2AN5A

Structure of human pnmt complexed with s-adenosyl-homocysteine and an inhibitor, trans-(1s,2s)-2-amino-1-tetralol
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
258
structure length
258
Chain Sequence
VASAYQRFEPRAYLRNNYAPPRGDLCNPNGVGPWKLRCLAQTFATGEVSGRTLIDIGSGPTVYQLLSACSHFEDITMTDFLEVNRQELGRWLQEEPGAFNWSMYSQHACLIEGKGECWQDKERQLRARVKRVLPIDVHQPQPLGAGSPAPLPADALVSAFCLEAVSPDLASFQRALDHITTLLRPGGHLLLIGALEESWYLAGEARLTVVPVSEEEVREALVRSGYKVRDLRTYIMPAHLQTGVDDVKGVFFAWAQKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mode of binding of methyl acceptor substrates to the adrenaline-synthesizing enzyme phenylethanolamine N-methyltransferase: implications for catalysis
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Phenylethanolamine N-methyltransferase
total genus 90
structure length 258
sequence length 258
chains with identical sequence B
ec nomenclature ec 2.1.1.28: Phenylethanolamine N-methyltransferase.
pdb deposition date 2005-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01234 NNMT_PNMT_TEMT NNMT/PNMT/TEMT family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2an5A00
5U4XA 3REOA 4GBED 5K0GA 2CL5A 4R8SA 2ONZA 2G72A 2JHPA 4LWOA 1SQGA 2AOUB 3UJBA 5CVJA 4POOA 3HP7A 5BP7A 3TKYA 3VYWA 4PGGA 3EPPA 3LCCA 1RJDA 1FP2A 5FA5A 1FJXA 2AN3A 4GQBA 3LBYA 5LQAA 3VC2A 2IH2A 4YV1A 2QE6A 2O57A 3HCAA 3HEMA 4HTFB 1M0EA 2ZZMA 4RTKA 5FQNA 4ER7A 2PWYA 3NWBA 1JTFA 1D2HA 4RX1A 5C0OE 3PTAA 3Q87B 4Y30A 5E9QA 2A14A 1UIRA 4HGYA 1P1BA 4XUCA 5GIOE 2P7HA 3OU2A 3CGGA 3KPUA 2HWKA 1X1CA 1T43A 1MJFA 1Z3CA 2FHPA 1G6Q1 2YR0A 2ZW9A 3IHTA 3P9IA 2AVNA 3TM4A 4ER5A 5EZSA 4PYQA 1ZHFA 3P71T 5T64A 3F4KA 1UWVA 3SSOA 4QVGA 3V8VA 2OXTA 4B17A 3UJ6A 3SXJA 5C9ZA 2K4MA 3I5UA 3CCFA 1JQEA 4PCAA 5EMJA 1L3CA 5EIWA 2BR5A 1N2XA 5K0JA 5CVUA 3FUXA 5CVVA 3U81A 2PVCA 3A7EA 5GOZA 5GM2A 3SR4A 2G1PA 2CMHA 1QYRA 4GOOD 2G71A 3A7DA 2PV0A 3TMAA 3CKKA 2GS9A 4RTLA 3PFGA 2P3LA 5FCDA 4GOND 4QDKA 3K0BA 3DMHA 1NE2A 2YXLA 3B89A 4RTJA 4A6EA 2IH5A 4C4AA 4E30A 5K0FA 3GIWA 3OZRA 3DULA 4HTFA 4OQDA 5GM1A 2OBFA 3EVFA 4PYLA 5JR3A 3HCBA 1XVAA 5GIPE 4AZVA 2WA2A 2IFTA 3SM3A 4C06A 2ZWAA 4HH4A 5EEHA 4M7RA 5EIFA 3FZGA 4PIMA 5ICGA 4GOLD 1OR8A 2OKCA 2FRXA 3LPMA 3LCVB 4AX8A 3UJDA 3CJTA 3SSMA 1AQJA 5DM4A 4LECA 5DRYA 4RSRA 4FS8A 3M6UA 3CVOA 2PSSA 3DUWA 2JG3A 4ZTBA 2ZIFA 2I62A 3D2LA 3EGVA 3IEIA 2ESRA 3OE4A 1FP1D 4DKJA 5DPMA 2PXCA 4CWAA 2YVLA 2PJDA 4CKBA 3JWHA 1D2GA 3C6MA 4IWNA 3FPJA 4E2YA 1EIZA 3H2BA 3UJAA 1QAOA 1NT2A 1H1DA 3KQSA 5EKUA 1PRYA 3T7SA 4Z2YA 5DTQA 4ISCA 4KIGA 2AOWA 1WY7A 5FHQA 4QDJA 1VBFA 4RTNA 5EMMA 1NW3A 4P58A 5LQRA 3ER9A 3CJQA 4BLWA 4CTJA 5F2KA 1HNNA 3KPYA 4KW7A 3TR6A 5LQKA 5CIYA 3K6RA 3EVGA 3B7PA 1VE3A 2CKDA 2YXEA 3G5TA 1X1BA 3LKDA 1WZNA 1ZKDA 2PWPA 1Q0TA 2ERCA 4ER3A 3QOWA 3FUWA 5FHRA 1EJ0A 2VS1A 3P2EA 4OBXA 2NP7A 1G38A 2AOTB 4X1OA 4DCMA 3MQ2A 4JXJA 4FGZA 3FRIA 2YX1A 2OB2A 5FULA 1WXXA 5G02A 5ICCA 3EMBA 1SUSA 4IV0A 1YB2A 3BWMA 1U2ZA 2XVAA 3GRVA 3KQWA 3NWEA 5E1OA 3KPVA 5FADA 2XYRA 3C3YA 2Z6UA 1RI5A 1KHHA 4BP3A 2XBMA 4DMGA 4P7JA 4FZVA 4G56A 2UZ4A 2I9KA 1BC5A 1Y8CA 3FPHA 1IXKA 5GP1A 3NJRA 1I1NA 1XDZA 4EKIA 5HIKA 2PX8A 2H00A 3KQYA 4MQ4A 3T7RA 1EJ6A 2EG5A 2ZBPA 3V97A 3TM5A 1EAMA 2JJQA 2ZLBA 4X60A 3FPGA 5DM1A 5FWAA 4E33A 4PIPA 5K0CA 2HTEA 4RVDA 1JG4A 4X41A 4V0QA 1R8YA 1L1EA 3FTDA 5DLYA 1NBHA 1YUBA 2PLWA 3GGDA 3O4FA 2BM9A 4E2XA 2ZFUA 3LBFA 4RTMA 3ELDA 3G2PA 3A27A 3DXZA 5DRTA 1QAMA 2B9EA 3P9KA 3B5IA 2P40A 1L9KA 3BUSA 4RV9A 3OPNA 1RI4A 2YTZA 4R8RA 2GH1A 3E23A 3NDIA 2IGTA 5CM2Z 2AN4A 2ZZNA 2YQZA 3IV6A 3BKXA 2PKWA 3M6VA 3LDGA 5HEKA 1L3BA 4EK9A 2NNWB 2O06A 1V39A 2N47A 2ZULA 4L7VA 5ERGB 5FA8A 3DR5A 4K6MA 2PXXA 5HIIA 2NXCA 3GRZA 4XCXA 3SSNA 2P35A 5K8VA 2IDJA 2ZBRA 3G2MA 3PB3A 1JSZA 5GWXA 3M6WA 2OPBA 3B3GA 5LSAA 3SX0A 3DLCA 4PGHA 3FYDA 5DX0A 5T6BA 3OE5A 4E70A 4CXMA 2FCAA 3MERA 2BR3A 4V0RA 3LL7A 5F2OA 3HVKA 4GC5A 3THRA 4C07A 5HIJA 1YZHA 1VQ1A 5CCBA 4OX9Y 1NW6A 5EOVA 3FUUA 1X1DA 3BKWA 3FYCA 5CVDA 2GAFA 3ORHA 1ZGAA 1YFJA 2QM3A 2BH2A 1VP3A 2IIPA 1UFKA 3EGEA 2ZSUA 3BWBA 3EVDA 3M33A 2QRVB 3R3HA 4QQKA 4NECA 4R6XA 4U7PB 5IKMA 4FP9A 4DM3A 4YUVA 5DT2A 1BKYA 4PYMA 4RTQA 2Y1WA 2O05A 2AZTA 5K0BA 1F38A 4P7GA 4DQ0A 2C7RA 1RJGA 5H02A 1KPIA 4M38A 3ER8A 1NKVA 1SG9A 3OZSA 3PX3A 1QANA 2EFJA 5LQCA 3GNLA 2B2CA 1X1AA 4PINA 5EEGA 2GPYA 2B25A 2P8JA 3SVZA 3MGGA 3KU1A 1SKMA 1SUIA 4DF3A 4P7KA 2YUIA 3A26A 4YUYA 3UWPA 4MWZA 4U7TB 7MHTA 3AXSA 2ZIGA 3ME5A 2V74B 3HNRA 1AQIA 2AS0A 3GXOA 2NXEA 4KIFA 4C05A 3G7UA 3OCJA 3FTEA 3C0KA 1EG2A 4E2ZA 3ERCA 1XCJA 3P2KA 3CJRA 4YUZA 3G2OA 10MHA 1N7JA 4GF5A 3O31A 5EMKA 1O54A 2UYQA 3MB5A 5IH3A 4OA5A 3G8AA 3ELWA 5MHTA 2FYTA 1N7IA 4KDRA 2OZVA 2IP2A 5E1BA 1M6EX 2AR0A 1ZGJA 5EVJA 3TOSA 3UA3A 4AZWA 4YUXA 5EMLA 4OQEA 1KP9A 2P3OA 3LDFA 2ZWVA 3UJ9A 2ZZKA 2EJUA 3FRHA 3GDHA 4BY9E 2GB4A 2HV9A 5HILA 1P1CA 1M6YA 2HR1A 4RTPA 1NV8A 5DSXA 2XVMA 4C04A 8MHTA 3NMUF 2DULA 3O7WA 3FPEA 3C6KA 3B3FA 3L8DA 3HA7A 4QVKA 4WVLA 2VZ9A 3I53A 3SMQA 5BW5A 3AWIA 4RTRA 5CD1A 1XXLA 3A25A 2ZIEA 3OU7A 5LR6A 1X19A 2PX2A 2PT6A 5DXJA 2PX4A 3KQQA 2ORED 2P1DA 4QQNA 2XYVA 3FTFA 5T67A 1B42A 3PVCA 3E7PA 5CUQA 5C1IA 3NDJA 2C7OA 2QYOA 1JQDA 3NW9A 5EGSA 1KPHA 4EVIA 3MTEA 3EEOA 5HZMA 2P41A 3WSTA 1PJZA 5LQJA 3I58A 4A6DA 2VDVE 3THSA 3DMGA 3GRUA 3JWIA 3KR1A 3KQMA 5DTMA 3BWYA 2C7PA 3RW9A 3PLAE 2G70A 1JG1A 3G8BA 4PWYA 4QPNA 5DM2A 5M5BA 3EVCA 5EPEA 1BHJA 2WK1A 3ID6C 4YV2A 1XDSA 5HOQA 2ONYA 3FPFA 5EZQA 2CMGA 1XTPA 2GA9A 3BWCA 2HNKA 2PT9A 5ICEA 3M6XA 1NV9A 4RVGA 3VC1A 2Q41A 3EVBA 4QTTB 2OO3A 1O9GA 4M36A 3GO4A 1QAQA 5KYGA 2ZVJA 1O9HA 2FK7A 5EG5A 4C08A 3PX2A 3TPZA 4GOMD 2AN5A 1XJ5A 3EVEA 2OYRA 3UBTA 2Z6QA 3A4TA 2NYUA 2WA1A 3QV2A 4YUWA 2KW5A 3I64A 3R6TA 5E1DA 4AZSA 3B3JA 5DM0A 4IKPA 4FT2A 4BLUA 1HMYA 4FSXA 3PS9A 3DXYA 2C7QA 2DPMA 5ICFA 4F84A 1KYZA 3UJCA 2IBTA 3LDUA 3PFHA 3MCTA 3HA5A 5FQOA 4DCGA 2P3QA 3HVHA 2I6GA 4YMHA 3DLIA 4KDCA 5EC8A 4ER0A 2QRVA 4PYOA 4MIKA 3AJDA 5KVAA 4F85A 1NW7A 3GRYA 3OU6A 4FR0A 1Q0SA 3EVZA 1SVUA 5LQUA 5GINE 2PX5A 3GJYA 5EKXA 4XUEA 1TW3A 4RTSA 2UYCA 4E2WA 2F8LA 3JWJA 5P8WA 1JG2A 2VDUE 4UOEA 3ELYA 1RI2A 3GCZA 3HVIA 3KHKA 3EEYA 1VL5A 3GRRA 1QZZA 3LECA 1RJEA 4ATNA 4YMGA 4E32A 4EKGA 1R74A 2VDWA 1XCLA 2B78A 5LQNA 4QPPA 2FPOA 1JSXA 5E8RA 2IBSA 1I9GA 4HC4A 2ZBQA 4HGZA 2ZTHA 2FK8A 3KR2A 3E8SA 3HVJA 1JTEA 4YV0A 3G2QA 3OFKA 1R00A 2OB1A 4GC9A 5KS2A 3BZBA 3ANXA 4F86A 3HTXA 3LHDA 2R6ZA 2PXAA 5E2AA 3UJ7A 3UFBA 1RI3A 3DXXA 4XUDA 3X0DA 3BGVA 4LG1A 5EQJB 5HFJA 3I9FA 5KQRA 2CWWA 1YZ3A 4KWCA 1IM8A 3OZTA 1I4WA 2VP3A 4KRGA 4P7FA 5JUWA 4PONA 1VPTA 2ADMA 4PYKA 2AVDA 2JH8A 4RTOA 4FSDA 4PYIA 4ER6A 4KVZA 4WXHA 2JHCA 3GWZA 1R6AA 4GUAA 5FWDA 2R3SA 5E8JA 1KR5A 2HMYB 5DXAA 3RODA 2EJTA 3EMDA 4HSGA 1XDUA 2XYQA 3QOXA 3M70A 5F2NA 2I7CA 5KQSA 1TW2A 5D1NA 3UZUA 4IV8A 1G8AA 1YF3A 3DOUA 2LD4A 3MCZA 3CBGA 3UJ8A 2BM8A 1ORHA 3OFJA 2PY6A 1DUSA 2ZCJA 4R05A 4AZTA 3NTVA 3SGLA 4OBWA 1BOOA 5FTWA 3LCUA 3Q7EA 1SQFA 5BW4A 4X63A 3TKAA 1L3IA 3T0IA 4DA4A 2JH9A 2UYOA 3JWGA 3LKZA 5K0LA 3TQSA 3BXOA 3DH0A 2V7EA 3TRKA 1YFLA 5HIMA 2P7IA 3GU3A 3KQTA 3G88A 2O0LA 4X61A 3FTCA 2AOTA 5DWQA 3R0QA 2UYHA 2NP6A 2GLUA 3HA3A 3KQOA 3MAGA 3MTIA 3E05A 5D1HA 2PGXA 4M37A 2AOUA 2BZGA 3S68A 3HCFA 1R8XA 5FUBA 3UA4A 3BGIA 4CTKA 4PYJA 4CKCA 3EVAA 5E1MA 2O07A 3EGIA 4BLVA 4E31A 3KPWA 1IY9A 4PNEA 2IH4A 1P39A 2H11A 2B3TA 1AF7A 2E5WA 3FUVA 3P9CA 4LWPA 5BXYA 3R9XB 3IYLW 2Z6AA 3KR9A 4OA8A 5E2BA 1G60A 3CC8A 3P9NA 3TFWA 3BT7A 1FPQA 3KQVA 1FBNA 1TPYA 1RJFA 2H1RA 4GEKA 5K05A 1NW8A 2JHAA 1RI1A 3HCDA 2NXJA 4PCLA 3P97A 4RYLA 1KIAA 2OY0A 5EHIA 3HCCA 1R18A 1VIDA 3AY0A 4EMSA 5DX8A 3HM2A 5K09A 1KXZA 3KR0A 1JR4A 5CVEA 1P91A 1WXWA 1VLMA 2BR4A 3AXTA 1F3LA 3P2IA 3C3PA 2NXNA 3NVKI 1WS6A 3M4XA 5K01A 1NW5A 1EQAA 4Y2HA 5E9WA 4H0NA 4O29A 1JQ3A 4MHTA 2YXDA 1ORIA 4EQZA 2EX4A 9MHTA 1KYWA 3MHTA 3G5LA 5E9JA 1D2CA 3LGAA 3R24A 4PYNA 1INLA 3G89A 4R6WA 4RVHA 1AV6A 4HRAA 5DX1A 5EHGA 3RIEA 3HCEA 3DMFA 3T7TA 4AUKA 3LSTA 4QTUB 1DCTA 2QY6A 2PBFA 3BGDA 5K0EA 5CCXA 3LX6A 1DL5A 1KPGA 3FUTA 3PT9A 4RWZA 5DTRA 5K0NA 1ZG3A 3NVMB 4HG2A 1NBIA 3ELUA 2IPXA 4MTLA 3TLJA 1MHTA 3P8ZA 3DTNA 4RVFA 1WG8A 5B1SA 5DSTA 3KPJA 3KQPA 3DP7A 1G55A 1VP9A 2AOVA 3KKZA 3VSEA 4BP1A 4C03A 4DZRA 1JG3A 1G8SA 2G8NA 4FT4A 2Y1XA 1ZQ9A 2AOXA 4CKEA 5K03A 2IDKA
chains in the Genus database with same CATH superfamily
2BMAA 2Q8NA 3COVA 2DFTA 4Q4HA 2ZRPA 1WXGA 2ZU0C 5I8ZA 1HDYA 1E5VA 1RRMA 3H86A 4W1QA 4BO9A 2XTNA 1AXEA 4X92A 1GTG1 2ID9A 5IH7A 4PICA 2OAEA 2OFWA 4HB2A 4KOAA 3B1XA 1OF1A 3MNFA 3T61A 1K8XB 2HMWA 3LBYA 5D3KA 3OT5A 1PSWA 5LD2B 5ARBA 1J25A 3IC5A 1T8YA 3M9XA 3RUPA 3D4NA 1RW4A 2QW8A 3AEQB 3JWEA 3WYDA 4ECEA 3PRHA 2J3KA 4KQIA 2PZMA 4JODA 5ALMA 5A7HA 4I8DA 2XCTB 3GEHA 1W75A 2V96A 4BNDB 5KSWB 2GEKA 3A0RB 4R5HA 1ECLA 5LNK6 4QJIA 4ZO6A 1KDYA 1EFTA 1OBHA 3E5RA 2MSLA 3X1XA 2QRKA 3TW4A 3HG7A 4H6PA 2ZIAA 3QUQA 3WYNA 4R9SA 5CFLA 1GOTA 3IVGA 4RMJA 3V7FA 4KE6A 2HCBA 5GIOE 2PZJA 3IBFA 3NDPA 2YR0A 1Z0JA 3AJRA 3COJA 1QG4A 2M9MA 3VYUB 1L5ZA 2ZUWA 3ZZUA 2NT4A 1H2YA 4Q5IA 4AF6A 4QVGA 2D1SA 1UBGA 3TMYA 4HVTA 1YVRA 3RYFB 4LYYA 3WK7A 4E2WA 4FLFA 3AVVA 2YWJA 5JWOA 4RA9B 4DLKA 1JYSA 3IP7A 1QYRA 3T0FA 1J5EB 4HDNA 1RRCA 1TGVA 1DKLA 3NC4A 4J0JA 4KREA 3ZN2A 1FFSA 1FTWA 4U7HA 2VK4A 5IEBA 2C94A 1IAQA 4BUZA 1E8DA 2LP4Y 1GCGA 3F2VA 3VSCA 5CA1F 4TTAA 3F7MA 4Y1GA 3S8MA 3U4AA 2ZSAA 1LSSA 4OQDA 3R7DA 1RXSA 4XKJA 2CXSA 2FW6A 4DARA 1V7ZA 2QTNA 3KYIB 3H17A 2G0NA 3FLEA 1B00A 4TXNA 3VNAA 1IVSA 1RYZA 1R15A 2C3YA 3AR3A 3MT9A 3OH8A 4P0TA 4ZN6A 2UXBB 1JHMA 2R1TA 3KUKA 3WLOA 2QG6A 4FR5A 3CISA 4ENWA 2GBGA 4V02A 4CR8A 4ED9A 5IKPA 1CIJA 1YRLA 2O3JA 5DRYA 4P38A 1HY3A 4NZNA 2CHFA 2VQFB 3VTAA 4HZUB 4QG7A 1P6XA 4RSMA 1AN9A 3H2ZA 4RHCA 5AKHA 4TLEA 3N6XA 3SHVA 3TUIC 4XWTA 4DHWA 1QQBA 1Q1EA 3IUJA 4IJWA 1Y1QA 4WCFA 5C8YA 1OPXA 3O8NA 2XNDD 4DSNA 4IQFA 3TIIA 1WCWA 2JIZD 4OM7A 5EJEA 4YLYA 2CVFA 2OOSA 4MULA 1KYVA 5JAZA 1A50B 2GSDA 2GX6A 3QM1A 5F9FA 3I76A 5AI4A 1JEYA 4K86A 4AJ1A 4YDSA 2J3JA 3MT0A 1DG3A 4QREA 4GX0A 3PCTA 1LWOA 3X1ZA 4L4SA 3KDPA 5CB4A 3DJFA 4M1EA 3VGPA 3V1MA 1FYFA 1S2OA 2PJUA 4LJ5A 5IJ0A 3WLAA 3NTUA 3RRJA 4WCDA 3RU9A 1IHYA 1QS0A 4HI0E 1O2DA 2CKDA 4W1RA 3G5TA 2P4EA 4D9GA 4LSWA 5J4LA 2B8NA 4YROA 1V9LA 1J7KA 1OT3A 3AERA 1E59A 3TFQA 4H7FA 1W8DA 2VWQA 3C5WP 3G5UA 2Q2VA 3B60A 2II6A 1V1MB 1DFHA 2H18A 4O1MA 1E9EA 3TZEA 4JUCA 4C7OB 2WJAA 1C7ZA 2P62A 4V0SA 3F2IA 1UJ5A 2IUEA 5K3SA 4BMSA 4RA6B 5IRCD 4BC1A 4REQA 3AF0A 4G5SA 1SCKA 2I54A 1RT9A 3A10A 2I9KA 1I6LA 2DSTA 1OXTA 4S05A 1IXKA 5HIAA 1X38A 3NJRA 4B34A 2GPWA 3V4ZA 1R12A 2JGJA 3ROXA 5LKAA 4GGPA 1M34B 3G0DA 4LRQA 5DM1A 5F5LA 4C0SA 1JFFA 1UDRA 1S2LA 3K5HA 2P9QA 3CUSA 5CA0A 3OQPA 4EGJA 2P11A 4RVDA 1E4YA 5HK8A 2RGYA 3AH8A 3B1JA 3C7TA 5ITZA 1YUBA 1J0AA 4D26A 3ACCA 5HMMA 5HF6A 2FMTA 1ZYUA 2YY7A 2RI0A 4V24A 1RBQA 1T5HX 2H1LA 1BCSA 2B9EA 3EQ9A 1JEAA 5DGTA 4X7RA 3BX1A 5JT1A 1UPTA 3M6LA 1HETA 2OV1A 2PT7A 4R7GA 3MWYW 4W82A 4XWAA 3SE7A 5M3BA 3RAGA 3OQVA 3PLAE 3BKXA 2GQ0A 5FL7D 4EB8A 2ZAMA 2J9FB 4B84A 5KNLA 3PEYA 3GFVA 4Q1DA 1T8TA 3FNBA 4H3HB 3FVQA 4XCXA 3GRZA 1C1YA 1E2LA 3A6FA 4FFOA 4QXOA 4W1PA 5KOHA 3DOHA 2ENUA 4DEXA 1FYWA 3OQHA 3D5EA 2QRNA 1P44A 2P78A 2BN4A 4QGFA 5LZ5A 3OVMA 3TLKA 4YUAA 5JVDF 3AKEA 2H4WA 1O6FA 4ZHQA 1HGXA 1N8TA 3ZLJA 1QDLB 4FMDF 5T6BA 4LDQA 1MAUA 2CUTA 3HVKA 3V48A 3FX2A 1E2DA 1ZOOA 2A9JA 4HDMA 4F5DA 3NO4A 1U4OA 1Q7RA 4ALJA 1C0IA 2LZ0A 3KSDO 3EAGA 4FEGA 2IX9A 5CVDA 4C0JA 4CMCA 5FPYA 1EUDB 5C4IA 4M9ZA 1G9SA 1Y1TA 2DLNA 4MCAA 3LYAA 3R3HA 3KUUA 4TKZA 4NNPA 4CLDA 4PYMA 4HNSA 1KY4A 2PMWB 1A8UA 1CZHA 2HFKA 1NE7A 3CWCA 2AZTA 3F3SA 3NHMA 1F38A 4A8HA 1PP4A 2Q8PA 2R8OA 5KJFA 3WQQA 4D96A 4CCAA 4DQ0A 3QKSA 4D4MA 3AEQA 4GRIA 4ACAA 2ZB2A 3I1YA 3PX3A 5TDHA 1VA4A 1OW3B 1OJLA 1Y8RB 2YCBA 1N5DA 4FJ0A 1FFEA 1TCCA 2FMUA 4IO0A 4Y9DA 1NFQA 1U8ZA 3LX8A 3OBIA 4ZGWA 2FPIB 3BMQA 5I5EA 1W35A 4JYAB 3S1LA 3BRWD 2HIMA 4P7KA 5I7EA 3M5CA 2VJAA 1E94E 2WJVA 4XFJA 2PUAA 2IYAA 1WZCA 1ZH0A 3E3AA 1JHXA 1EFKA 1EBUA 2O3TA 1IIRA 1EG2A 1I3MA 4MV0A 2QV0A 3B53X 4KODA 5TF4A 3VDXA 4QT0A 3C98A 2G1UA 5TJHA 3SKYA 3L4KA 1C3OA 3BZWA 4F97A 1WOMA 3A9TA 1H2BA 5E1BA 2ZB4A 3X1DA 1KAOA 2ISCA 3K9FC 2B21A 3L0DA 3EXFB 2F43B 2Q5JA 2CL0X 2RCNA 4GT1A 4GYJA 4TMFA 4UZFA 1YDEA 3WFIA 2W6OA 3FRHA 2NVUB 4X8MA 1S2GA 4G4IA 1OLXA 3R77A 2GGSA 4LC9A 1E7QA 4MRMB 3HXPA 4TWRA 4QLBA 5JYEA 3HWWA 2ZJ6A 3K9HA 3NANA 1QFZA 1I5OA 1QK3A 2XE6A 3KTFA 8MHTA 1P8AA 3S8YA 1CUVA 5KKAA 3N5KA 1IEXA 2ZCUA 3U60B 5NLLA 4EFNA 1LLDA 2QENA 4LCEA 5CXXA 4PVCA 4RDIA 4URWR 4DDVA 4ZYVA 5HUQA 5TXGA 2J3HA 1T9BA 2PX4A 4M1WA 1OIWA 4MVJF 2Y67A 5TX7A 5HKKA 3OTHA 3I32A 3NORA 3OPYB 1B42A 4KR0A 1MTZA 2RHWA 4URFA 3E1KA 5K3DA 1CEEA 4LDJA 5FL7A 2FB9A 3GROA 1PO7A 3AKYA 3DFMA 5DBHX 3DE3X 2ZDHA 1PNOA 4H18A 4HWKA 4YWHA 4DR2B 3RFFA 1KVRA 1A5ZA 4IIYA 4UTRA 3KAQA 3B1VA 4UW9A 5JW6A 1VYTA 2AG5A 3UC9A 1PJLA 2XMGA 4KPYA 3BXHA 1F0KA 1XP8A 2W2XA 3R5XA 4DRXA 3QLEA 1T36B 5C5CA 5HOEA 1T36A 1RYYA 2X0JA 2C7PA 1JG1A 1ULAA 1FFBA 5T6MA 3ENVA 1ULSA 3UWOA 4BFVA 5EPEA 4L95C 5FI0B 2PV7A 3ID6C 3D8SA 4JFRA 3L8ZA 2CDAA 1S3SA 2GA9A 2CDRA 1KI9A 3BWCA 3L4SO 1DWUA 1E2UA 1F9AA 1MDFA 5TARA 4NOJA 1V71A 2VL7A 2ZWIA 4QTTB 4TXHA 3W3AH 3N6VA 4E1BA 4Z8YA 5KYGA 2WAXA 1O9HA 1QVAA 2GPTA 3C8MA 3GN1A 4MRVA 5EG5A 5FOSA 5IKEA 5JMTA 1H8EA 5TPZA 3JQBA 2HEIA 3ZIUA 1J33A 3VR3A 5LD2C 4PC7A 2IGBA 4AM8A 1DADA 4WH0A 1QGUB 3IE2A 4EF5A 5KVCA 4QHTA 3QFRA 1OAOA 1C9DB 3W5HA 1CZUA 2QL5A 2VC2B 2E0IA 4FT2A 3UVEA 4DDHA 2C7QA 3EQZA 3RF7A 4LXTA 5EIHA 4QM6A 2BFMA 2B5OA 4XDHA 1G3RA 5CH5A 4DQVA 5CDYA 4DCGA 3E9ZA 1XAGA 1F1BA 1K66A 2LCIA 4M98A 3K5IA 3UK6A 1SHUX 2C0PA 3ZHVA 4UDYX 4KPFC 5LCXA 3ZV7A 3GRYA 3OU6A 3UQYS 1B1AA 5MN5A 2JIBA 5LQUA 1NMEA 2LBPA 5GINE 3M5WA 3G17A 1M2GA 4EARA 1IZ9A 1EM8A 4X20A 4DMHA 5FNVA 3I2IA 9ABPA 3FGNA 4BO3A 1FL9A 3RRYA 1LX7A 1J8QA 4PRLA 3CW2A 3ZYZA 5L45A 2CVZA 3F7OA 4RVSA 1JH8A 1EA5A 2QZJA 2RK3A 4J7XA 1H42A 2MSNA 3TX6A 4WXEA 3IHKA 4E32A 1R74A 2BKAA 5EINA 1JZQA 3KAPA 4UMDA 5B6IA 5EUBA 1X8LA 2O7VA 1SPXA 4GGOA 4JL6A 4ZU3A 2IBSA 3ENKA 4FFBB 4L7QA 2HWXA 4ENQA 3LIPA 4EB3A 1ABEA 3HS3A 3KR2A 1EAYA 221PA 1RC0A 4NQZA 4R2JA 3AU9A 3QE4A 3REGA 4Q9KA 2GJ4A 4EYOA 1G1AA 2GO1A 2V8BA 2W2KA 2P2CA 3GBPA 2RBEA 2OHXA 1OXMA 2C84A 1A9YA 2MSDB 3D6NB 1P3Y1 2I6FA 3IPYA 5REQA 3WE7A 1YL5A 5FUYA 3WLFA 5EJ2A 4AMGA 5FO1A 4PPNA 3BGVA 3IQZA 3O1LA 4O2AA 2QW1A 4YAOA 3QEBZ 1V16A 4YASA 4MDFA 1XDBA 1PW5A 3LXRA 1IM8A 4DVGA 3KOYA 4P84A 3HVUA 2J85A 3OETA 4QYSA 4XASA 2IYLD 3FXAA 3TW8B 1T25A 2VH2A 1Z07A 3PDHA 3ECAA 4RGBA 2WSSD 2NQ8A 4B1FA 5J59A 1J2TA 1FXWF 4D8XA 3D7MA 2O7SA 3NB0A 4S2UA 1M1YA 1PQWA 2BMDA 1UINA 4FCVA 2JBWA 5AW6A 3EMDA 1CUFA 5G40A 2IYZA 1R2QA 3PHIA 4UM9D 1L8OA 2R25B 4B31A 1EWVA 4HH0A 4D0NA 3EZYA 1JPNA 4BQRA 1NDHA 3ZU6A 4YRMA 1BMTA 5LFAA 1WMSA 2JI8A 3DOUA 3T3NA 2XHEA 5FP0A 1G3IA 1UKZA 2RC5A 3PQ4A 4OQMA 3Q7SA 1A2OA 3A2LA 5FIUA 3SGLA 4GS5A 3VH1A 5C53B 2O0KA 4PGFA 5FXMA 3FKJA 3V00A 1VBNA 4FQ7A 3HRHA 4TXMA 4KP7A 2UYOA 3GDGA 3KJEA 3M6MD 5K0LA 5GJWC 5INTA 3NU1A 4ZWNA 4L8GA 1CUWA 1WKBA 5TSDA 1L4KA 1STOA 2FR0A 3G88A 3K6KA 2HSGA 3GCWA 2QN1A 4C1BA 4B3CA 4F2WA 3ITKA 5IVKA 2AOUA 5DLDA 1SWVA 4YCSA 4MQEA 1JL3A 5HZKA 1GARA 1R0RE 4PFSA 5A0TA 4PE5B 4YPFA 2XCOA 2CVOA 1Z0IA 5IAJA 3LLUA 1KI1A 3KPWA 3W5JA 4A8JB 4IXMA 3LC1O 1Y4ZA 1W0JD 5CG1A 2ONKA 1QMPA 2XGMA 2OO5A 2QLBA 1U11A 1TPYA 3E3LA 2AHOA 3DSRA 1UM9B 1KOLA 2R8PA 4OJTA 3PKZA 4W8GA 2HN9A 4ZVSA 5IDQA 4J4BA 4LY9A 3WMEA 2IYRA 4GICA 4MTCA 4ZYWA 5EJGA 1L7EA 4MHOA 4P92A 1ULZA 1ACMA 2EJWA 4CEIA 2I3AA 3HCOA 4MGYR 3N86A 1EUDA 3SC2B 2HPVA 4IY1A 4ML3A 4R9RA 1WS6A 2FLVA 3MS4A 2P27A 2REQA 4D9HA 2H8GA 3C16C 2XEXA 4O29A 3FPCA 3KUCA 3LPDA 5AP9A 2NO0A 2CXRA 2DY0A 3M3DA 3QVWA 4JT2A 1T5DX 2QTWB 2PDAA 2I71A 3TD2A 5EE5B 3MHTA 4D8UA 2Q6KA 3JD3A 1L7XA 4MB6A 4XVQA 2DBZA 2I4TA 4BBZA 2WWFA 3Q6IA 1YTUA 4JGBA 3IHLA 1W4CA 3R7FA 3WC4A 4PM4A 1M2FA 2PZGA 1FUEA 1OFIA 2FR1A 2ZYVX 3FUTA 4MKZA 4NV3A 4IIJB 5J63A 3TR0A 2ZIVB 1NR7A 3H1PA 1APBA 1BVHA 2DQYA 1XF9A 3SHWA 3WGOA 4CN9A 2FFRA 4MW5A 3HWRA 2I6UA 5CT8A 5FBVB 4ZVKA 1LF0A 4N3GA 5DP2A 3LSYA 2VAXA 3KZCA 3PUYA 3KTAB 3DW1X 4NZ9A 3MJHA 1JDUA 4G85A 5F7ZA 3SYRA 3AUKA 1OFVA 1XQ9A 3L77A 6REQB 1XAIA 3CPHA 2OXRA 2VF5X 2R66A 2Z8ZA 3EGOA 4KO2S 3UBMA 4A10A 1FTNA 2E6UX 3C45A 1L7QA 2FY8A 3DM9B 4HRYA 5GVSA 4JAVC 5BP7A 4NCJA 2QR3A 4NBVA 4PXSA 3TKLA 4M9RA 2ZI5A 5HR5A 4DSAA 4IRMA 1LBQA 3C7CB 1EKXA 3IMKA 1X7WB 5KTPA 1GG9A 1HG1A 1K98A 2J3MA 1BJTA 1IJFA 3RRBA 2IH2A 1ZRHA 1OZFA 1A4RA 4S12A 4Q9NA 3OECA 2JL1A 5ALLA 1GAQA 1CZOA 4DG8A 2XLBA 2PO7A 1P1FA 2OFFA 4P1ZA 1YS7A 3NWBA 3NETA 2C4KA 1CR4A 5DV9A 3VVBA 3EUFA 5BXQC 4ZT7A 2O20A 1E92A 3Q87B 3I6YA 1E32A 3DE2X 3S2GA 2ZVPX 2P9JA 1R0SA 2XGSA 4M7PA 4BLQA 4BN4A 2C9BA 4N82A 1CJTC 1F0PA 2TYSB 3S1AA 2BFEA 3RQIA 4FFBA 2IF0A 4D3FA 3K3PA 2M2IA 4WI1A 5K0ZA 3GLIB 1ADFA 2VDLB 4Q3OA 3V8VA 2VYFA 1E9FA 2QMYA 1EDDA 3UJ6A 4LI0A 3V1NA 4BQNA 2RMKA 1Z22A 3OTQA 3GD5A 3I8SA 3VVCA 2HRRA 5KWSA 1M73E 4I5DA 5T5QA 1NQAO 4RVOA 5IAKA 4NJMB 4OI4A 3VPDA 2CBGA 3AKCA 1E7YA 3M34A 3OG9A 1X1QA 3QKRA 4P9NA 4J0FA 5GOZA 1N1GA 1ACLA 2ZYSA 2GJSA 2GPSA 4DV4B 3CKKA 4S0ZA 4DA7A 1YQ9A 3BH6A 2F1HA 4GOND 3VU3A 3KSZO 1Z13A 2WF8A 4G5QA 1UZLA 3EQ8A 3D7RA 4F92B 3L2OB 4OMFG 5BVGA 4R98A 2B8WA 2HTFA 2WP0A 2JJ8A 3FWZA 3OZRA 1HE8B 1UOOA 1X9IA 1ZM9A 2R6AA 4AJ2A 5C7IO 3MJVA 3DE0X 2D2VA 1ODFA 2Z3WA 4HF7A 1AGXA 2CXOA 5AI6A 4C7XA 3IL2A 2NSJA 2X86A 5EIFA 1SUEA 1U2DA 1KE1A 1QB7A 1VE9A 1WXHA 4FFDA 2YHAA 1UBRS 1S7CA 1T2AA 1U1EA 2G9VA 3ICQB 2X5JO 3MS7A 4U2CA 4YCLA 1L5KA 1VMEA 2O5RA 2PUHA 4GNKA 1K63A 2ORWA 1GR0A 1QQ5A 1IQUA 2FZWA 3DFKA 4GG1A 4TMZA 1NJ2A 4BE7B 1WNFA 3AB8A 2WYVA 2BFNA 2XI4A 5E0OA 3TG2A 4AS1A 2QUJA 4WVFA 4ENRA 4P32A 5CW1A 1X42A 1QYCA 4IHJB 4X7BA 4CKEB 3VR2A 4BLOA 3BTOA 4II7A 3N70A 1FLVA 2ZBVA 3IQXA 1D2GA 3C6MA 4IWNA 1HE5A 1K1EA 2HU8A 3AL3A 3HXLA 2V6FA 3NR2A 4Q6WA 3WLEA 3THWB 3CNHA 1G8JA 3ZWWA 5BR8B 3O4JA 3U4IA 5J4YA 1JBEA 2BBWA 4GM0A 5A2QA 2QW0X 8ATCA 1Y4UA 3VPHA 2VDJA 3K6SB 1G5TA 1WY7A 3D31A 5IJAA 4B3DA 3D7LA 4CLHA 1OYWA 4P4NA 4Z51A 5ED4A 4RTNA 4AMZA 3V7YA 2C2YA 3BRCA 3EH2A 1E18A 1D2MA 1UDWA 4DN6A 1I7PA 3GMIA 1YUNA 1ZN9A 1IQRA 2V97A 1CS4C 2J3EA 5CK5A 5JDCC 4KH1A 2XUJA 1X1BA 2JD1A 3HSKA 1ZKDA 4WZBA 4F38A 1OB5A 2V7PA 2QLJA 4ER3A 5LZ9A 1GPKA 4HNHA 4DTIA 1YONA 2JHGA 1RKVA 3DHWC 1HXHA 4DLYA 3LT4A 4C30A 1LDMA 1TF5A 1FU4A 2QD1A 5K3BA 3RC9A 1TMGE 1Z5NA 2BH9A 2N0SA 1BXGB 1K0FA 4TZKA 4Y2QA 5FADA 2FMFA 5TQ0A 1O8BA 1P2DA 4OAPA 3ZCSA 1P0FA 4FHGA 2NUAA 1YU6A 2B35A 2X6RA 3LX4A 1N32B 3DAPA 4PC1A 2I4NA 1J21A 1U1DA 1DAMA 2QT9A 3KQYA 3NNNA 1YQXA 4FJ1A 2LKCA 3M81A 1K3UB 1QH1A 2PSHA 2RKWA 2ZBPA 1QYWA 1SVWA 3A1TA 4Q3KA 3DQZA 1SBTA 2C77A 3IT3A 3PD0A 4MDHA 4Y2JA 4JGIA 5FR2A 5BYAA 2WB2A 1YBFA 2Z1DA 2YNMD 3I0MA 3MOGA 4LF9B 3VKHA 1I5RA 1TQ8A 1UXHA 1I32A 5F23A 1ENYA 4FFSA 4P3KA 4BVLA 2QVXX 4AURA 2ASEA 4EZBA 3IT1A 1NQVA 1YJBA 4KSYA 4U39A 5L3QB 3PP8A 3A27A 4UXJA 3S5JA 2PGDA 3P9PA 1YRBA 4O1HA 4WZAA 1DQYA 3ZWPA 3VHLB 4H1TA 1MOSA 1RI4A 2CEKA 1BMDA 4ZC8A 3FGZA 2AN4A 4ZK2A 5ER6A 2PKWA 5LP6F 4U9UA 3OLXA 2NTJA 1T0BA 2OCXA 3T4XA 3UN1A 3TBKA 3ZNQA 1SC3A 1KK3A 4ZHQF 1EGAA 3PKIA 5KNDH 3EMVA 3WI7A 2PTGA 4JC5A 1KI4A 5ES4B 4NCAA 1U28C 4QNNA 3V5NA 3TINA 4MP8A 4D9BA 1WCXA 1YKGA 2PVSA 3HZZA 4U5QA 2OC9A 1ZR2A 4QGBA 5U4QA 4IGKA 1G9TA 1E0SA 1MD9A 1DWOA 2RGGA 2EP8A 4XXHA 3EIFA 2HV8A 4PO9A 2ON6A 2FPRA 3A6EA 5F33A 5C7LO 4CEIB 5CYFA 3E58A 2W22A 4QUKA 2QRGA 4G4GA 3BWBA 3C3KA 1TPZA 4GP6A 3M9WA 4FP9A 4RGYA 3CNNA 4MW0A 2HKIA 2QMZA 2GN0A 3R40A 5JH7F 3LYHA 2BHRA 4C6TA 1Q44A 1EUQA 2HXYA 2OCAA 2RD2A 3PD7A 1WV1A 2Y66A 2H9AA 4CKWB 5BWBA 4LXQA 1E5TA 1QANA 2JCSA 1J22A 3GNLA 2FPGB 1ISRA 5G0TA 4RABA 2XCSB 2GNAA 1R8QA 2CSUA 3QXXA 3KSAC 1BN6A 3BE5A 2Q7DA 1T1EA 2EDCA 3B20A 2UV8A 3OIUA 4MINA 3TVDA 4ZI3A 2B4TO 2JFOA 2BEJA 3QVGA 2V74B 3DWIA 2E4WA 3AJEA 2W4QA 1ZMOA 4OH7A 4NAVA 1HEIA 1BXKA 1KZ7B 1GM5A 2EERA 2PAFA 4CV3A 3K0AA 4EVRA 4YUZA 3KJGA 2OUIA 4XCVA 1DZIA 2VUSA 4GNRA 5C4MA 4C7JA 1GUFA 5LDGA 3SDZA 1X6VA 4A3SA 2AR0A 4E5YA 1OXKB 4PX9A 1NA5A 1E66A 1CY4A 4JLOA 4G97A 4OIMA 3BQ9A 4V03A 3HO8A 2P3OA 2AG1A 2MJLA 3LDFA 2RGCA 2JZNA 5FEUA 1SBNE 2E85A 2C2KA 2GXSA 3JR3A 4GH5A 4DPMA 5BN5B 1DC6A 5T8KC 5AH0A 1GGMA 4LCBA 5D5HA 3SC3A 2XVMA 1OV4A 2ZGVA 5TJ9A 1RIFA 2OK8A 1RWNA 3H8WA 1ZHHA 1YU9A 2LNDA 1CF2O 3L8DA 1FSGA 1VGRA 4LRSB 4PO8A 3IO3A 2R00A 3VHXA 4YCJA 3PE3A 4I1SA 4BEWA 1GPAA 4AO8A 3UCXA 2H06A 3HV2A 2AMJA 2VRBA 2Z58A 3NEYA 3PJDA 1HWYA 2HQ1A 3OTGA 3UEOA 4YBRA 1P0CA 2YV3A 5C1PA 5TT0A 2A59A 2DKNA 4FGKA 5EERA 3K71B 2E4XA 4YMWA 3EHDA 2YHSA 3B70A 4HWSA 2HMTA 2HHJA 4FYKA 4JJGA 4AS3A 1HMPA 3VOTA 4LSGA 4CM9A 3I58A 6GPBA 2Q5IA 5EP1A 2WFAA 1N2SA 3KQMA 5JRZA 2OENG 1P77A 2PKRA 4M4SA 3PI7A 5BQ3A 1TQ2A 1CUSA 3H3FA 2H92A 2QHXA 3SHOA 5IWAB 4AFNA 2GZ1A 1JIKA 2VSNA 1T15A 2AYYA 5ICEA 4TLMB 3HH8A 4RVGA 1A9QA 2PRSA 2LPMA 1DO8A 3EVBA 4PX3A 2P0EA 3P20A 4S1VA 4BFLA 5GJVC 2ZSKA 4M36A 2OYCA 4QG3A 1L5WA 1T10A 4KMMA 2IEDA 5CCEA 3O5AA 1EFLA 4TLLB 4U0KA 2VA9A 3EVEA 1RRPA 4LXYA 4L4XA 4CL3A 1PYDA 1UPXA 4MQ5A 4O2RA 3X1WA 4QDXA 3RCBA 3IQHX 3BILA 4YUWA 2I78A 3I2KA 1PZEA 3UY4A 4M46A 3WSVA 4HQ6A 2LCFA 2NTEA 4Y8VA 1BE1A 3V8PA 1EXMA 4P35A 3CZ9A 5EKSA 3R20A 4D74A 3NHSA 3DZHA 5FQOA 3VDRA 3EXFA 2IS6A 1MB4A 1F0NA 1P2TA 1Y6GA 2VT3A 1ID8A 1U0HC 2M6RA 4ND2A 4MA0A 4M55A 2Z9CA 4PYOA 1P7WA 4KO8A 4EJSB 1D5CA 3A9CA 3IQDB 4W1SA 1C3XA 3GQBB 2JAOA 1ZJZA 3TL6A 1YQQA 3IOMA 2Q49A 3LK7A 3MA0A 5JJIA 2XOKD 3NM4A 5AOAA 1V8DA 3CS3A 2WABA 2VDUE 2H54A 3P94A 3SIWA 3VKFA 4ITUA 4TT3A 1E61A 1IZYA 3BMOA 5KWIA 2PGLA 3JAMA 5J1SB 4FS3A 2X5KO 3A1FA 3WRXC 5IAAA 5IBCA 1DTWA 3OQNA 1JKMA 1ZGGA 4D9KA 3OUTA 3RSGA 3EFOB 4TTIA 1QU3A 3NT4A 1Z2OX 4I4NA 3H87A 2LW7A 3QPDA 1S96A 1JSXA 1MC8A 2A9QA 2G9ZA 3F49S 1MJGA 5KINB 1WVIA 1A4IA 2GPJA 1Y5IA 3TZKA 5LNK1 4PLWA 3UANA 1COWD 5JBNA 2JIOA 1BD4A 3OOYA 3N59A 3S3TA 3J80A 4FOLA 3ANXA 2VCYA 5EHZA 1PR5A 4HKTA 1L5SA 2FWPA 2B36A 3TLMA 4KHZA 2KM1A 3X0DA 1M6VA 1SQ0A 1T8RA 2ZAYA 1TD9A 3W5CA 4BQQA 3B6EA 1YS2X 5KTSA 2XRZA 9LDBA 3KDAA 4TYQA 1P7YA 2FN8A 4W63A 3TIVA 2HOQA 4G89A 1A95A 2FG5A 4L0DA 1KAEA 1XZLA 4KVZA 3VR2D 3LL4A 4CG0A 3PVSA 3QFHA 3VUEA 2IX3A 5CLLA 5A3VA 2HO5A 3R6DA 1HSOA 4RC9A 1E0JA 2C95A 2EJTA 3HO6A 4Q9IA 3RWBA 3NHUA 3P0RA 3TUZC 2JCVA 3EXG1 1FUYB 2Y99A 1KI8A 4MUJA 2ZR8A 1U9JA 3TCKA 3UGTA 1ZEJA 2PS3A 3EBOA 4DSUA 2RH8A 1G8AA 4XIFA 4OQZA 5U9CA 2IOYA 3OEYA 2F8SA 1Z4QA 2GMWA 4U2BA 1NRJB 1TEHA 3LZDA 3AETA 2WMNB 4MGHA 1QYXA 4YR7A 1T5IA 1MH9A 3DOFA 5LKRA 4JLAA 4FW9A 3QJYA 1F0YA 2O7QA 3JAWA 4NF2A 3VFDA 4XVCA 1LQ2A 2YHBA 3LKZA 2OPHA 4R9VA 1Z5PA 1M2OB 1UMDB 1G17A 5C1OA 1UMBA 4IIJF 2BONA 2O0LA 2Q3CA 1N34B 4P08A 3RU3A 1YOVB 3T5BA 4ZZ1A 3KLMX 4LY6A 3KCQA 2BZGA 5GVRA 3S68A 5LVAA 3I2FA 4EZEA 2G83A 1L8QA 3L41A 1H94A 5B3JA 1WX1A 3KBOA 1FS6A 2IH4A 2H11A 1XLWA 2HK7A 4HX2A 1GPH1 1QHEA 2JD2A 4BRWA 1JHZA 3RKUA 4R0VA 4KQFA 4GEKA 3I6QA 3MTJA 2NZJA 3E0XA 4MRAA 1ZM4A 4G1MB 5F1KA 1YNSA 2NXJA 1QUFA 5EHIA 3V9AA 1V26A 4O63O 1WLSA 5M34A 2ZT6A 1L7NA 4P93A 1TL7C 1WRBA 2O50A 2HC9A 1C2TA 3BFVA 1QP8A 1E2MA 3LK6A 3PUZA 4KIWA 2PO5A 1U02A 1CY1A 3NHWA 4LOJA 1NUTA 1UBKS 1ZSYA 4V0ME 4WA8A 3T94A 4ZJZA 5B3LA 4TYYA 3C3PA 1YR7A 3GNSA 3N6RA 5HJ7A 3NIDB 3AI2A 1GIAA 4ASUA 3NVKI 1GU0A 4HMQA 1TUEA 2BDTA 4IS3A 5E9WA 1SBIA 2J7PA 5LP6B 3A8TA 2D4AA 2H52A 1R64A 2R6R1 3ND6A 3OJOA 1TGYA 1N8NA 1MJ5A 1VLLA 4KAAA 2FJUA 3VJLA 4AXBA 1PBTA 4TGLA 3WV5A 4BX2A 1FCJA 2Z2JA 2GZ2A 4HPXB 5A5DA 4D56A 4C21A 4TYMA 2AI3A 3VKWA 4B0OA 5EZYB 1ML4A 5TMDA 1TQHA 3L6OO 2ZPUA 4IIUA 3I05A 2QY6A 3IBYA 4KRXA 5SZJA 2XH8A 3ZQJA 5K0EA 1RWPA 1IJBA 3OESA 1OFUX 2O4CA 2X0RA 3AI7A 3LLVA 3TXAA 3ZK9A 3SDSA 5BN5A 4G3XA 2BBSA 4XPIA 5FLXA 2I22A 2IPXA 1ZCZA 1FTQA 5DKFA 2PZBA 1OE0A 4YHHB 4MV3A 1XHEA 4ZVRA 1Z8HA 1MFZA 4EM6A 3PFBA 4E5DA 1NUQA 4RZXA 3KKZA 4BQOA 4IDOA 4IIHA 3TD9A 4EF6A 1FLDA 1K7SN 3FTQA 4U3JA 2AOXA 4NU8X 1Y6QA 4HEHA 4DCVA 1FUIA 5HKLA 5KOJA 4D6YA 4GGMX 2WHRA 4U2EA 5FFNA 4TV9B 2WTXA 3BIJA 4HDKB 4EA8A 1K97A 4X85A 5JS1A 1FOEB 3LCCA 1E6UA 4LKRA 1SBZA 4KB5A 1MOZA 3TQHA 4DV1B 1ILWA 4FBLA 1CG6A 3WRWA 5BWLA 3VC2A 3U6BA 1EVKA 1PDOA 2B7BA 3HYCA 2NUPB 3KD3A 2XUGA 1MQSA 4MVJA 2JLYA 1SHKA 1KO1A 4IWYA 4I6EA 4TQGA 3OJEA 2DBVO 1XZPA 2AW3A 4UXIA 2DR2A 4CL0A 3PTAA 2QTVA 2PBZA 2WVGA 3HY3A 4AJNA 3DZIA 4A8JA 2P9FA 1AKYA 3FFTA 1D0SA 3PK0A 1HQYE 2EYUA 1I7LA 1IDN1 3D3NA 1KI2A 4OQYA 1TJ4A 4FYYA 4TT3D 3F1LA 5CLIA 4YJFB 2HBRA 3ZIDA 1RWWA 1KZ6A 1Z2AA 4EITA 1DC5A 1ZHFA 2HF2A 4Z86A 3TTXA 3L06A 5HXAA 3TMKA 3CF4A 3KV3O 4W9MC 4QUAA 3HDGA 3LUGA 2DTXA 4OHOA 4N4AA 1RKQA 4KWEA 4UNSA 3UMJA 3BVPA 3OZGA 4FYXA 1U3DA 3GGCA 4UD2A 3NAMA 3U81A 1BH6A 2R6CA 1S2NA 3WNDA 1H9BA 2COEA 2WKWA 1YH3A 4OJYA 2ONCA 4UTZA 3WL8A 4L9WA 1NMZA 4YRGA 4RAOA 2CLEB 2DPYA 3MVEA 1KERA 1LY1A 2FR8C 3ED1A 4HGOA 4L4YA 4E30A 3HU2A 2GCOB 4GI2A 4JLUA 4RETA 1ZI9A 1SEPA 3PNKA 2DPGA 1OFUA 2OQ2A 3EVFA 4D41A 4C2TA 4W8HA 3NTQA 2IFTA 3IBTA 3AGPA 1JR3E 4PNPA 3JRWA 2BD0A 1GGEA 3FMVA 1J9ZA 5C8DA 5JD5A 1RVDA 2KQUA 3NV7A 4YJHB 1T35A 3T3IA 4DLTA 1M66A 1V6CA 3QSYA 3UJPA 4A2CA 3GJRA 4WJZA 2AG6A 3GFSA 4WKPA 3U44A 5EIXA 4JOCA 1W96A 2QX9A 3DHNA 3EYAA 5HS6A 4BB6A 1ORWA 1QHFA 1PG2A 2I7TA 4IDAA 2JG3A 1FEZA 5BNTA 1D0VA 5JY1A 4WKGA 2QG9A 1KEWA 5BNIA 3GEDA 3MC1A 3PCXA 5DW0A 3PQ7A 4ZI5A 4Y2VA 5A04A 1IK4A 1E1QA 1K9SA 4QDOA 3OE1A 2EP5A 5F4ZA 5I7VA 1U2RA 3CURA 2ZYIA 3U4HA 2F3SA 1KFJB 3H2BA 1VHQA 2LDBA 4DMMA 1VI5A 2CKMA 5HCNA 1DIBA 1X80A 3MIZA 1OXUA 3JSAA 4RK4A 3AIKA 5HKKD 3OD1A 4ISCA 4CFSA 4KLRA 1N6OA 5IFLA 2UVDA 3AZQA 1VCMA 5EMMA 5LLDA 3AP2A 3GUUA 3OT1A 3ANTA 4TQAA 1QU2A 3GBSA 4ZANA 3LUKA 3R4VA 2J8ZA 5AVKA 3U0VA 4CMEA 3TB4A 3QENA 2E89A 1BWSA 3FDXA 3FOWA 4LX0A 3ZBPA 1Q21A 2PTHA 1QK5A 1WEKA 3DUFB 3II6X 5CLJA 2O8VA 3R3WA 4EG8A 1YOBA 3GZNB 4JZKA 2LKDA 3RSSA 4HFRA 2QL7A 3QTLA 4V0NA 3L0IB 1WZNA 1X15A 4MIEA 3RBXA 1ZUIA 2PUVA 4CZ2A 1F2TB 1U7HA 2GVNA 1PEDA 4UPDA 2MHCA 3V1YA 1K06A 2WSYB 3F5DA 3KETA 2XCUA 4JXJA 4BDTA 3FRIA 1CYEA 1N1DA 2HCRA 5LPNA 1JMVA 2CE2X 3B1KA 1NDQA 3CU5A 4GM4A 3RM3A 2XLCA 4X54A 4CIXA 2XVAA 2CLCX 4GPZA 2Z6UA 3UFXB 4DIBA 1Z2CA 1Z7BA 2GWRA 3AFHA 1DO2A 4MLDA 3OKPA 3PGMA 5AOCA 5EJMA 4BPRA 2Q3EA 5I3CA 1YVPA 1E2EA 4P3XA 4XPIB 2GF2A 3ZCPA 2UZ4A 2DUNA 2FMXA 3GJ0A 2CHGA 1I7QB 1SUCA 4G9BA 4DRYA 1FMFA 4I4TF 1JXAA 5CFRA 1OYYA 3DF7A 2B8TA 3UWKA 3IEPA 1VRCA 3EA0A 4IHQA 2WUEA 3O8BA 2BMJA 3LHKA 1JR3D 2H0QA 2APJA 2X0DA 3ONWA 2Z98A 1PZGA 4PBSA 4ZARA 4Q4JB 3O73A 2G17A 3GH3A 1W48A 1NQWA 2B0CA 1R8YA 4BYMA 1CS0A 4GW3A 4RXUA 5F1PA 1YUMA 4RCVA 3T7EA 1R6XA 1VZ2A 4DC9A 5HM6A 3T5DA 2ZREA 1PKEA 1LBEA 3IQGX 1WPGA 4Z1MA 4AKEA 1QX4A 1Z12A 2CUZA 3RHFA 1U98A 3OOJA 4F8YA 2PQ0A 2DHDA 3TLBA 3KB6A 3FR7A 4KNVA 2X1LA 1BGVA 4LSMA 3QKSB 5LP6C 4D3ZA 4BFZA 1T0JB 1CP2A 3IMCA 1PV4A 1P9WA 2FMHA 2LCQA 1J6UA 2RHOA 2HCJB 2YJZA 3LA8A 1ZCJA 2I03A 3AESB 4PLTA 1M6NA 5FLEX 3RSOA 1E3TA 1KE2A 2JAHA 5FA8A 2YKGA 4PRYA 5HIIA 1U0TA 1P0PA 5THQA 5LXTA 1R37A 2J41A 1IUOA 3BMCB 3EB9A 1SOUA 5CNKA 3VR1A 1J8DA 1H3FA 1L0BA 2INGX 2KB0A 4HNQA 4UHKA 4WIAA 2NUTA 5FV4A 1U0NA 5EWJB 2O8CB 2EFEB 1U8YA 1K7YA 3V1LA 4LYDA 1GNSA 1TT5B 1PR2A 4O2BF 1GL7A 2B37A 3RB8A 3VJKA 4Z4QA 1E2BA 1M0SA 1QG2A 4FIDA 3BHIA 4QUIA 4N0DA 4C07A 4MVJP 4Q7MB 5HIJA 4HNTA 2HRZA 1M8PA 3EIEA 2VHUA 2RG7A 4ADSG 1SCBA 2CLKB 1XRPA 3CYFA 3AL0C 5T41A 3H0EA 1Z29A 2EF0A 4PTYA 2FNAA 4QQKA 4U7PB 2GJ9A 4FMDB 4E12A 2C8JA 4B4WA 2FZGA 1J97A 1TEXA 1OLUB 1ZVJA 4II3A 5IM5A 1ICEA 5JVDB 5B55A 1Z0FA 1Z47A 5KYWB 3V46A 5ALTA 3HACA 2VUUA 3K92A 4NK4A 1KK2A 2OMEA 3BD6A 3QKWA 4XLZA 1HDCA 2V6GA 3ETDA 2Q4DA 3C3JA 2R8RA 5L4LA 4H6XA 5B1HA 1GAJA 3RVRA 4BNXA 1T2DA 3NPMA 4KQJA 2BFFA 1NIPA 4BZZA 3TSWA 1ZOPA 2V4MA 2CXHA 3KU1A 2I3GA 4ASUD 1EK2A 2XCRB 2N9UA 1SUIA 3EIWA 5E6SB 1N2EA 4IHAA 3G85A 2QTBA 3DZBA 1W36B 2J46A 3NZEA 3EODA 4L6IA 3NJ4A 3AUUA 3PG5A 2XNHA 2BZSA 3H6GA 4YAFA 5DB4A 3HJRA 2A1TR 5C5IA 3I92A 3SD7A 3UG6A 3GL9A 3ZE7A 4OA5A 4RNCA 4N41A 4OGKA 4BXOB 3WDLA 4NULA 3K0CA 1LPAB 3K32A 3N1UA 1U7DA 2WPDA 4OXXA 1VL0A 2I9PA 2OM6A 1K92A 2RAVA 4WY8A 5DI3B 1AXRA 1DRVA 3ZWMA 4X3OA 4BFCA 4OQEA 3UM9A 4F56A 5E38A 2AX4A 2UVPB 3NDBB 3GRKA 3DNMA 1AKVA 3H2YA 1XZBA 1XTIA 5DHAA 2GK3A 1ZO8A 3ADDA 4OB8A 5ENVA 2GCNA 1KI6B 4FVTA 3WKBA 2C1EA 3FNFA 4R31A 4EPXA 4TRNA 1P5FA 2VATA 3C6KA 1NJ1A 1TYAE 1BDMA 1YS6A 2OV6A 2X8JB 2PH7A 2RAPA 3I53A 3PXXA 4JKYA 2ATVA 4NC9A 2OCIA 3HMQA 3CNOA 4XQGA 4KRFA 1IQPA 1UEXC 1VG9B 2WSIA 1QS0B 5LR6A 4INPA 4OMDA 4BMYA 4RIHA 4BZXA 2ORED 2P1DA 4IF6A 2F4VB 5H5JA 4Q21A 4QTXA 5E9AA 3ZQUA 3NDJA 4Y9UA 1SCQA 4Y6RA 5EXDA 4YRZA 1P5ZB 4I08A 2A33A 4ROSA 5F9MA 4EVIA 1DAOA 5LP1A 5MF6A 1EXVA 1G4UR 2K87A 3Q6NA 2QTGA 3W9BA 3CRQA 2PL3A 1UMCA 4TWAA 4OJMX 1SQSA 3D0OA 1NN0A 1E7RA 1PQYA 4NYIQ 4TV8B 3RK0A 1RHJA 5BR4A 1JDTA 4EW3A 3FHLA 1F6WA 1X0XA 2WJ6A 1CZKA 2WRZA 5JFOA 3BEOA 2ZJBA 1AK9A 4KR7A 4GVLA 2E4AA 4X95A 5EHQA 3V80A 2QD5A 4UCXA 4OLHA 2PZLA 1U3UA 1W4BA 2Z6VA 1O9GA 4MV1A 1K2VN 5DSZA 1LRJA 1S1MA 2R1VB 3FWPA 2WTBA 4IM7A 4JVLA 3T3DA 3ROEA 1XJ5A 3TPZA 2ATIA 3CVYA 3AJAA 4KC0A 1Z5GA 2CB9A 4ETWA 2WHXA 1XPOA 4QXRA 4YTEA 1IUNA 3R6TA 2PLAA 3GJSA 3WHLA 3AV0B 1C8LA 4JJZA 4MUBA 3T34A 2XV1A 3DBLA 3KT0A 2GD1O 1XTUA 2BTQA 4GI5A 2WD8A 3RC2A 3HPRA 4D4HA 2IY7A 1IYZA 3MINA 2WM8A 1CJMA 1PDVA 3HA5A 4JCCA 2JJ2A 1LDNA 5HPYB 2HIAA 4DXHA 2YIDA 2HI0A 3RLIA 1OWLA 2C5EA 1WCYA 4BO7A 2HK6A 3OIFA 2QN2A 3EUEA 4RKFA 4MWDA 3SFZA 1ZBDA 2MR5A 2AI2A 4KXQA 2FSVC 1PNVA 1SAYA 3ETGA 4BNKA 2I2FA 1TU0A 4F3NA 3PPIA 4ZRNA 5I5GA 3TTUA 1EFPB 1W0JA 1ZA2A 1E2HA 1QX3A 2R9VA 2SCUA 1UEIA 3AUJB 1EZZA 3ND8A 3Q85A 2I4LA 4IGFA 1NBMA 4RPKA 2JDID 3K96A 4K3UA 3OA2A 3RTEA 4EUHA 4ATNA 4BFYA 1HFWA 3BULA 1B76A 2BKVA 2OGZA 1EZ4A 3GB9A 1TD1A 2Q29A 4A0FA 4E4RA 4WEQA 1RWBA 3F6YA 3IFSA 4WUTA 3R9KA 1H93A 4LGMA 1I9GA 3PZBA 4HK4A 4HC4A 2C2MA 3KKMA 2Q4OA 2PD6A 4HGQA 4HGZA 2HCFA 3Q41A 1QV9A 3Q7PA 4JJIA 4ON9A 5AM0A 1PNTA 4OOFA 3HEBA 2PWAA 2D3WA 2DUUA 2X3YA 4WCFB 4EJMA 2WTMA 4QEKA 3T9AA 5JAPA 2PXAA 5ED0A 5KYNA 2XMZA 4GWLA 2DC1A 1NMQA 4YRCA 2O8FB 4WWHA 2VPQA 3AONB 5HQTA 1RLUA 5I7RA 3QYAA 4XGQA 1F2UA 1WW8A 3PGKA 4DUZB 3WYFA 5JATA 2JH8A 1JHPA 2MTBA 1NQXA 4R2XA 1H4VB 2R7AA 4WXHA 3ZKAA 1LJUA 1ZQ1A 4QO8A 5HUJA 2DX7A 2D1QA 1J56A 5HFNA 4EGSA 3TLEA 2VHQA 7ABPA 2ZI7A 3ZLTA 3QOXA 3AF3A 5IF9A 1AGRA 1ZNZA 4L0MA 3WHPA 5ALZA 4BV3A 2ERYA 5IX8A 3HU5A 4GOKA 3BREA 1NXVA 1G66A 1Z4JA 3OM8A 4TX1A 3G0GA 3MCZA 4WZZA 5CAEB 2FSIA 4LDAA 3WXMA 1IHPA 1U6IA 2EKBA 3K0HA 4JJEA 1Q6YA 5A6VA 2ZCJA 1ZXLA 4R05A 3AP1A 1UFOA 1KRXA 4FWIB 3SQMA 2XZTA 3VR6A 4TQ9A 5ESWA 5FTWA 2YJ3A 4XYGA 2DXIA 5LU8A 3MTAA 4K3VA 2F55A 1MG0A 5I4CA 4NCBA 4O4IA 4DA4A 4K0RA 4UHHA 3GT0A 3T7KA 1EX7A 1T8WA 5GONB 1RFGE 4OHBA 4DCNA 4F3KA 4ZO4A 1C1DB 1PSDA 5F4BA 3RC8A 1ZLYA 2YCLA 1RHQA 1IOWA 2ZATA 4YYZA 5AHWA 3ZDQA 4DWVA 3PHLA 5EJ9A 3BAFA 2FHSA 5KX5F 2PUGA 2CE7A 1QO7A 3WLMA 5FUBA 2YINC 4PRZA 3UA4A 2Z04A 3F5FA 3FA2A 2WB4A 5CPFA 4YAUA 1P2UA 2ZU6A 1MO6A 2PN1A 4CR7A 2Z6AA 1N9GB 4BQSA 3NBXX 5FF9A 1BJRE 1DRUA 3W2GA 4K6FA 1CUXA 4BMVA 4EP1A 1NW8A 4LJ8A 3GRAA 4EPTA 1RI1A 2MINB 1KDZA 5IVPA 1Q16A 1EVLA 4MWCA 3I9OA 5IBQA 5DX8A 1XJCA 2W2LD 2GPAA 4ARZA 1GITA 5AW2A 1XU9A 4J6FA 4LV5B 2Z8XA 5CVEA 2CDBA 1VLMA 4ZQCB 5ARCA 2J7KA 1DWPA 3CRVA 4US1R 1TFUA 3KEOA 2XDAA 4I8IA 1U31A 4KK3A 1Y6JA 4P5EA 4WK2B 5SYMA 4AJHA 2Y0PA 4J3JA 1CQJA 1NW5A 5TEVA 2VK2A 3I3SR 2GYWA 2ZWOA 3A9SA 3RSZA 4AJJA 1ML3A 1Q20A 1WM1A 1GTZA 2DLDA 4PZCA 1WZEA 3WBKA 1U8CB 2ZXUA 1KU0A 2ZR7A 1IBMB 4Z54A 3LIIA 2VBFA 4AB1A 4BLTA 3TQCA 4R6WA 3FZEA 4CKZA 2E18A 1Y0BA 4HRAA 2GYYA 3DMFA 4GE3A 4AUKA 2C5GA 5FLKA 5KNCA 2WYHA 4JB3A 4H2DA 5TMPA 5HK9A 4G84A 2VK1A 4I1YA 5EQDA 4FPXA 2H2IA 3R09A 3W6ZA 4JBYA 2DU8A 2O59A 2V6BA 3NVMB 1OXSC 2DSNA 3L7NA 3WKDA 2XWBF 2GK6A 1ZUNA 5FBHA 3AG6A 3DTNA 3ZDAA 5B1SA 5TB5A 2JIPA 1PYOA 1DPGA 2BHLA 3KQPA 1LXCA 3KE8A 4Y6GB 2D5BA 1X7DA 3BJRA 4C4TA 2G7ZA 1HSZA 4EMUA 1T4MA 1HRDA 4LGCA 4D0RA 4DQDA 4IEFB 4FOPA 3DDSA 5IASA 1SCDA 3REQA 2CFRA 1WSDA 3LPCA 4TSRA 4KTVE 4ZAWA 2QE7D 1PBNA 1L6RA 3QLJA 4TV8F 4R54A 1MLDA 2ONZA 2WFLA 4GYKA 4EUSA 3GLGB 1A98A 1TZBA 3B2QA 3HKBA 1CW2B 1SA0A 3LUAA 4PHGA 4YJ3F 2H2GA 2Z6QA 3RFVA 3EPPA 2GJ8A 1Z62A 1BROA 3T7DA 4YAIA 4QD3A 2PR7A 2V0GA 3WK8A 1WXFA 1FVXA 2X0NA 3IBSA 3ZXIA 3CX3A 1N5OX 4JLWA 4NMXB 3JQ8B 4X44A 3P2MA 4MWBA 2FVYA 1E9RA 4LW8A 3HCAA 4B8ZA 1IBSA 1M0EA 2J4DA 3IQFA 2PWYA 1R9MA 2O2ZA 3CR8A 3NUGA 2CK3A 1MT3A 2I33A 3O92A 3PD1A 4H4EA 1DKQA 1SVIA 4KK4A 1ESEA 3ET4A 3G8CA 3I4LA 1SUDA 5DVZA 5FYDA 4CEJA 3AJ8A 1CLUA 1X39A 4MVJH 1E0KA 2W2LA 4GR5A 3GHHA 1Z9BA 1QWSA 2K2QB 3H3XA 3FI9A 2YMLA 3B36A 3WOHA 2C88A 2Q6IA 3KTDA 4J6EA 4Y2UA 3KAJA 2Q9AA 1K6IA 2GFIA 3SDBA 2H31A 4C1NA 1XYYA 4OJKA 5K51A 4HWTA 2OBMA 5DNEA 2YJTD 3ANYB 4NH4A 2RHGB 3WYCA 5EIWA 1JQKA 1N2XA 3SQNA 3WLNA 5ALKA 1O0CA 1M1ZA 5HVNA 3B1YA 3M89A 2F9MA 1USWA 3W34A 4ZAZA 3PNMA 1GGNA 5CK4A 2GS9A 4BCDA 5A4AA 1XLTA 3IEMA 1W2WB 3H11A 2DWOA 3QE0A 1PLKA 1UXOA 1VJCA 1XV5A 2H6EA 4UE2A 4EDHA 3DMHA 1DRKA 3R0IA 4QGGA 5BV8A 1I80A 2P4SA 2W98A 4MZXA 4Z9AA 4TTQA 3OWHA 4AMYA 3ZHUA 1UFRA 3H83A 3I39X 4YRRA 1UBMS 4AP6A 3AHEA 4DANA 1ZR4A 1BOFA 3GAMA 4K7JA 4GLJA 4CF5A 4ZU1X 1N6HA 5K0GA 4NZOA 3KJIA 5A4IS 5JADA 1AG9A 1O3YA 3HADA 4KO3S 4ZMSA 4CIWA 1WB4A 2FRXA 1KR2A 2VKQA 1FS5A 1NDUA 3UKDA 4REMA 2GN9A 2ODNA 4AX8A 3FYUC 3CZCA 3QKIA 1E63A 3SSMA 1OH5A 1J23A 4ESOA 3MLEA 1M0WA 1OWPA 1TA4A 1SU8A 1TEVA 4Y2SA 5DHRA 5GAJA 3VU9B 3PWSA 5ANRB 1UJMA 4ZTBA 2REQB 1B6TA 2ZIFA 3LY9A 1P3DA 2I62A 4N5LA 2WM2A 4QXPA 3GCDA 2EVWX 2ESRA 4KN9S 4WFIA 5FV7A 1GO2A 2QJTA 3VSBA 4Q05A 3LX5A 1DDGA 3RC7A 3U7QB 4F12A 5IC4A 3GUZA 1SVNA 1UPBA 2AEMA 4ZDIA 4MJ3A 1MRNA 1NT2A 1U2EA 2AEFA 3LDHA 3LY8A 3NXKA 3G0BA 4MAFA 4OCZA 4YWJA 2FPPA 2IYPA 1HOXA 4Z2YA 3TX2A 5A2GA 4OK3A 4KOEC 2AOWA 4ESVA 3F78A 4QDZA 2REBA 1A9TA 1IOZA 1VBFA 1WUYA 2AMVA 4LV6A 5DHQA 2B4YA 2RAUA 3TIFA 1AUPA 1XMJA 2CFTA 2CL7X 2O7NA 4MWSA 4LYAA 5DULA 3CJQA 5BQOA 1MNAA 1XQWA 2YW2A 1Y1LA 2IYVA 1DQZA 4K9OA 2UUAB 13PKA 2IYFA 1CUEA 1VE3A 3ZV5A 4MRRA 1N5KA 1SIUA 2EIHA 5JD4A 1HI9A 2L2QA 3HM9A 3K1JA 3DZJA 3I01M 4MOWA 4YECA 4NU0A 5FTLA 3H16A 5G1OA 1HQKA 2B3DA 1U7WA 1OFHA 4H1HA 1KFCB 1GNRA 5JPDA 1GG2A 1JQ5A 1N7GA 1RE0A 2M6SA 3ZV6A 2O8BA 3ESXA 4XDZA 3EZXA 2ZSEA 3QUTA 1NQ5A 2NVUA 2HU5A 2CJXA 4OL9A 3K0KA 2EEZA 2LTAA 4M0CA 2LR0A 1JIJA 3BDAA 1NJ5A 1KHHA 3ETNA 4Z0NA 4KLCA 4RPGA 4YIKA 1JFTA 3EPHA 3OF5A 1ZVVA 1N5JA 1Y8CA 1JEQA 4CKBB 2XVXA 4NXNB 5DHFA 2BFCA 5KTTA 3NHZA 2Z1NA 3EARA 3ICPA 4N49A 4QU0A 2IVZA 3V97A 2VJMB 3JD1A 3VPXA 4CI0B 4QA9A 1TU3A 1RYNA 4EDFA 2JK1A 4K6GA 2W90A 2XDWA 1Y1RA 3LOUA 2C4MA 3AM3A 3HCNA 1SXHA 4RD4A 4ZQIA 3RIXA 5EXPA 3ZZ0A 2ASVA 2IOFK 1Y9EA 3R8CA 5BUCA 4RSHA 3SP1A 3ELDA 4D0GA 5JZOA 4A7PA 3QUSA 2WD7B 3KKQA 4I1IA 4RKRA 4I3FA 2ZYWX 2D06A 1L9KA 3JQAB 4F7WA 5CD9A 1EA7A 4OD0A 1YI0A 3I8XA 4R8RA 2RHTA 4KKXB 3M5PA 2ZZNA 5HEKA 2I6XA 3SC4A 3KZ1E 2C7VA 3PFFA 4QEZA 2WAMA 2DHQA 4AQYB 4CKYA 1ZIDA 3T5GA 1WHSA 1DX4A 4GBGA 4K6MA 3HR7A 2RI1A 3K20A 1IRIA 5AM3A 2DHEA 1E20A 5LA6A 2AUTA 3V6LA 4DUYB 2XKJE 3COZA 2YUTA 3JQ8A 1OX4B 1R4MA 3CUVA 4EL0A 5AM2A 4Q7EA 3L4EA 2N42A 3O4GA 3OPXA 3EWAA 2P68A 1A7JA 2XUDA 4GLBA 4BUCA 4IG4A 4KHPB 3GWGA 2P9ZA 1WP4A 2QP3A 2W5UA 3NBKA 2OTCA 3OSUA 1JXQA 3EXEB 4DLVA 1W73A 2C2WA 3AOGA 1EK1A 1K5PA 4B3HA 2VP4A 3JD0A 4MUHA 4F9TA 2OE2A 1FMTA 4QZVA 4GPAA 4BVKA 3S1AB 2HLPA 2R68A 4B7ZA 5ADHA 3FSGA 4JUIA 1UP6A 4OXQA 4PHCA 2ZSUA 2EX0A 1Z0SA 4I9UA 4C7BA 1H05A 3I42A 5IUKC 2VDPB 4DM3A 5HJ5A 1EFCA 3W3AD 1JLLB 1CT9A 2AK2A 4NG4A 3D8NA 6NULA 1NC3A 2Z4RA 1TXGA 3DT6A 2B4QA 3AKZA 2QROA 2PR2A 2FFJA 2IXDA 3DTVA 1E3DA 2QV7A 4RZ3A 1O03A 1J24A 3SVZA 4P0QB 3RARA 3LYLA 4KDFA 1E58A 3AYXB 2I2XB 2WF5A 3VV3A 7MHTA 2W93A 5BT8A 3N07A 1RXUA 3AI3A 1GDHA 1Z5ZA 2FPWA 2H2HA 4TMYA 2GLXA 3NAGA 3OCJA 3R3VA 1FMJA 3UOAB 3K1YA 4CUJA 4LZNA 4O25A 1PVVA 5D84A 5KNBA 2YZ7A 2V7BA 2V55B 1QGOA 1TKAA 3F6SA 3MM4A 2UYQA 2JJYA 2PGAA 1QH8B 4RF3A 2XNKA 5CHYA 5FBZA 4YJHA 3RHSA 1ODJA 2ZJ4A 3CE6A 3DYVA 3FOAA 3K0EA 5EXTA 3SJBA 4F3TA 1CP3A 2YDXA 2IP4A 2WF9A 5T4BA 1NPTO 1JJBA 1US8A 1CR1A 4RXTA 2W0MA 1IJKA 1WWKA 5EE1A 1R3UA 4R8LA 4MS4B 3GLHE 3MMZA 3EFOA 3UMRA 2IEBA 3ETCA 1ULBA 3HYRA 1YKSA 4AULA 1THTA 2CLMB 4JBHA 4C4RA 1EDZA 3P4XA 5BW5A 2AUNA 2I0FA 1G7SA 3B3FA 3AMVA 3OT4A 2FP4A 3AW9A 4L27A 4X84A 5K3FA 4EY4A 4BATA 2XT0A 4RTRA 3DDHA 2OFPA 1Q2UA 4G1BA 2XA1A 3O4RA 1VBKA 4ONEA 4R2KA 4NS4A 5T67A 1U65A 3G1UA 1KVTA 3PYMA 2VOEA 4JBWA 4DCTA 2EFDB 4YP1A 1B15A 3GFFA 2ZWMA 4TMKA 2CLSA 3OLCX 1CCWA 1DKRA 3E48A 1DV1A 1BXZA 2QUHA 3GAAA 2VJBA 1CFJA 2Y77A 3ASVA 4O4IB 4A16A 8LDHA 1LS1A 2Q3DA 1HA3A 4RU1A 1SCJA 3HDTA 1JSCA 5HE9A 1Q6ZA 1LI7A 3GJ3A 4MA4A 3BTVA 4CF7A 4XSHA 5J43A 1E3MA 5B30A 2FE4A 3WQSB 4EUKA 4XDGA 1IHDA 2HNKA 2CB0A 1VMDA 3M6XA 1E7WA 1SO8A 2G06A 1B41A 3FROA 1S9DA 4MGZR 1JWLA 3IS3A 3LQQA 3DQPA 4B33A 4MUMA 4CHGA 2VQDA 3H5NA 2AHRA 4QX6A 4C3OB 3H1GA 1Z2DA 2QAJA 2R84A 3FGPA 1NW4A 4FC6A 4KQMA 1RKUA 4OK6A 4YP0A 4ZOEA 3SYMA 4C05A 4BUJA 3B51X 3W2FA 2CK3D 2Z09A 1QTQA 2I8CA 1WCV1 2WA1A 4UUQA 5L7WA 2JLZA 1HNXB 2Z8YA 4Q9LA 4LE1A 2H5LA 4Q7KA 5ALXA 2XOEA 4C0AC 4J1NA 2DPMA 4P6VF 3U3MA 5HTKA 2OESA 1G21A 1FNBA 1P29A 1BGXT 3Q9LA 1PJTA 1W88B 5K3AA 1TCAA 1Z4MA 2YS7A 3BXXA 3BCUA 1JB9A 2OHGA 3BG5A 4BTLA 4GKVA 2BFOA 1TM5E 2CF6A 4RIGA 2OORA 2B94A 5DO9A 2ZQ5A 3MILA 1GZ4A 2H5JA 2WBLC 1D9XA 2C2BA 1JIVA 3EHEA 2V9CA 5HWSA 2J0SA 1U4NA 1VJ0A 4Y0NA 1E1QD 3EF3A 3UJ3X 2NACA 3H9UA 5AJWA 3BGSA 4YJDA 2DFLA 4GPBA 3FTNA 2QRMA 4A4DA 5B2EA 1E4OA 5JXHA 4EHNA 3EEYA 1QO0A 1J2RA 2GTHA 1X2BA 1AVTA 4JI6B 3LECA 4ZU6X 1AC5A 4I6JA 1UC4B 2DWUA 2O0HA 4CLRA 4UVDA 1UXGA 4XJSA 3SX4A 2QU7A 2VJLA 4WAUA 4GL4A 1QTIA 2P1RA 4YHBA 1ECCA 2C03A 2J59A 2QN7A 2KI5A 5BR7A 3SYNA 3UAZA 4TSKA 4DCCA 1UODA 1P2VA 3MRXA 2BHNA 1GA4A 3OFKA 4GZLA 2Y3IA 5HBGA 1R00A 4PAGA 5J3JA 1EX6A 3BZBA 1KORA 3VXKA 4F2GA 2YYSA 2XXAB 1JFRA 1Z36A 2QM0A 1WD7A 3QHAA 4LNUB 1E9SA 1Z4LA 4O8ZA 1UBNA 5A62A 1JLRA 1NG1A 3RBAA 5JUWA 3BRWA 1OZ0A 1T13A 1XRQA 1WLYA 2DUMA 1NVTA 2NO4A 2Q28A 4OV6B 4LOAA 1QIEA 3NRJA 4L78A 4G0UA 3ADCA 1TYDE 5FWDA 4UNRA 3WA7A 1KR5A 2FX3A 5FNZA 2O2DA 4JL8A 5FUWA 1SB9A 4KMOA 4MW7A 1HE4A 2QZ4A 2YYZA 4BVEA 2Q07A 5A1TA 4FDUA 4F5WA 3BSYA 4H7KA 1W581 2GPNA 3UWDA 1CJCA 2VIIA 2WMOB 4LOHA 4QRIA 4WN9A 3W8FA 3MJFA 1P6QA 2ZUTA 1GCAA 4F9GA 2PANA 1C1XB 2KSQA 1ORHA 2ONJA 1PFQA 4EX6A 1Q1ZA 4AZTA 3E9YA 1CFZA 1RQRA 3ZWAA 1XSEA 2HBQA 2R00C 4CM5A 4EAQA 4F2HA 1HKUA 1GFWA 1KVUA 1L3IA 2BP7A 3T0IA 3WK5A 4FZ5A 3HKCA 4WBXC 4C6RA 2G7MC 1D6SA 5T7BA 3PUHA 4C0HA 1KYXA 2XVYA 4GMGA 3R0QA 3RIHA 3VR6H 1EWKA 2GLUA 2AN1A 3MAGA 3PIIA 4BO5A 4C4YA 5GJBA 3TQFA 2DETA 1MAVA 1G6HA 2WFZA 2X8AA 1V8BA 4G86A 3JQ9A 5JEDA 4CTKA 4RFSB 5EP3A 1SXPA 4DR7B 1R88A 4QQRA 2VSFA 1GN9A 2SECE 4PNEA 2QTMA 4F1KA 3P9CA 3NBQA 4DT1B 4G81A 3PXEA 4HWRA 4LCJA 1FBNA 2IPMA 3CZQA 4N5IX 2X0KA 5EPOA 3T9BA 4ZKEA 3RRFA 1NW9B 1M5TA 3ANSA 4M9CA 5J2TA 3O8QB 3U3ZA 3E82A 2ACVA 1VIDA 4NL4H 4HBGA 3DBLB 4E21A 4V39A 4AF8A 2JLSA 2G09A 2CCGA 1DBIA 3DKPA 3P7MA 3GA7A 4HR7A 3VAYA 1XVLA 3QSGA 3RV3A 3JZAA 3V55A 3R4CA 4QPJC 3WGUA 3MCWA 4KGDA 3UHFA 1AQLA 1F4PA 4G63A 4Y2HA 3WY9A 4X91A 1QF6A 2RB5A 1G8MA 1Z16A 4CGYA 1MT0A 3R24A 5DBGA 3U49A 1INLA 1XWWA 3G89A 2A9PA 1BVUA 3L6BA 5LBTA 4ZEWA 4E15A 3RAJA 2XODA 2WQZA 1VSQA 1CY8A 2NO6A 4HQNA 4JMLA 3EAQA 4N5DA 3TBHA 4LISA 4KJXA 2E6KA 1KPGA 5K0NA 4D9CA 4QYIA 4YJGB 7REQA 2B7CA 3OQJA 5J5CA 3ZC3A 4YREA 3IUBA 1KFKB 1M72A 2GTPA 2FX2A 2Q9UA 3MCAA 4NBUA 4Q03A 2ZYTX 2FJPA 2VSQA 3WNQA 1PJAA 3UYKA 4PEVA 1NGSA 3PXCX 4KNWA 4QYMA 3VR5D 5EJ8A 2ECQA 2JI9A 2O3SA 3EOZA 1DWQA 4Y6OA 4PQYA 1NQTA 5JCJA 5AVTA 1Z06A 1JBQA 2DYKA 2GCEA 1U8AA 3COPA 3TE6A 4HH3C 3OF2A 1LRLA 1MIOB 3P9ZA 2N46A 3HP7A 5CVJA 4CM7A 1F2UB 2FKNA 1IXSB 3QIVA 3V1KA 3WDKA 4B6FA 3N87A 1Y8QA 3FLMA 3DO6A 5LA6B 4EPWA 3IUQA 3E61A 4JVOA 4JC8A 1OI3A 2WSSA 3BIOA 4PZLA 4BBPA 2OD7A 2V59A 2GBLC 1GZDA 1DT3A 4NCNA 8OHMA 1EHCA 4HTFB 3ONFA 4DY6A 3AIMA 4OREX 2ZRIA 3PGVA 3ZIAA 4RX1A 1TA0A 3EGXB 4YQZA 1C3EA 3LC0A 2A14A 2QSJA 3O8OA 1PZHA 3ECSA 4IDGA 4MI9A 3VO9A 2YJ6A 2YN4A 3V2IA 3NJ8A 2TMGA 1K2WA 3HEAA 4BN0A 2C2OA 1ZESA 4OJNA 5GZ6A 1Z3CA 1WB9A 5BSEA 4XWKA 1R5OA 2GAIA 1NONA 1NMYA 4AW9A 4RADA 2CV0A 3KWMA 3MD9A 1NHWA 2QAGB 2PCLA 3R76A 4Y2PA 5DEOA 3CCFA 4C6HA 1HTBA 4KCGA 1NY6A 4PG5A 4X90A 4D3XA 1KQNA 2D4HA 4BMCA 1IG3A 3FSJX 1MB3A 1OMOA 2FG7C 4EW6A 3C48A 3QOFA 4F0JA 4F3RA 1QCYA 1U7UA 2J07A 4LS3A 3NTOA 3K05A 2G71A 4HAWA 3WLPA 3IUYA 4DA0A 3AILA 2PCJA 3RVOA 3GQBA 1QFXA 5I9NA 3FSEA 1T9HA 4R2MA 1UBHS 4Y7DA 2IKQA 4KAFA 1RHMA 3LHFA 4JMPA 1OI7A 2H1FA 4YA6A 4P98A 3TSAA 1KQGA 5LOVB 5AW0A 4B8WA 4K88A 2XE4A 4M2LA 1DOAA 5IC5A 1PR0A 1QGDA 1TKRA 1WHTB 2C7GA 1TZKA 2HPZA 2CZQA 3M49A 5G4KA 2WPDD 3B6JA 3NKVA 4A0QA 4ZCRA 1A8SA 1QYVA 2JASA 3U7EB 2PL9A 3KHTA 4B5KA 1B26A 2O8EA 5MFZA 2FQ1A 1R5NA 2P5YA 4PXAA 1N6IA 1B23P 3MXOA 3TD6A 3QUAA 1KEKA 1M2JA 4NESA 3ICOA 3WMXA 2HB6A 2HU7A 1N2CA 4OAQA 3WP1B 4QQFA 3D2LA 1A0OA 4F45A 1DQPA 2ZB8A 3B7WA 2VQEB 2JCYA 2PXCA 1NAIA 2XOKA 3ZUPA 3OFNA 2H4FA 2ISSD 4E2YA 1MFPA 1XN4A 1NMXA 3FUCA 3Q72A 4MVWA 1JE0A 4HN2A 3QV1A 1H2RS 4QFDA 3RVQA 4DXDA 4QVIA 3HLYA 3ZHBA 3M4JA 4FKBA 4GU5A 4L9RA 4TWIA 1J49A 1P2SA 1FDRA 1ZUHA 1Y37A 1FX0A 2RK4A 1Z68A 1VGVA 1E6KA 3DQQA 5H3HA 3EULA 4DR6B 4P58A 2POCA 3LT2A 1CY6A 3PU6A 1U90A 1YS9A 3HB4X 1BD3A 2WWGA 1L7DA 1NUUA 4PPGA 5KDLA 4IINA 4D3DA 2QA5A 1JECA 8ADHA 1JQLB 1OU4A 3P9YA 4KFCA 1J70A 4WZBE 1J8VA 1RLMA 3WLIA 2HADA 3GVCA 4J3NA 2X2EA 3CPSA 3GDFA 4QYWA 5G0SA 2JKYA 5THKA 4DCJA 2ORYA 1IN6A 1ESMA 3JYLA 5ALYA 4B79A 3D7SA 2YX1A 3EZ7A 2L82A 1W85A 2OB2A 1B8PA 3L1IA 5BWOA 3HR8A 2E9SA 3A1VA 1JEYB 2D8MA 1NXTA