 1W4LA 4I14A 4WXYB 2C5LA 3UG7A 2E85A 1JH9A 4QM6A 2IZ0A 3AVOA 3IPXA 3KE8A 3BD7A 4GNRA 4R2MA 5FOWA 3ZWMA 5HF9A 4RXMA 1U2QA 4B4OA 2E1RA 2P7IA 5J4HA 5K01A 1JE1A 2GK4A 4WPGA 3A4TA 4A0QA 2B8EA 5CM8B 3DWEX 4RQTA 1NXVA 2EEZA 4FQ5A 4GZ3A 4LMPA 2E82A 4P4GA 2OO5A 4JVNA 5F9FA 3BJMA 1N6HA 2QE7D 1V7PC 3MGGA 4Q4CA 4W5TA 2JCXA 3K6RA 3BK1A 2WVGA 1OVGA 1PR1A 3GFFA 2PTHA 3L41A 2PUHA 4JODA 4UUQA 5IK2D 2FA9A 3CEHA 3TYXA 4FCVA 3V8BA 5IJXA 1IHOA 1MW9X 3THYA 3UM9A 5FDFA 1XHFA 2QR5A 3EMBA 4FHEA 3SP1A 5JQGF 2WTUA 3SIPA 5FUMA 2BFFA 1JECA 3FOFC 1BDJA 4X60A 5KQRA 1YQEA 1AIPA 2VK4A 3H3FA 1KDOA 3RV3A 1OOEA 2C4VA 2FQXA 2I1QA 1X1EA 3NV7A 1RR6A 4XJTA 3JQAA 4QXRA 3WQSB 4C2AA 4UU1A 4GQAA 2P2LA 5BSVA 2OXEA 3DO5A 1A2QA 4UBJA 2BBWA 1PEKE 4EB6A 1BGXT 1GZHB 1WTAA 2V7UA 3KEGA 3ZE7A 4CMEC 4R4JA 3JWEA 1P7YA 5JAHA 4EUEA 5KQLA 4RX1A 3PIIA 1J0BA 3GBPA 2FUNB 1CHDA 1EM8B 3JATA 4RYDA 5J5CA 5JSZA 3W9UA 4CGYA 1HNXB 1SXQA 4FDMA 3DNPA 3KQOA 5DMXA 4O08A 2DFPA 4ZA2A 3UYKA 3VPXA 1UBOS 5B53A 4HNUA 1Y48E 4A91A 3SZGA 1YIOA 2A9KA 5EGSA 3L4EA 4E7PA 1QC5A 3N0VA 5DYTA 5BRNA 1RP1A 3DE7X 4Y1RA 5AJHA 2B36A 3W8FA 4D8VA 3CSSA 1JEYB 1L2TA 1U81A 1XDGA 3IDQA 3PJRA 4F5YA 1ZU5A 4KQFA 1SBHA 2I3BA 3PJEA 1G59A 1OLXB 4L85A 3V4LA 1JNYA 1ZAYA 3FCXA 2BUBA 2HQ1A 4OJQA 5DNUA 2B7BA 5DDIP 4FDTA 1Y3DE 4EVSA 2EJUA 4W5HA 2JI8A 4JLOA 1ZMOA 1Q3KA 2I5PO 2P40A 2ZIXA 2PUFA 3SMVA 1IL0A 2FR8A 3F98A 4NBLA 3BT7A 2X9LA 3GJZA 4BY9E 4DV6B 4GNKA 5AM2A 3GQBA 5J43A 3W8DA 3QUCA 4RCZA 3FROA 1G42A 3FKJA 4ZODA 3D54D 1KFKB 2JHFA 1Z5PA 2GF9A 3G9XA 1GUZA 1LSUA 3QYFA 2X1MA 2JLVA 5FWXB 2YDXA 3BWDD 1HLDA 4MQUA 4NARA 2GBFA 1QHFA 3ZD8A 2VTBB 5EQTA 4QFCA 1RWMA 4B4DA 2C4HA 4D4KA 2NN3C 4M8KA 1XZFA 1Y8CA 3WP0A 5HK8A 2JRLA 1U9IC 2R1VB 1V45E 4NOJA 4LRWA 3IPAA 2GH1A 4XXHA 4QBHA 5DGXA 3ZZTA 2XAUA 4BFXA 1IC6A 4BJ3A 1DKMA 3MZ0A 1ZOSA 3F4KA 3EPLA 3VR3D 3ESBA 5JYEA 3HFRA 2VF2A 2WUGA 2A78A 3VR1A 3PC4A 3OTQA 1CZLA 2CXXA 5DX0A 4AD8A 1BXZA 2XUFA 4FINA 5DN9A 5CDFA 2HK6A 1N32B 3OJFA 1CRPA 3O47A 1CY1A 1SVUA 4MGEA 5KOYA 1RXCA 3IUMA 4J4HA 2O2CA 2ZJ4A 3GG9A 3JQ8B 1J90A 3KKPA 5DFAA 1IBMB 1VL2A 1CY8A 3ZHVA 3A6GA 1AV6A 1WO8A 3D8UA 3EFBA 3R0ZA 4WNCA 4ZOBA 2ODEA 3GFPA 4Q1CA 4BUZA 4MMXB 621PA 4D9NA 3ZH2A 4G8JA 4YV2A 1GZ4A 2IHZA 1YRBA 4C6RA 2QMUA 4DV3B 2QDKA 3TLJA 4P5DA 1R4AA 3IIEA 4I5GA 1WZCA 1V35A 5IYZA 3PNVA 4M1YA 2GHTA 4GPBA 4MWDA 3SLGA 1I7QB 5ETJA 1IPEA 3B7GA 3HN2A 5EPUA 4YRJA 1QE5A 1V26A 2XDQB 1J00A 1PD0A 2AGVA 3QUTA 4IOKA 2R1TA 1TIBA 4B3IA 4MKZA 4ENSA 3FIUA 1YRYE 3N6XA 3K0FB 5JNRA 1LPNA 2GJSA 1ORRA 3TK1A 1P0IA 2C2ZA 1VI5A 4JI5B 4JEMA 2WPDD 1IOWA 4P1ZA 2CYAA 1J97A 3HI4A 5FEMA 1YRQA 3QY9A 3W77A 1WAMA 3JQ9A 4EA7A 1XTSA 1GG5A 5SZHB 2AI1A 1X14A 2G07A 2WAXA 1H5NA 4CMIB 1NPTO 4D3YA 4B8WA 3BAFA 3VC7A 1R0ZA 5LD2C 1YVPA 1Y98A 3OZ7A 3VOAA 3WYBA 5K0BA 1AJEA 3DE2X 1QHSA 1FDRA 2BGKA 3K53A 3R20A 4TMZA 4WXRA 2NUPA 5CH3A 3ZGXA 1SUDA 4DJJA 4YEDA 5EA2A 5BXYA 3GP8A 4HRAA 10MHA 3EUFA 4WFKA 1TVKA 2SCUA 3FUUA 2A35A 4EEZA 1W87A 5J23A 3T9AA 1CE8B 3F3YA 3VU9B 5G02A 2A5LA 2LD4A 3WGTA 2D0IA 2W2NA 3HXPA 3QXGA 4NZMA 3DCIA 5K4GA 3SWWA 1Q1AA 3ZNNA 3A9UA 4MR7B 4YA6A 1K4KA 1EFUA 2PD6A 2H17A 1II8A 1UMCA 3GVCA 1OMOA 2XRMA 2JAHA 4H6PA 4PYOA 3SIWA 2W42A 2X4LA 1BXKA 3UHOA 4H7DA 4E2FA 4ZZ0A 9LDBA 4I8XA 1HM5A 4RGQA 3NDJA 4M38A 4AXXA 3WGHA 4JP2A 3HVRA 2I65A 3ZWQA 5A4IS 1C7RA 4O5OA 3I4CA 4PIMA 1BWSA 1N9GA 4RHTA 3EYAA 3DR5A 2JZCA 1JR3E 1W30A 4MW4A 4B85A 5CUQA 2FVXA 2FWBA 1JQBA 1M6EX 4ZVQA 2PBFA 4JQCA 3VJKA 3KXKA 1XVIA 3E9CA 5FAKA 1Z28A 4H6WA 4F4CA 1PKEA 3K70B 3VR2D 2AJ8A 3L84A 1J7KA 3IJ5A 4MS3B 4DCSA 1X86B 2CV2A 3H7IA 4O4JA 2VR1A 4ZI5A 4DF3A 3GLFA 2WUFA 3MINA 4QEZA 1L5LA 4TL8A 6ADHA 4FGZA 1EP9A 2AK2A 4NE7A 2NNLD 4LHEA 4GDMA 2J48A 3JYHA 2WD7A 4YUVA 5I9BA 5TS3A 1ZRNA 3OOEA 3MS4A 3FLAA 4BEVA 1ZG3A 3K5IA 1C81A 1JQDA 5FA6A 2FDCA 3COZA 3HCPA 4QXOA 2IYOA 2ZUSA 3AOEA 4ENQA 1MGOA 4D44A 2XAAA 3I9NA 1XRSB 4FEYA 4E3ZA 2Q2OA 5FFNA 1ZGHA 4PAWA 4RXUA 8ABPA 3FH0A 3UK0A 1U1IA 1OWNA 3CLHA 5BT8A 3FNHA 1HT1E 1FF9A 3GI1A 3HCFA 4PLPA 1NG9A 4FT4A 5CFNA 4KNWA 1WBDA 2IHJA 4UARA 1AZTA 3MWEA 1GADO 3UBMA 4HB2A 3JWJA 2NVUA 4IHAA 3NALA 4RVGA 4CF3A 3RF6A 1KJ8A 3OAAD 3DDUA 5EVJA 5LYJA 4KBYA 5IUJC 4BDSA 1R0KA 1PRYA 1Z07A 3NO4A 2PV0A 4BASA 1MVOA 4YHHB 2ZKLA 1F7VA 3JSAA 5IMBA 1RJGA 2BP7A 2Y2UA 4XPIB 2HRCA 5EXTA 1AA6A 2Y1EA 3KQNA 3NIWA 3PHBE 3S1AA 3CY6A 4FHCA 3CEAA 1XCJA 1H9CA 1JA0A 1XTUA 2ET6A 1ESMA 1LBTA 4QYIA 4AYXA 4DNFA 4R1PA 5L3VA 2G80A 3I5XA 3AL3A 1IBCA 1JB1A 3LLCA 3GRRA 4LV5B 4WBNA 2RGRA 3RREA 4O25A 1SU6A 1E9DA 4EPTA 2X4GA 5FTKA 1T1GA 5LL6P 2WICA 1T43A 2CCJA 4UAGA 1NVBA 3KQHA 1HQDA 1I80A 1NP3A 1TCAA 4FR5A 4YP5A 3ZHTA 5K0CA 4UM7A 1PJ8A 3FWYA 1VMDA 4FMCF 5ERYA 4JBYA 2IGTA 1GNQA 4MLDA 2FN4A 2PQ6A 2EGHA 4M8SA 5T8KA 1CYEA 1T4CB 3SDBA 2XXAA 1N3BA 2UZ1A 1RC0A 4M9SA 2ZUFA 5TJ9A 5CCXA 2PVPA 2EDAA 3I2JA 2AJBA 4E30A 3I2FA 3U4DA 2IVZA 5BYBA 1NG1A 3HDHA 1GIAA 1C30B 1Y8RA 4PAGA 1XDZA 3R9KA 4OA8A 1EFLA 2CNOA 1XCLA 1FS6A 4P7KA 1JHMA 1X2EA 4FOSA 1QK5A 2OSBA 1QV7A 3DOEA 1UJNA 4NI5A 1GDHA 3BJZA 1D2RA 3RIHA 3RIXA 4UXJA 4GGPA 1EWKA 2ZIUB 3OOWA 1WCV1 1DTWB 3KYCB 4BLUA 2ZJ0A 2VXBA 4LDRA 1JXOA 2CFSA 2ECQA 5BNZA 1R8YA 1V41E 4X1KB 1PTJC 1HDYA 3DA8A 5BSEA 1GR0A 3EF1A 3Q8WA 1JVSA 2PGIA 5FL7A 2PUTA 2WIFA 2H7VA 1IY0A 3F7NA 3O8BA 3VR5D 1ZGJA 3ZDRA 3ZWXA 4JJEA 5IVPA 1C9EA 3KT6A 5DCWA 4LSMA 2VQ6A 4H6VA 2GN8A 4MITA 5LZ7A 7YASA 3OM0A 2W70A 4KQ1A 3V2IA 5LQAA 1EVIA 2DUUA 2CV1A 1OYWA 5GJVC 3G6WA 3K0CC 2J0UB 4J0KA 5IJ9B 2ZANA 2ZU6A 1OBHA 4NV0A 3MJFA 4NPCA 5I01A 1EGAA 1TKCA 5KAPA 4K9QA 5EIFA 3UKJA 3TIIA 3W3AH 3SYRA 4PFJA 1ZUNB 1PR4A 3HBMA 3K09C 3ELWA 5LYJB 1L5GB 3TAHA 4LGVA 3Q11A 4TMVA 1GL9B 5K0NA 3T15A 3VC1A 3A31A 3O0TA 3CONA 5FAXA 3QA9A 1YI8A 3H6HA 1RM3A 5A5FA 2MMCA 5D3MA 4E2ZA 3FCEA 3PF8A 2WYUA 3SZRA 3ISJA 1P5FA 1SCAA 4LOJA 3K32A 4OX9Y 3ND6A 3W6NA 1RQRA 1VE3A 1JDPA 5TS2A 3WFZA 1VQ1A 2Z9BA 4RK6A 3AJ9A 3NJ8A 3C1AA 4O2RA 4X3OA 1YH3A 3K1AB 1HDOA 1JSXA 1DAOA 1H4TA 1OGIA 4QTXA 2XD9A 3LKDA 3P32A 4GOKA 4E13A 4A8HA 3TS1A 2H00A 1WDLA 4ZOCA 4ZT3A 4ENTA 4I50F 4BBPA 5JBIA 1A97A 4D9KA 4X62B 3CR8A 2IXBA 4BJ5A 2Q6VA 2WFAA 4N0DA 5H82A 4BDTA 4BV8A 4CMHA 3K70D 1U65A 3H65A 4ZKDA 2WKQA 2AEEA 5H80A 2NSHA 5MN5A 1RPTA 2VP4A 1RAAA 1T0PA 2A0UA 3DT8A 3NAZA 3GGPA 3F49S 3SYLA 2V6MA 4ZHSA 1FE8A 1VJ0A 1E6UA 2GD2A 3HMQA 3CUSA 1QV9A 2BFCB 3BHNA 1E79A 1IZZA 3K0AA 4PSAA 1SXJA 4DV7B 3H8WA 2ZZNA 1Y89A 1T91A 2NVOA 2WRZA 3OZFA 4JLAA 3HTXA 1EFRD 3M6FA 4PVCA 1UBNA 2AK3A 3EPRA 4QLAA 5DCUA 4GM1A 5IULC 2OAP1 2XGSA 2A1TS 4E32A 1T1JA 1UBHS 1ZNYA 2JIDA 1A9YA 1DKOA 1RTTA 2QBYA 5SY9A 4CMKA 4ZDKA 2OM2A 4L02A 1TQDA 4LE2A 3WK7A 3KOWA 2IX9A 3GN1A 2PEZA 1E7SA 4PV7A 5CPBA 2BGIA 3FYTA 3T9CA 3VNQA 2K2QB 1E99A 1NW9B 4IDAA 3S44A 2QQFA 4LZNA 3LD9A 1QS0B 1ZA1A 3MLBA 4YMVA 2BEWB 2HD4A 2XB2A 4F9GA 1IDN1 4P9NA 4QDJA 1G4AE 1NU8A 4PF1A 2J8ZA 2R4QA 3HCRA 1CNFA 5E8JA 1Y8AA 4MIEA 3R9IA 3WL3A 5B7PA 4DR3B 1TJ5A 3SBEA 3UT0A 3B1FA 1RZRD 1G3QA 1JEJA 3K4HA 4YUAA 1SO8A 1AHPA 3I9OA 2QRQA 3ESXA 3MA0A 3W2FA 1UFVA 3NWOA 3RC3A 4N5NA 3B6KA 3HCDA 4KO1S 1GRNA 4XD7D 1EFDN 4ZOQI 3K6SA 4XYMA 3FNGA 3M2PA 4OKIA 5IEJA 2D1FA 2WU0A 3WGGA 4H0CA 2BGLA 1A7KA 3OSUA 4KWEA 4AZVA 4QRHA 2ZSDA 4NH4A 2HIGA 1LBHA 3DEZA 4JJ6A 4XLTA 4Y2TA 5KYUB 2DJIA 3K8OE 5BWNA 3PQCA 3IO3A 4GBJA 4KIFA 2RHTA 2WJIA 2YXLA 2VTDA 3L4BC 3P2IA 4PCLA 3DMDA 3R3YA 4O29A 4QU5A 4ESEA 4Q12A 3U7GA 2OM6A 2Q5FA 4QL3A 4E6PA 2I7TA 5AVUA 2H2HA 1WEHA 1ZLXA 3BTVA 1EK1A 4TTPA 4BN0A 4ZYVA 5HSGA 4EMSA 4YCBA 3QWBA 3ORFA 5H1YA 3F7OA 4D9MA 4Q7QA 5EKUA 2JLBA 2SNIE 2FZ4A 2GVDC 4IUCS 3L07A 1V5FA 4DEXA 1ZN7A 1FNCA 1BEEA 4FS8A 4U2GA 3T7AA 4KMSA 1NVDA 1P74A 3O3NB 2G1KA 4DR5B 4AMGA 1OI3A 2Z2JA 4KLCA 3B9PA 1CVLA 1DX6A 4RM3A 1X6VA 3ILHA 1ZMBA 4FFVA 1VBMA 3AL2A 4L57A 4TVOA 5IHXA 2YJ4A 5FWYB 4FPXA 1FSZA 2ZT6A 3I39X 2BONA 1U0TA 2ZI4A 1CJTC 3LT1A 4JXJA 4KRGA 4NIMA 5GOZA 1IM5A 2BE7A 2PZJA 5CA0B 5IZCC 2Q5IA 1O95A 5C7IO 4BNIA 4RQUA 5LP1A 1WB9A 1WU7A 2GN1A 2CLMB 2DP4E 2FR0A 2NUTB 2QT1A 2YHIB 3PUIA 5ALSA 2I03A 2AC4A 5IN5A 5F7OA 1VJTA 1EK6A 1J33A 3OIVA 4LI0A 1CUWA 4V38A 2BEJA 3H2IA 1HK7A 1W94A 3KXIA 1QIFA 2DBQA 4XM1A 4URXR 3AKZA 1ZJWA 3P2EA 2W2QA 4OBEA 1UIRA 2QP3A 2W6OA 1UXOA 3NTXA 1NWCA 5DBOA 1KQOA 3U5ZB 1WNFA 4QTTB 3ZWCA 4YRGA 2IXAA 1L7EA 3SC3A 3SY8A 2C9OA 4B1FA 3IODA 5IRCD 4WOJA 1XZMA 5EXPA 3BGWA 2JVIA 4PGHA 4IJ5A 3TW8A 1TPZA 2RHOA 2PUDA 3NMUF 1ADCA 1SIOA 1IU9A 2GSWA 4D0SA 2LE0A 4J29A 1S3SA 1N1EA 4DG8A 1TFUA 4FP9A 3KXDA 3R0VA 5BYKA 3ACCA 2MSDB 1T0IA 1R00A 1QZ3A 4AMYA 4BV2A 3H5AA 4AKTA 5DNAA 5IJZA 3Q8KA 1HPLA 2DFLA 4CLRB 4JR0A 1TCVA 3IJEB 3HB5X 4C06A 9ATCA 1ELOA 1KEPA 1WW8A 1YJCA 4QASA 2Y0CA 1IOLA 6PFKA 5AW7A 3FSJX 4EY7A 2UUCB 1Q74A 4XLLA 1GUAA 5LLSA 4GOJA 4WECA 3CRRA 2ZRNA 1ONOA 2D1SA 3K09A 1H2AS 1T1IA 4IKPA 3VTZA 5EP4A 3O2SB 3G7UA 4JLMA 4PO3X 4X1YA 3VVBA 2VHEA 5LKRA 1QAMA 2QTZA 5ADVA 4W5WA 3TLYA 1EB9A 4N4AA 2CK3D 1C7ZA 1JBKA 5HRAA 3NKLA 3PUXA 1FNNA 5I7FA 1VE1A 2QUKA 1JQEA 1X92A 4GVXA 4PN7A 1AB5A 3O1HB 2EL7A 1MQSA 5LDDC 1EUZA 1RDFA 1D2MA 4CTJA 1Z06A 2AZDA 1LH0A 2IHYA 4UVDA 4A2PA 2DUWA 3ADBA 4FW8A 2C3OA 4YRIA 3RYFB 2B4QA 2GPBA 5DWDA 2OZLA 2P4QA 1I51A 2VSYA 3G23A 4ASUA 3T6KA 1EDZA 2YHUA 2AX3A 3BPSA 2R7AA 1Y6ZA 2VDRB 1CS0A 2HREA 3OLXA 4IDOA 4RNDB 5AD1A 5I9NA 5CLLA 1F8FA 1KBQA 1X7WA 5EL0A 1NSYA 4G0OA 1FXSA 4KAXA 1UBMS 5JMWA 4OB6A 1QF6A 5EMNA 4HSGA 4DG5A 4HD8A 2L82A 1GCUA 2ISCA 4QJ5A 4IW3B 1NRJB 1W9MA 2X7JA 2J3KA 1FBTA 3OLWA 4MJ7A 4YCMA 4GOLD 4MRMA 2UYGA 3CE9A 3O4GA 3OQ1A 3CYFA 4OQNA 4E7OA 3M4ZA 4J9UE 2IV2X 4ZZIA 1ENYA 1NY5A 1NV9A 4RPCA 3PQ4A 2XQIA 1NR7A 4KUGA 2BHNA 1IAVA 3DV2A 1D1PA 1UC5B 1VFPA 1V43A 2DBYA 3E3OA 2XTZA 3L46A 4NAUA 2VH2A 3PUZA 2R2AA 2BFDA 2FFJA 1W2WB 4X8LA 4XRRA 3WGZA 1XTBA 3PA8A 3EBLA 2IYUA 4KRYA 1A72A 1Q1GA 3GNLA 4RDHA 1VSBA 2B20A 3L8FA 1NXWA 1P5ZB 2TRSB 2XEXA 3SR0A 2AYZA 3PHIA 5GPBA 1U8UA 2WFLA 3PEFA 2XKBA 3EPKA 1B26A 1NF2A 4ZREA 3PT9A 4AM8A 4EG1A 3A32A 1W581 1M2GA 1SD2A 1A50B 1GAEO 3HP1A 4M1WA 5AKHA 3EZLA 2DQ4A 1Z5WA 3DOIA 2NVBA 3OT1B 4CTNA 1ZH8A 4QYXA 2BBOA 1K5GA 3WLAA 4U2BA 3O8OA 3P2MA 1A9TA 2BKEA 4YRFA 1SKBA 3I34X 3WRXC 3JPWA 2ONYA 2W8BB 4QXQA 5IUNC 5JI2E 2V3WA 1CEEA 1IWBB 5E0KB 1T8TA 1H1LB 1F8YA 2P3LA 1HH4A 3QJ5A 4P32A 3P2OA 1AXGA 4I1VA 2K2WA 1OTXA 1OQAA 4UDXX 5DI3B 1HZZA 2O5RA 3P0RA 3ROZA 3I5UA 2PR2A 4TV9B 3U4GA 1GL7A 3GJ5A 1SVKA 4W4TA 3BREA 4XYEA 5REQB 1GJRA 1M2OA 1I1NA 4PYQA 4G1FA 1CDEA 2WU3A 3LRPA 1JTFA 4EPVA 3KELA 4DOMA 3MMSA 4YAGA 4X84A 3ZS8A 2B78A 2CMDA 2QVCA 3FX2A 4NH0A 1QAQA 2YVUA 3VSAA 1YS2X 3AERA 4FYVA 4RHYA 1N2HA 1LDYA 3TZLA 1MR3F 2BMFA 4BL5A 4U7DA 3N2LA 1OAAA 3IP6A 1A9SA 4B2PA 4HNHA 2H9YA 4IH4A 1VIDA 4BO3A 2XPCA 4KXFB 4MR9A 3PDWA 1T8UA 4AJEA 3LJKA 2NUPB 1T5IA 4KOEC 4N5DA 3QKSA 2PNJA 1GRRA 5DK6A 4FCWA 1ECGA 5DF1A 2BI8A 2GYVA 2B30A 2CJFA 2UKDA 4R1TA 5EUBA 3VKWA 2FR8C 1D0VA 4MINA 3VNRA 1KQGA 4KW7A 4TTSA 2Q8NA 3W5CA 3CLUD 1UBEA 1KNXA 2BMWA 4KWCA 1UFKA 5FX2A 4F04A 3V8VA 5AESA 3B9RA 4D9GA 2NO6A 1H1LA 3HSKA 3VDMA 1Z25A 4NHOA 5M3BA 3HKDB 3O91A 4IYRA 2V74B 3TDMA 4MR8A 2WNSA 2FFAA 4RJLA 3KPVA 1JBQA 5J4KA 4B9AA 4GDFA 2NZ2A 4KK3A 2QXUA 1PAUA 3ZGOA 2P9QA 4G86A 3IILA 2P2YA 3FDXA 3VSBA 3TAUA 4K9OA 1E3JA 4HUQB 5KO2A 3WV4A 2CLLB 1AKTA 1PJLA 2ZJ2A 4ZDIA 2WSMA 2ACEA 1QOZA 2GAOA 2GPSA 3A8TA 4EB8A 1TMOA 5KTSA 1PZHA 3BFJA 3IOEA 2HBQA 4R8KA 3WYDA 2D6FA 2FHPA 3FNRA 2GJ9A 4JENA 1CJSA 1T8YA 3DBLA 3MNFA 4H3SA 4GZ6A 4MPPA 2RGUA 1D2HA 1P60A 4MV7A 4LMBA 4OHMA 4JJZA 4HNAA 3D6NB 1LPBB 4MWSA 4QUHA 3GBSA 1NLUA 4DDTA 2WYHA 2JIQA 3L0OA 3UAZA 5KTRA 2O06A 2Q8PA 4QSMA 2WUDA 1WZNA 1MNAA 3QWIA 1SVLA 2LVBA 3TCNA 3AHEA 1I3NA 1KK3A 3OZIA 1NI4B 1SKYB 2VJNA 4IJVA 4LC1A 4LRXA 4TV9A 5EIWA 2MOKA 1KVUA 2DFNA 1FZTA 4KAJA 4BXOB 4HGQA 1IZ7A 4X1KA 3O2QB 2FF5A 3OEED 5BV2P 1XGKA 2ID9A 1U2SA 2FW9A 1AUOA 5IG2A 3EIHA 1PT9A 3L0SA 4TROA 1I5EA 1KZ7B 2TMKA 1V5EA 1V16B 4IHJF 1T5LA 3TSAA 4RGYA 1JEEA 1TYZA 1J8VA 4G5SA 4E08A 4INJA 3STVA 2B69A 4RVCA 5TGZA 1T8WA 3AUKA 2E3JA 3O92A 4Y1RB 3G1UA 1M73E 4WBXC 5JAQA 1MH9A 5SY6A 4KPFC 4BUCA 3G8BA 3WBBA 5E4TA 5A5DA 1CUDA 2PRKA 4KBGA 5C8VA 5KJFA 4NTZA 3ZZNA 3OQNA 3ERCA 1EBUA 4X20A 3C3WA 1QFSA 2Q3CA 3E8SA 1T36A 5KJEA 5J59A 5LC1A 1U8YA 2H51A 2KBFA 121PA 2G88A 3LT2A 4HDKB 5AYVA 5HQTA 4KOAA 4KQHA 4JSTA 1QP8A 3ETEA 3NHLA 5E1MA 3A1NA 2M6SA 3V4FA 4A8JC 4URVR 1FTWA 1QHIA 2VRNA 2OMEA 4JASB 4OHUA 1Y8ZA 1N77A 1HX7A 1RYMA 4R3NA 3SFTA 5K6AA 5LSAA 3PQ8A 5AMXA 2FZLA 1QH9A 4ED9A 1XZHA 4GR5A 1R6XA 1BYIA 2XMPA 3WWZA 1GLVA 3ZHSA 4IIBA 3ZCVA 1KO5A 5JECA 4OXIA 4EO4A 2TECE 5L6LB 1M67A 3QITA 4UNIA 4BFUA 3U4MA 2CMKA 3GF4A 4TZ6A 4JB0A 5BY2A 1F6WA 4MA5A 5M2QA 1LJUA 3RUHA 3MTDA 3L02A 4JBXA 4WADA 5KNDD 4HDNB 4HEHA 1HI9A 3FZQA 1HT3A 5CW1A 3UUFA 2Q5JA 4YT4A 3DMRA 2OK7A 3REQB 4JBGA 3UENA 5MGNA 2ZB3A 1JJBA 4FZJA 4MV8A 2Y05A 2BSAA 1SEVA 3LP5A 1OY1A 5SYNA 4QT0A 3UK6A 1Y6JA 1YBMA 2JLQA 3CX6A 2R7NA 4JUCA 2N42A 4TTJA 1ULTA 3KT8A 4MQ4A 3ST7A 1U2GA 5CBKA 3BSSA 3OKPA 1GZVA 2DULA 1YHZA 3SEQA 1JDZA 2HF2A 4YMUA 2WUWE 3GJXC 2A3RA 3HACA 1A27A 4LNUA 2NU9B 3A4MA 4CM1A 1J9ZA 1G1AA 4NPAA 1K3FA 4AIRA 1X80B 3R3JA 4Y1EA 4I4LA 4C7OA 3RUFA 2PAAA 2YMMA 2Q1TA 1SCUA 4HX5A 4BRZA 2JGKA 4S0ZA 1ISRA 4NNJA 4BZZA 4E5KA 1IFXA 1T2CA 2Z6UA 1YV9A 2JAQA 4NF2A 1EG2A 3KVVA 3GLTA 3W4IA 1ZEMA 3DTVA 2Q3HA 2AEMA 2DT5A 3B3FA 2DUMA 1DHRA 4JC4A 4O4JB 3GLFB 4ZXFA 3ZH9B 3WGVA 1JJIA 1T9CA 4UFOA 4F4UA 3H1PA 4IGAA 3Q85A 1NJ8A 1LJLA 3E7WA 3ZTTA 2A5GA 3U44A 3BTSA 2JGDA 4QOGA 1H6AA 4BMYA 1O94D 2OWEA 4ND2A 4E07A 3NHJA 1AT1A 1L5WA 3OIYA 5JD3A 2D8AA 2XNHA 3USCS 3N59A 1PNRA 2Q3FA 1HYHA 1OU4A 4IM7A 3X1DA 4ND5A 3QBDA 1KZHA 2IHNA 3SHQA 3KX2A 1HDEA 1QE0A 2FCAA 1NE7A 2CBXA 5CDHA 1CZOA 1Q2UA 4ZCRA 3BRWD 3ICOA 1TYBE 2D1YA 3DVLA 3QQ5A 4GSLA 1KOLA 3ZHBA 4C5CA 2C97A 4EJSC 5BRJA 2Z9CA 1XLUA 2H06A 3KO8A 4C76A 5WRFA 2NU7A 4ARUA 2YZ2A 4IIUA 1GU0A 5A5VA 3P9SA 4TLBA 3HSSA 5K3SA 1P0PA 3GHYA 4DVJA 2WNHA 1CNMA 2FDRA 1IHDA 2CHUA 1P0QA 4GH5A 4J6EA 4BNGA 5FBVB 2DTEA 1Y5MA 1VHLA 2Y1GA 3BG5A 2VPWA 4HPJB 3RVNA 3LPAA 1YD7A 4RFSB 4UTPA 5BQ3A 3G2JA 4QPCA 2R6GA 1LV7A 2GJKA 3AONB 4IXNA 1XKLA 1GGVA 1OWOA 3ZZ1A 3E84A 4HQ0A 4JEUA 2DY0A 1DSSG 4LIPD 4LZPA 4WJZA 4QFMA 3MWKA 4U39A 3VYSB 4JV5B 2WYVA 5ALEA 1DL5A 4PXAA 1B15A 4GC5A 2ZRKA 4QVGA 3SU8A 4UEKA 1HNZB 1NUUA 1EGHA 2HYDA 5I7AA 1Q7RA 2H16A 1JSZA 1USVA 1GYQA 4HX9A 2XKKA 3IKLA 1F0KA 3BIFA 3OQOA 3KLNA 4NK5A 3TX2A 3ECSA 1Q0TA 4HPWA 4ZOEA 3O1LA 3OIFA 2WLTA 2XMBA 3QRWA 3D0KA 5IDXA 1W8DA 2BFBA 1T34A 2CXTA 3B20A 5H83A 4PRZA 4HAOA 3SZMA 3LCUA 4HR7A 3ZGZA 1EX6A 1FUKA 1MLDA 1RWNA 1Z6AA 4K6HA 2AUNA 3DJYA 1M0SA 3U1BA 3EEOA 3MN1A 2DWPA 1G20B 4L8YA 4PQGA 1BU5A 3K9NA 1Y3AA 3CPSA 2AQHA 3H5OA 3B51X 4GU5A 4WESA 2FNAA 4BJHB 2YN4A 4N76A 3BWEA 2FI1A 3UW3A 4UC0A 1VE9A 5GJCA 3TLMA 1XZJA 4G24A 4KV9A 1E63A 2CUNA 1IN5A 4ZP1A 5ECYA 1XA3A 1OA0A 1SIWA 1Z0FA 1H23A 2Z57A 4F85A 4QNRA 4Q4JB 3UJHA 2F4VB 2C3UA 5G3YA 3RTAA 4BRSA 3E27A 2AOVA 2Q4EA 1XHLA 3OE4A 4JYMA 5FIUA 4ZOLA 3R74A 3U0BA 3TSWA 5JR3A 3FNQA 2W37A 5BR7A 5IYZF 4BEWA 2F3RA 2XITA 1EP2B 4MUMA 3G0BA 3ZV6A 3E4CA 1Y3HA 4EFKA 5LQUA 4ZQCB 3NUQA 2NTYC 4DXAA 1USKA 5K6RA 2C1EA 2ZSJA 1W88A 4CTKA 3NHZA 1UEIA 2FWRA 3D4LA 4TWZA 5C8XA 4ZI7A 4R16A 3O7MA 3KKEA 5C37A 3DV0B 4ZO9A 5BN4A 4DB2A 1Q6YA 5F2KA 1GZ3A 2YIVX 3B1YA 3UFXB 3KTOA 2O3RA 3A11A 1TQ8A 1KO8A 1MO5A 2QM3A 4G1UC 5AVJA 2C3YA 3LT5A 4N7JA 2IPLA 2RG1A 3I45A 3KJQA 2ERXA 5E3IA 3RKUA 4B79A 5AW8A 1FUUA 3CCCA 3LUAA 4KXUA 3IEPA 4ARZA 3VO8A 3G0GA 4EYGA 2QD3A 3NDIA 1DMSA 3BE4A 4H3KB 2XBMA 1EAMA 3CX4A 1KFJB 3DP7A 1XB2A 5JARA 1PKXA 3X2FA 4GYKA 1JIQA 2XT0A 1CUCA 1BC5A 4WDQA 2ZAOA 3ZVNA 2VAVA 2QQ0A 5DKFA 1Y3IA 1XNJA 2VZ0A 4GMHA 3EEQA 3W3ZB 4KLRA 2HQBA 1DG3A 3EIOA 2A0WA 3KL4A 5JNLA 1B41A 2X15A 2V5AA 2DWUA 4HVTA 1ETUA 1T10A 3DW3X 5FR1A 5FTMA 3RSLA 1ZM3A 5D6OA 4CMIA 1CS0B 1P39A 3A6HA 4IXWA 5EXSA 2IUEA 1F6DA 1NOJA 2CE2X 3JQBA 3MJEA 5CLQA 4JLWA 4UUMA 5EWJA 2LNDA 1ORDA 2PMDA 1L6IA 2DX7A 3CRQA 3DZDA 3STXA 3UA3A 4QEKA 2HTFA 3AVVA 1Y9DA 3D1JA 3HO1A 4R84A 1TU4A 2XZOA 2F1RA 4F71A 2G5CA 5KB3A 1GL6A 3VU9A 2CUKA 3E1GA 5ELXA 3H8SA 3MTJA 2GM3A 2ZPTX 3ELYA 2CL5A 1W6UA 3EH2A 1KVQA 4N6OA 3JQCA 1DUVG 4ILEA 4YRLA 3KTDA 2W2XA 4G63A 3DO6A 1J4AA 1I4TD 1PR0A 1KQNA 5JFOA 4CRWB 1B8NA 4XDGA 4J0GA 1CRWG 2Y0PA 4MVJP 4ZQFA 4BMNA 2AG6A 4YLGA 5KOJB 1Z7YA 1IY2A 5E3JA 1OB5A 2ANBA 3JQPA 4C7VA 2JW5A 1Z0AA 3A7EA 2AW5A 1H65A 3CKKA 4U2KA 2WSIA 1GSAA 1ZHHA 1QYDA 2YXDA 1LU9A 4O4IB 4WCFC 2BEKA 3HCWA 4V0MA 4J0EA 3VDNB 2I1WA 1JV2B 3N0XA 2RHCA 4GLLA 4W8HA 4LF7B 4LXHA 3NYWA 2C04A 3C3JA 4JL8A 1JKMA 2KS6A 3OZXA 1EG7A 3K6SB 4RLSA 1C29B 5D86A 3IE1A 1KI9A 4XZ3A 2QRVB 5FT9A 3URKA 5C1BA 4UU7A 1EWVA 4WGFA 3VJMA 4K6MA 5T6MA 4X54A 1G8PA 5HM8A 1Q0UA 1LTKA 2IEGA 4IMIB 1NVTA 2GYUA 3BH0A 2WIAA 3O2NA 1YB2A 2CBGA 1D03A 1L5FA 2Q3MA 4DSZA 4FWTA 1U28A 4RVFA 3SF8B 1FY2A 1KH1A 3EUWA 5K0ZA 4LXTA 3WY9A 5IP5A 3UJNA 2A58A 2C9CA 3KSMA 4RJ2A 5DISB 2FP3A 5HQ3B 3DC2A 1AZSC 5KTYA 4BTVA 1UC9A 2HWWA 5EHQA 3M1LA 4X1IB 5A06A 1AUQA 2C9DA 5HG0A 1U3UA 2VUSA 3G13A 4N6NA 2B1RA 1GQ2A 1P80A 4G9GA 3VU1A 1U3VA 4BNDB 2JKVA 1JWLA 4JI8B 4EQZA 4YAEA 1JEYA 3L1UA 4G41A 4KPYA 1Y4AE 3JZIA 3RSOA 4B6GA 3LXMA 2GO7A 4YP9A 3DUFB 4HX2A 4FOOA 3U1TA 2A9QA 1PLKA 1Y4SA 5A2QA 5JDIC 4HWRA 3Q5DA 4ALIA 4B4VA 1R0RE 3CSDA 4XWTA 4DMKA 1E9BA 2P8JA 2A33A 3L06A 5K4HA 2H1VA 3IBYA 2GGSA 1D4FA 4P84A 1WZEA 3H4VA 2JLXA 4X90A 3PJGA 2A5FA 4GW3A 4WX2B 3CVWA 3D6UA 3EQ6A 4KQWA 1QYCA 2RI1A 1U7DA 1E2QA 1VPTA 2P4SA 1H93A 3DKKA 1T26A 3ISTA 5DV9A 5K8IA 1YZVA 3FW1A 4G0MA 3VYTB 5E9QA 1MC5A 3N8IA 1Z13A 1E3IA 1L5HB 3UJ6A 5JXWA 3MVEA 4DHWA 5J3JA 3QTTA 4TUYF 2QG4A 3CZ4A 4OHZA 5IKEA 5LQRA 1YF3A 1XNRB 2JAOA 4XA8A 5KWEA 1ZR4A 5CH5A 1OZFA 2NZ8A 4R05A 1UMDB 1YNOA 1H2BA 2GCNA 2YINC 5G1PA 3TTYA 1J8QA 5JATA 5CT9A 3HCBA 4GMFA 3S4YA 1YSCA 1WY5A 3KYBA 1NPYA 5IM5A 2G63A 2M1ZA 1HFWA 1JWAB 2RGXA 1V8DA 4HWKA 4MIKA 4NBSA 4X45A 4GQIA 4RK0A 4UOEA 2I6QA 4A1OA 5I9MA 1Q1BA 4BNDA 2J0SA 1C14A 4PBTA 3VH4A 4OSPA 4Q3AA 2SICE 3P9PA 3GRUA 1SUEA 1A88A 1T25A 3O1IC 5CNMA 2XE7A 3HADA 4GVPA 1B6TA 3LVFO 3FRHA 4A36A 2RJNA 1JYFA 4GRIA 2O6LA 1K97A 5EXDA 2F9MA 5LMUB 1EVLA 3CU5A 4RCVA 3CLSD 4ZQGA 8AT1A 2IPMA 1RT9A 1ND5A 2VJLA 4ARCA 1FLNA 3DM9B 5CVDA 5KUTA 2C4TA 1L1RA 3EQ2A 2EC5A 3KHKA 5FUVA 4IZ6A 4NENA 1EK0A 4LOAA 2WP0A 4CCWA 1LCIA 3L82B 4HQKA 2F1IA 1W34A 3FYSA 1BXRA 3LIIA 3RWOA 4IS2A 3NKVA 5JZMA 2P2DA 3TDNA 3I4FA 5JHHB 4WUVA 5EWLB 4ZEVA 3ZHYA 1IOVA 2QD5A 4HB3A 2UVQA 2NM0A 1JG1A 1FOEB 1ZOIA 2JS7A 5CB0A 1Z4KA 1GUFA 3PWSA 4AXBA 2FYTA 3VHQA 4EX6A 1H69A 3H3JA 3JVDA 2J9FB 2IYVA 4MS3A 5JAPA 5HWSA 4XWWA 5AM4A 4H3VA 1GCGA 3AI1A 1YDGA 3CG4A 2VWHA 2WKRA 5DGDA 3I61A 2E4WA 1G8GA 4KPUA 5FI3A 3OH8A 4OV6B 4R6XA 2P91A 5TV2A 4D56A 3L4JA 5HEKA 1UXKA 4WERA 2Z5LA 1IZYA 2A4MA 4EW6A 3R23A 1ZAKA 3AUTA 4RKFA 1YA8A 2GLTA 4CQNA 1DRKA 1P4JA 1A2OA 2CE7A 2ZATA 1RHMA 2J6HA 1ORTA 1RAGA 4DA0A 4EABA 3ER8A 3UHFA 2X8LA 2Z83A 5FJJA 4DDVA 3WO0A 4E31A 4TTAA 1XEAA 1YKGA 2R5WA 3ADKA 4LQCA 2FVYA 2M98A 2ZPUA 3QELA 1XSEA 4JS0A 1V47A 2IE8A 4FEAA 3ZIAD 2YWJA 4YMHA 1A7UA 1ZGBA 2HJWA 1KI7A 3P27A 4JUFA 4E88A 1DEOA 2NMVA 3LDAA 1WJGA 1QQ5A 4KIWA 3QE0A 5E6SB 2VDNB 3COWA 3I2YX 5FPHA 1R27A 4A26A 4CPDA 2WF7A 5CEEA 2XTJA 2XXJA 1MOQA 4QC2A 3VAYA 1AXRA 5B4VA 4L7VA 3S2UA 1JLLA 4LI3X 1GILA 4YS6A 2LKCA 3TNLA 3D7KA 1IHUA 3QF4A 4G36A 1C8BA 1MHPA 4B3BA 3LE8A 2GXAA 2ONZA 3R7WB 4O59O 2XX3A 1WBJB 3M82A 2XZLA 4HYYA 1Z6TA 1N7GA 4YJHB 4PN3A 1IXRC 5DLYA 4RYLA 2Q2QA 2J3MA 1AC5A 5TEWA 3HK2A 4EMTA 3P5SA 1M1NB 5IAKA 2QQ5A 1DKQA 4RGVA 4RETA 4N9QA 5D3ZA 4ZYYA 4JOSA 1DRWA 3UWOA 5KX5A 1L4UA 4H17A 4RHUA 4RH3A 1C3LA 1MAWA 2ERYA 3EH1A 4DLPA 1NR1A 1E2DA 1RXSA 4II7A 3KVRA 5CGQB 2W43A 1KI8A 1QIIA 1BW9A 1I33A 1EQAA 2VA8A 3WTCA 4Y3UA 3FOEC 2ZJAA 2HMAA 3RRNA 3HP4A 4IQFA 1UKEA 1NTOA 1JKXA 2WHPA 4I9GA 3ZK8A 1KFEB 2GKSA 4C14A 2ZYVX 1LQUA 1SCUB 4E12A 1T0HB 4A9AA 2F8MA 2ZVDA 3K1JA 1C8KA 1JLKA 4WA7A 2JB9A 2V4MA 3FWZA 3N9IA 3NONA 3R0QA 4YQZA 4ZTBA 2UXBB 3QOFA 1H8EA 1NOKA 3D59A 1DC7A 1Z2CA 1B8VA 2BFMA 2Z2IA 4M99A 4Z4IA 4I4NA 4N54A 3H1EA 4YRKA 2OEPA 3B13B 2QL5A 1R0XA 3KUDA 1C4OA 2SECE 2ZRGA 3D6VA 1U3DA 4AN4A 4BMCA 5IXSA 1XPUA 3JQ7B 4ZRNA 2I4MA 4X7BA 2NZVG 5EE0A 4DJTA 4UE6A 2HA2A 4M7PA 1POXA 2PS1A 3EFOA 1TUIA 2QRKA 4QSHA 2LKDA 2QS9A 2CB9A 2R5NA 1D0IA 3AXTA 1GPH1 1WR8A 2HDHA 2X9QA 3D3WB 1MO4A 1P62B 2R25B 1V1JA 4A2WA 5TR9A 4L0MA 1XNQB 4S1PA 2CDBA 3ZXYA 3NWJA 4I2NA 2FCRA 1Y9AA 2R751 4Q9IA 4BC1A 5C0OE 1OJLA 1E1QA 3ZY4A 4BKOA 5BN3B 3GYGA 4XGKA 1YB5A 2OHHA 4LVCA 3CB2A 1JBEA 5B7GA 2IXEA 2NGRA 4MCIA 2XYQA 2QT9A 5AUOB 4IVPA 4EHBA 2QX4A 4COKA 3OZEA 3QE4A 8LDHA 1F2UB 4XARA 3P0IA 4C43A 1DWUA 5AK5A 1DT3A 4OK5A 2YWEA 3K73O 2GQ0A 1GITA 4ARVA 3FUVA 3T35A 2R8EA 3LSTA 1DO0A 2YCLA 4I9HA 3KDAA 1YQWA 2FX5A 2VNSA 2A0YA 3K1AA 5TDHA 3WRYC 4H0NA 4H1TA 2FRVA 4F21A 1ZHOA 1GKLA 2PDAA 2E18A 4LKOA 1PCXA 3IUNA 5BSWA 3L1IA 3K6JA 3V9AA 3BGIA 3IUPA 2QSYA 4MV6A 3KCQA 3OPYA 2YC4C 5CA1B 2VSXA 5BR1A 1G8FA 3V6MA 3LGSA 1TUGA 3OZDA 3PE6A 4H35A 4KXQA 5J2TA 3RSSA 2UYCA 4WCFB 1E0DA 2WYWA 3HJRA 1U8ZA 1EE1A 3L8CA 3ZNQA 1G20A 1W73A 4MUNA 1QONA 3RVRA 3LLUA 1P17A 4LBZA 2IV3A 3V1TC 2J7PD 3FUCA 4K6FA 2I99A 1JL3A 3HXTA 4XI9A 3ZVKA 1SQ6A 1ZIDA 4C3VA 2HK7A 1Y7TA 3K0FA 4LS3A 1ZA2A 4RF5A 4RVHA 1VMAA 3GNSA 5AKJA 5T4BA 2IDZA 4B6FA 2HFJA 1YDFA 2F43A 2ODNA 3PL1A 3K2BA 5EYPA 1KL7A 3HUEA 2X8WA 1N5LA 1WULS 4L2IB 4NEQA 1CJKC 2ZR0A 2PM8A 5BQOA 4DWVA 2R62A 3DDCA 3UFBA 3R3VA 2IDJA 3DBRB 1SHTX 2XA1A 4LPKA 1OZHA 3ACBA 3Q8LA 5KCZA 4HDSB 5ES3A 1T3GA 3AHCA 2G04A 3G8YA 1XK6A 1TXGA 3KYCA 4GG1A 4IBOA 4HGYA 3NWBA 3QVLA 4LZWA 1TIKA 5U4XA 4C89A 4G07A 4ZCTA 5J63A 4NFSA 4X8MA 2L17A 3KWJA 4ALJA 4CZ2A 3AF0A 1OIVA 3PGA1 2ZQZA 2B94A 2FMXA 4GICA 4F12A 3N86A 1ML4A 3DFZA 3MJVA 2A1TR 1U98A 2W0MA 1LUAA 2V96A 2OPHA 1K88A 5TMBA 5KOJA 2WJPA 3OTHA 4KYIB 1CUGA 1AE1A 1TQ2A 2MDTA 2Q46A 3EYWA 3G5AA 2NZWA 2PCJA 3QBEA 4XJVA 4TKVA 4N82A 3AR7A 1RMQA 2XSZA 4PYLA 2WVAA 3WIEA 4L3OA 4DABA 3K6KA 4RTSA 4YACA 4MUBA 4EHJA 4AMUA 3CH7A 4Y1FA 2Q4OA 1Y7IA 4HDQB 2F6RA 2VJYA 4P53A 2AL7A 2XVXA 5TGTA 3U39A 4NU0A 2IW3A 1QVZA 5BW4A 2FFQA 2MU1A 4UQOA 1FQOA 3ORQA 4C88A 2Y3IA 3U9SA 3RSFA 2LWIA 3AKDA 3GR6A 3EQ9A 1Q2XA 3NHBA 3A6PC 1G7CA 3TSYA 4BMPB 1HE1C 2MT9A 4GKVA 1V95A 3V6LA 1VG0B 2DY1A 2NO7A 5M5BA 1CPYA 3MIZA 3G0HA 4H59A 1RZUA 1SAYA 2FZ5A 2KI5A 4LF8B 4LJ4A 5AW9A 4B3SB 2VTVA 4EKYA 3V48A 3MD9A 3Q3HA 4ZDJA 1COWD 1TLFA 3WB0A 4NXNB 5AVWA 2QRHA 4NYJQ 5J2TB 4C4YA 5K8JB 1GVHA 2F4NA 2WTXA 4ZAWA 3SJZA 3EF0A 4IZIA 4S1OA 5DE3A 5EMLA 2DVMA 2N9UA 3N2GA 2QYOA 3UXYA 1PL6A 4HV4A 5GIPE 4H1UA 4Q4HA 4FM9A 4N49A 4PAMA 3EARA 5CYPA 5LMCA 4BVKA 3F1LA 2GR9A 1R88A 1BKSB 3RUDA 1EJBA 3BWXA 3HN6A 4BE4A 1HT0A 2CL0X 2JCYA 3V7YA 1KHHA 1K6JA 2CMFA 1TM2A 2C95A 3PDIA 3K0AB 1DXOA 4ZO6A 5J5VA 4EF5A 3R3UA 2OQIA 3X2EA 2ESRA 2VL7A 3T4PA 3KHSA 2G09A 3LY5A 3N1UA 1JVNA 3CM0A 4AJIA 3FLEA 4OHKA 2Y66A 1TFRA 1W4RA 3C15C 5EN4A 3IQEA 5TEVA 3CEMA 3ZU5A 2EIHA 2CW5A 2ONCA 3RYCB 1L4FA 5CBPB 3MD0A 1IPFA 1V2HE 2M1XA 4BWVA 1QNLA 4JK3A 1I9CA 2HCTA 3IMFA 3OBBA 3ZEIA 1NVWQ 3V4VB 2WB4A 1UFQA 5BP7A 5F12A 2VPPA 2D3TA 1UDRA 2BHRA 3PYLA 4X8OA 2CFRA 2PWPA 3PNBA 4ER7A 2EJCA 3NAQA 4RMHA 3U7JA 2AEFA 5FUXA 4OGKA 5IVDA 4MPJA 4F2DA 3UBTA 4C7KA 3G89A 3ZQUA 3URMA 1U0NA 1TT7A 1UZNA 2QW1A 3WGQA 3UW1A 1A5BB 1JE0A 3MMNA 1UMKA 1QQBA 1FDVA 1QH8A 1PVVA 3LZ6A 1Y81A 2XJ9A 2VC2B 4Y2UA 4EY3A 5IDVA 4MO9A 1W2HA 2Y4NA 3PUKA 3AXSA 4EATA 4D25A 2VT3A 5FI5A 1ZK2A 4AG5A 3OU6A 2UZ4A 2W7TA 1P29A 1FMCA 1D0SA 3PT5A 3NNSA 4EQ6B 1UJCA 3UXMA 3G5TA 4G4SO 3A6JA 5ALRA 1V7CA 1DEHA 4Q00A 2CY0A 1L7RA 3U61B 1SK9A 3RFTA 3QVGB 2ZYUX 1YGPA 4DA8A 2GEFA 4PICA 4DB4A 2EBWA 3TFQA 1PZNA 3EDOA 5TF0A 4LRQA 3U4QB 1JJFA 5THQA 2W11A 5E1BA 1YO6A 2XQVA 4ZPJA 2OFXA 1Y4ZA 4HO1X 1RE0A 1I5OA 1U0FA 3E9RA 4HAZA 3TLZA 4CIVA 2PUGA 2V45A 2HQRA 4ZHQB 1E5DA 2C7BA 1MABB 5B58T 5ENZA 2RH5A 4ZAXA 1ISFA 5F64A 1FDUA 1L4MA 1Y9JA 2GAIA 3E70C 1ZS9A 4Z0TA 2AI3A 1NYRA 2XTAA 1RFGE 2H4ZA 1P4AA 1V2GA 2FV8A 4BGUA 3RVOA 4ER6A 3VR6D 4ZK6A 2ZI3A 1DAGA 2H4HA 4AY3A 2ZVQX 3GDFA 4JR1A 1P75A 1UDAA 3RRZA 4EKNB 5CYGA 3F73A 4QT4A 1MORA 1VL5A 5IKMA 1VJ1A 4FC6A 2WJYA 2C00A 1I32A 3K16A 1QQ6A 3EMVA 3R0XA 4UVHA 4JYCA 1UBCA 1JMVA 2R48A 3EJ6A 3M81A 1NVFA 4IUBS 4NE2A 5BOSA 2AG1A 1CUXA 2XVYA 4CLRA 1XJ0A 2DC1A 3NYQA 2JCSA 4WL0A 5EIBD 4ZCSA 1NF3A 2IH5A 2VHVA 4YJ3F 5HIMA 2G77B 1NNSA 4N3GA 1PW5A 1ZNXA 2HU7A 2Y68A 3I8OA 1M33A 3IP9A 1P9OA 4N1AA 3SC4A 4A3SA 4ITVA 5C8YF 3I62A 3K71B 4DCUA 2QZ4A 2Z6QA 5EHXA 2ZWPA 1YS4A 1Y1RA 4ZAFA 1Z88A 3PCXA 1CERA 3EULA 4DXDA 1FXWA 4LG1A 3UWMA 4GEKA 3VX3A 3O8RA 4BBAA 5LXTB 3GPIA 5MGBA 4OP2A 1TC2A 3G2IA 2G9NA 2GWRA 3RDPA 1Q3HA 3TF5A 1CIPA 5JNTA 1P9NA 2X0EA 2WVJA 2QT0A 2R6AA 5CH8A 1ZOOA 3C8ZA 2P75A 4QOIA 1PHPA 2LGJA 1P1IA 3RK1A 4CQJA 2SKDA 2PSDA 4E51A 1MAHA 5IEBA 1HE3A 4W7HA 1QRAA 1KK0A 3G2HA 3NM6B 4ND8A 4BX9A 3D6TB 3Q7EA 4R69A 1OU0A 1VSUA 1SULA 4ZI7B 2XDAA 5AK0A 4P4UA 3DZJA 1KDTA 2YZNA 3GROA 4GBMA 4HDMB 3UMRA 3E5NA 3GRKA 4NBNA 1B1CA 1PDOA 2EHDA 1QIEA 1XG5A 2BBTA 4GBED 2C5AA 4GX2A 4I81A 4IZHA 1QYIA 1R6VA 4DA6A 3SDZA 4N7MA 3EQZA 1EXWA 1YS9A 3HZOA 3I8SA 4HWTA 4EHKA 1UKYA 1JXMA 1YXMA 3HWWA 4Q02A 5L7YA 1IEQA 2Y1XA 5JZSA 4Q1DA 3PBKA 3FYUB 4K46A 4K9PA 2W0SA 3VAZA 1CT9A 1E18A 4P58A 1W4AA 1X7ZA 3H19A 5TPWA 3GVXA 4EYSA 4KSYA 2QM8A 1M2OB 4NBVA 2Z08A 3USES 3EVDA 1BFUA 1O6ZA 3BHJA 3N7TA 3OKAA 3QPBA 2A59A 1GO2A 2VLBA 1KI1A 4L5BA 1QGYA 1U7PA 4BB0A 4DKXA 5AWFC 2NAPA 5JH7A 3QOXA 1XQ1A 3GLKA 3KJHA 5U9CA 3IMEA 3KWMA 4BFZA 3PC7A 4KYUA 4FFBB 4FZVA 1R0YA 1A0OA 3KZNA 3E61A 3VM6A 4JOQA 5KHLB 1SXJE 1G5HA 3CRMA 3FGNA 3D2BA 4LXUA 4UE3S 4DDHA 1XCGB 2JJYA 4HT3B 3HCAA 3MHPA 2AFIE 2PUCA 5ILOA 3WG9A 4OHPA 1P72A 1O5IA 3ZD6A 3H75A 3G5MA 3H9GA 4PLHA 4WKOA 1WKBA 5JPCA 1M0WA 5LIPA 1KRHA 4ZT6A 4OBWA 3PYMA 4UBOA