2AN9A

Crystal structure of oligomeric e.coli guanylate kinase in complex with gdp
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
205
structure length
205
Chain Sequence
AQGTLYIVSAPSGAGKSSLIQALLKTQPLYDTQVSVSHTTRQPRPGEVHGEHYFFVNHDEFKEMISRDAFLEHAEVFGNYYGTSREAIEQVLATGVDVFLDIDWQGAQQIRQKMPHARSIFILPPSKIELDRRLRGRGQDSEEVIAKRMAQAVAEMSHYAEYDYLIVNDDFDTALTDLKTIIRAERLRMSRQKQRHDALISKLLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Calorimetric and crystallographic analysis of the oligomeric structure of Escherichia coli GMP kinase
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords Guanylate kinase
total genus 68
structure length 205
sequence length 205
chains with identical sequence B
ec nomenclature ec 2.7.4.8: Guanylate kinase.
pdb deposition date 2005-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00625 Guanylate_kin Guanylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.63.10 Alpha Beta 2-Layer Sandwich Guanylate Kinase phosphate binding domain Guanylate Kinase phosphate binding domain 2an9A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2an9A01
3B13B 3T35A 4B3DA 4WXPA 3ZLJA 2Q9AA 1F5NA 1G291 2F1RA 4FXPA 4LSGA 1P7CA 4NYMR 4WBSA 4D0LB 2EYUA 2IL1A 4U5XA 1Z22A 3RSOA 3THYA 4AYWA 1Z63A 2QP3A 4OQMA 3MG9A 2JGNA 3K0SA 1KDTA 1N0UA 3T1VA 3VAAA 2CLCX 5JJLA 2FSFA 4CIDA 4XD7D 3X1YA 3QBVA 3EW9A 3SNHA 5TDHA 5C18A 4QBIA 1UEJA 2G9NA 2JLXA 5DISB 1VCIA 2JJ2D 1QG2A 5KSYA 1T6NA 2AN9A 1Z06A 4X8HA 1U81A 3G5UA 4HB0A 2FWRA 5AUOB 1FFHA 4RZ3A 1Y3AA 3TSZA 1E9EA 1VTKA 5AJXA 1NY6A 4M1OA 1QHGA 2ZE8A 5KDLA 3HU1A 4BEJA 2FPKA 1QHXA 1CR2A 3R7WA 2G6BA 3I4LA 5C4GB 4HDQB 1AS3A 2OXCA 1J7KA 3BFXA 3FB4A 4Q1BA 1E1RD 1XNJA 2WWIA 1DE0A 2F6RA 4XTRA 2CNWD 4G5QA 2IS1A 4LV5B 5F3WB 2ATXA 1TUEA 3AV0B 4MGKR 1X8KA 4AG6A 3W5IA 4GZLA 4QKQA 2SHKA 1OW3B 2ZRLA 4PC6A 1KKLA 2QORA 1KMHB 1J70A 1U8AA 2GCNA 2XJ4A 4HATA 4P3YA 5LD2B 1W5TA 2FPMA 4HUTA 5JS7A 4CDGA 3V4RA 3KL4A 4IXNA 2NQ2C 4JVMA 4ARZB 1OFHA 4E22A 4GOXA 4LBWA 2V7QA 1LW7A 1R10A 3U2QA 3FMIA 1P72A 5FPHA 4BFSA 4Q4AB 4QFMA 1TF7A 1D6JA 1EX7A 1XJCA 1Z08A 5KNBA 2ZYTX 4LHWA 4HZUB 5CDFA 3U3RA 2NO7A 1KIMA 2PZFA 3CNOA 1W4RA 3K1JA 4F91B 2BOVA 4RD4A 3NEYA 2WJIA 3I92A 3WBJA 3DOFA 5JLJA 5JZVA 3RNLA 4WXRA 2OCYC 4IEIA 4TT3D 1CF4A 3FHOA 2QAGA 4J0QA 3KFVA 1OHHA 1CIPA 1NRJB 1KTVA 1W2GA 3B78A 3EZFA 4M21A 3SJAA 3T12A 4UNSA 4DCUA 4E03A 3KKPA 4O2RA 1ZW6A 4C30A 4D26A 3VNUA 2ERXA 3FKSA 4Z1MD 2I3BA 5B64A 2JIZD 5FL7A 2ZRCA 821PA 2D4HA 4N1AA 2MMCA 3PUXA 1W48A 1VKJA 1KDPA 4Q1DA 1CJMA 2YC4C 1OXXK 3VTKA 3IILA 4FIDA 1L7VC 1NBMD 2B92A 1H8HA 3EZ9A 1JPNA 3FHCB 4QGFA 4QBFA 3TQCA 2W2TA 1G8GA 2D2FA 5HTKA 1RKBA 4FN5A 1GL9B 1XXHA 3A1TA 4JLPA 4EDHA 4JLMA 3IIMA 3F0TA 2BC9A 2GJSA 4JVNA 2XZPA 4EQ6B 1KI6A 4DUGA 5JHGB 4DLZA 2WSSD 2VQSA 4EFNA 1U8ZA 3BORA 3GLIB 3HPQA 3SJBA 1FOEB 1I2DA 5AJWA 2VEDA 2L0XA 4BECA 4UXHA 2N1BA 4MKGA 2QGZA 3I61A 4LY6A 1XMSA 2PLFA 3C16C 3O8DA 4NYMQ 2OBNA 1E2MA 1ESMA 1XTJA 2VRWA 1KDRA 4GL2A 3CX8A 5FBWB 5C4MA 2ODNA 2QQ0A 4PR0A 4MRPA 4TTPA 1D2MA 1BOFA 5DYIA 4FMDF 3NDPA 2IS2A 1NVUQ 2X1VA 2ZR0A 4ILEA 3TMKA 3SDZA 3ZQJA 2WVJA 5K8UA 3LLMA 1EFRD 4P4TA 3WMEA 3GLHA 1SHZA 3K0AA 4PZZA 4EJSB 3LA6A 1Q12A 4Q21A 3KKMA 3IHWA 3EPJA 4DLYA 1ZCBA 1P4SA 2XSZD 3F5FA 1TMKA 5HCIA 1P73A 4B6FA 1DAIA 4B3GA 1M7GA 1D9ZA 4G5SA 4Q47A 3W90A 4C7OA 5FPKA 4AI6A 4L9WA 2WHXA 3GJ6A 1KY3A 1PUJA 3QVVA 4DEXA 1KK0A 3VR4A 4PC2A 3ZVNA 2CLSA 3GJ0A 1OE0A 1QHYA 1GP2A 1G3RA 2NO9A 1VCOA 2GXQA 3WMGA 2QRNA 2HLDD 4GPTA 3QG1A 1ZM7A 2N46A 1WCV1 1UBFA 2WJJA 1ZMXA 1T4GA 1ZCAA 5JRJA 3I5XA 3RLFA 1K5GA 3QVUA 1MABA 4A2QA 5A5GA 2QRZA 4PTLA 1HUQA 1UADA 4MUAA 4F4CA 3K0AB 4EJSA 2NOAA 1VYVA 3LDAA 4A6XA 1CRQA 1XJQA 4BLOA 3ND9A 4RFSA 1QHHA 2WMOB 4IVQA 4QGGA 1E9CA 4G5GA 4V03A 2OZEA 1NNEA 1WBDA 2IUTA 5FOWA 1G7CA 5D3MA 1KGDA 5EJEA 1ZM3A 2VYFA 4Z51A 4KITB 2XZOA 1Q1ZA 2ZVPX 2ZI5A 3TSWA 2VHCA 4GOKA 4V0LA 1N2CE 3QIAA 1E2GA 3W6NA 4POAA 3DOEA 2GTPA 3AVYA 4PAQA 2R6DA 3HU2A 2RH5A 3EIHA 1SQ5A 3BAFA 4A6PA 2IHYA 4D6PA 4JLKA 2NMVA 4DXAA 1TPZA 3QF4A 5EP4A 4CYMA 4JZKA 1MABB 5JBQA 1A5TA 1N6NA 1GRRA 4RZXA 3F8TA 3A4MA 3Q5DA 2G0TA 3BXZA 4BFUA 1IAQA 1E2HA 4DIEA 1ZINA 3V00A 2Z43A 2FH5B 2QAJA 1GZSA 3QPVA 1GFIA 4GSYA 2YVUA 1VMAA 5FFMA 1EXMA 4HLQB 5JFGA 1MH1A 4TLDA 2HCJB 2ORWA 3LXRA 2IW3A 3DMDA 1IY1A 3KKNA 4IDHA 1E4VA 2GZHA 3HU3A 1EX6A 3LQQA 4TYPA 1W0JA 4II7A 5CK5A 3GLIE 3RS5A 1M74A 2R9VA 3VX4A 4QXAA 3KQHA 5G3ZA 2V4ZA 1V5WA 2H17A 3PQCA 4PO9A 1ZUIA 4KLZA 2BBWA 5FTLA 4N0DA 4O0MA 4HSEA 4GFDA 4ZKDA 2WZQA 1WQ1R 1C1YA 1E94E 1ZU5A 1E98A 2CJWA 2Y8EA 3PITA 1F2TB 4GP7A 4AKEA 3P32A 1DPFA 3THXA 1W4BA 2C78A 2D3WA 5BWMA 4L16A 4JL5A 4Q7MB 4EJSC 4V0NA 2JLQA 4LC1A 4CEIA 4AY2A 1NBMA 4JLJA 1JR6A 4URWR 2GNOA 1GNRA 3KJGA 4JLOA 2KB0A 2QA5A 1DAFA 3T34A 1T3HA 1CJVC 4HYYA 5B58C 2YOHA 2NZJA 4TL8A 4BFYA 3ADCA 1W7AA 3LD9A 3EAQA 1ESNA 3CZPA 1XTIA 4I99A 4I1UA 4V0OA 3H86A 3JVVA 2C98A 3WYGA 2ODBA 3BERA 2CL6X 1Z0IA 5ANRB 1GKIA 1Z0FA 5FTJA 2KI5A 4DKXA 3AVWA 4CRWB 4TN1A 3ASZA 3EA0A 4AKHA 3KJHA 3KB1A 3ADBA 3A1VA 3D8BA 5J4LA 1UJ2A 2EYQA 3ECCA 1RRPA 4DLXA 3ZIAA 4MYUA 1F3OA 1M8PA 3CRMA 5LDDC 4AURA 2FSIA 1RRGA 3QPWA 2O8CB 3QXCA 4HB3A 2CL7X 2J7KA 3NBZC 1N5KA 2ZAOA 2HYDA 2QPOA 2O0HA 3WY9A 4BLTA 1AQYA 2WBLC 3Q7PA 3RS3A 4WZAE 4MUBA 3LWNA 3G0HA 4QBGB 2NO6A 4D2IA 3QKRA 1CLUA 1G64A 3TW4A 3UKDA 5CB6A 2O8DB 3TKLA 2V7QD 3GEHA 4LV6A 2ONJA 3SBEA 4OJQA 4OHVA 5G41A 3KX2A 3SJZA 3KFXA 4QNMA 2NPIA 3U7GA 3CM0A 3QEJA 4H1UA 3AKYA 2QT0A 4OHXA 4BWYA 2V1XA 1JR3E 1JI0A 2DB3A 1RW4A 4KXFB 1IN8A 1G8HA 2Q3HA 2FSHA 1CU1A 1Q3HA 3ZD6A 1II9A 2GCPA 4R2IA 2QMOA 4LJYA 4XVRA 1Q3TA 5KHOC 1H8ED 4LJAA 5SZIA 2HXSA 4HUQA 3K0FA 3FTQA 1JAIA 2D74A 3S1AB 2REBA 2OAQ1 3UWOA 5L3RA 4RZ2A 2CE2X 4UKDA 1IY0A 3HDTA 4TSFA 3R8FA 1QVAA 4IDOA 1P5ZB 3ZZ0A 5JEDA 5K8IA 1A2KC 2AD1A 3ZYCA 3QXSA 3ND8A 3GLIA 1P9RA 4Q00A 3IQWA 4Q66C 4JT2A 1ZC3A 4AKIA 1M34E 1VG8A 1RYFA 2FEMA 1U2RA 1T5IA 4MKHA 4KVGA 2IEZA 4GOJA 2V6JA 1YRBA 3QKUA 2LWIA 2J9RA 1G7SA 4WAUA 5IK2A 1EK0A 4US0R 1II8B 2RGAA 3NXSA 2CL0X 1LB1B 2B7BA 2QEQA 1MT0A 2HF9A 2LKCA 3X1DA 1L4YA 5L3QA 3NTUA 4L4UA 3QSYA 4ZDKA 2NTYC 5EXPA 1KSJA 3OE7D 4NONA 2AKYA 5CIQA 3U7HB 1BS1A 2BDTA 2HCBA 3HWSA 8OHMA 2X19A 1N6PA 2AWNA 4A8JB 1P9WA 1W47A 3RABA 3BFKA 4BQSA 5E7IA 4P31A 3I8SA 1VCNA 4ZDJA 3I3SR 1ELOA 4UJ3A 2QP9X 1S9HA 3AF0A 2JLUA 1N6IA 5CK4A 1SKQA 3CO5A 3WHKA 5FOVA 1O87A 1P75A 1SVKA 4OI0A 4M9QA 4XVQA 3PIRA 1NF3A 4BGDA 1G8YA 2ZS9A 4LHYA 4AWXA 2C2HA 4I1OA 1FX0A 2IYQA 2UZ3A 4OQXA 5GJCA 4JLAA 2X77A 3WXMA 4D25A 3EIEA 3S1AA 4JJZA 5IHPA 1COWA 4JL8A 1L2TA 4ZIRA 2FGKA 2QPAA 4RD3A 2QBYB 3CWQA 2PCLA 3L43A 5AJYA 2ZI6A 4L5BA 2J87A 4OL0A 2NIPA 1R5NA 4HLDA 3B1XA 3TUJC 1YZLA 2AX4A 5BN3A 3THWA 1QG4A 2ORVA 5LPNA 4D80A 4KJZA 2WWHA 5CDFE 2ZXUA 2H16A 1KY2A 2HXYA 4CEJA 2FJUA 4OQFA 1DTSA 3RC8A 4G1UC 3KKQA 4IDQA 5HKKA 3Q9LA 2I1QA 2UKDA 1E32A 4RFVA 2OT3B 1DAEA 2IWRA 2REOA 1Q22A 2XOKA 2Z4RA 3NC0C 3WYAA 1D2NA 1XD8A 5AUQA 3B85A 1E79A 3O8BA 4UNNA 3AF2A 1G41A 2X2EA 3FE2A 1F2UA 5DGXA 4ZCLA 4JIMA 1KI7A 1T91A 2G1JA 5SZKB 4OI1A 2DY1A 2ZI7A 1YVDA 3BB3A 3RWOA 2HDNB 3OAAD 2CCJA 3BH0A 2GF0A 2BV3A 5FI1B 2RGNA 1Z28A 3W6OA 3KTAA 3X2SA 1KAOA 1L8QA 3CH4B 2ZTSA 1NSTA 1NKTA 3AKCA 2GEUA 4U00A 5EXTA 1SXJE 5KUTA 2GHIA 2J1LA 3I1FA 2OCAA 1N6RA 1TU4A 2H7VA 3AP2A 2DWQA 1US8A 2RKOA 3SR0A 1SVWA 1CR1A 1DVRA 4OQLA 4ZI2A 3T1TA 4MA4A 3I72A 3R9WA 4MKIA 1OYWA 4QHSA 1JAHA 2F3RA 1N3BA 2EFGA 4M1YA 5JCPA 4A0RA 5DH9A 1FMJA 1XPUA 4LCBA 1U0JA 4OK3A 1DO0A 4HLUA 1MV5A 3ZDQA 1SXJC 1DO2A 1HV8A 2WJYA 1DEKA 5SZHB 3WBKA 5DNYB 1CTQA 4OJKA 3FMFA 4RY2A 4EKDA 2ZITA 3ZVMA 1CR4A 3M1IA 2J0SA 2A5JA 4KSCA 1G6OA 3KUCA 4JKYA 1JPJA 1E2QA 1J8YF 1KNQA 2YNMA 4B34A 4TQAA 2IA5A 1NJFA 4Q1AA 3H84A 1NP6A 1T5LA 4C4PA 4NL4H 3U60B 2C96A 1HYQA 2A5DA 2PZGA 1JBKA 3C41J 3CB4A 3JZAA 4M9SA 1S1CA 3L2OB 5KDDA 3IDQA 4GDFA 3ADDA 1T0HB 5TARA 3R7WB 2BVNA 4HB4A 3EC2A 1SVLA 4URXR 2J3EA 4RJLA 2HF8A 1O3YA 3UANA 2JLYA 3DEFA 2E9SA 1MO4A 5EXXA 1XTKA 1UDWA 4PAOA 1SGWA 5FPTA 3LO5A 1R0XA 1WE2A 2P67A 3IO5A 4LX0A 4B3BA 2RGBA 4FD2A 4NP6A 4K46A 4DSTA 2CNWA 2R65A 4Y0VA 2IEYA 3PUVA 4D4LA 5AR1A 1R0YA 2BMFA 4O25A 2C03A 5AUNB 1K5DA 1G6HA 4JVLA 5CYPA 1RC8A 2PX0A 4H9GA 2Q21A 5BN4A 1W36D 2J7PA 4KSBA 1JEDA 2GESA 3GLHB 3EPHA 3NC1C 1N6OA 2WMNB 2XAUA 3GEIA 4PSVA 5DHFA 1U98A 4DLRA 2G1KA 5H70A 5J5CA 2QM7A 2QP4A 3D7MA 4LJ4A 2YC2C 2CXXA 1Z0AA 4RD2A 1OIXA 2OILA 5LB4A 3QOFA 2CMKA 3Q5EA 2FU5C 1R5OA 3E70C 4BFVA 2EVWX 3N5CA 5BN5A 5AUPB 2LCFA 4C0SA 1KO8A 3PR1A 4Q19A 4PANA 1XD9A 4OBEA 2BJVA 3FPAA 5JSZA 5L3QB 2HEIA 4UXJA 2VSOA 3FFAA 4Q48A 5DYGA 2JJ1A 4QHTA 4ON9A 1TQ4A 1UBCA 4LJ9A 3UG6A 5K8LA 5GJBA 2X8AA 1FP6A 2J0UB 2O8EB 3ETLA 3C14C 2QTHA 1YZNA 2FOLA 4K8OA 2F1HA 2IXEA 4GT1A 2CK3A 4QG7A 1UDXA 3L0PA 3MFYA 1G18A 4QM6A 1GAJA 2VA8A 4ZDIA 1YZGA 4NCNA 5L3SB 2RGCA 1GUAA 2PH1A 2C8VA 1OB2A 1RIFA 1TNDA 3TSOA 4ACBA 2IK8A 2NZ8A 1E2DA 2VO1A 2A7QA 1E0SA 1NN5A 4LHXA 1ZD9A 2GAAA 2WKRA 4TYQA 2ZE7A 4DDWA 2OCBA 1XEXB 5CLQA 3UIEA 1QRAA 4BFTA 1JJ7A 4KI0A 3VR3A 4PPFA 3FMOB 3ICQB 2OV2A 3BWDD 4E5UA 1RRFA 1A2BA 1OSNA 2OBLA 2VTKA 4M8NE 2AKAB 3NVAA 3AVUA 1BO6A 4HDCA 2FFAA 4CEHA 1KK2A 4EPTA 2O8FA 1VYUA 4W5HA 2GJ9A 3TH5A 2GEVA 4A15A 1N25A 1ZD8A 4KAXA 1F60A 2QQEA 4YONB 4KFSA 3QI2A 1W0KD 2A78A 1OH5A 2ZI4A 2O8BB 1LVGA 5C46F 3AVVA 4OQNA 1X1SA 3GLFE 3A1UA 4EPWA 2PJRA 2IYTA 1WF3A 2BMJA 3K9NA 2FZ4A 4HAVA 4LYAA 5P21A 5CIWA 3LY5A 4KFTA 1PJRA 3B60A 1TL7C 4P4UA 4D0NA 1F2UB 1LF5A 2EWVA 3AEZA 3CW2A 5GJVC 3WHLA 3H0KA 3AM1A 4Q7KA 1KI1A 4LHVA 1YR9A 4DB4A 3MRSA 3ZH9B 3DHWC 1R2QA 5EUQB 1N0VC 1XTRA 1FNNA 1HE8B 5FUXA 1T8TA 3VU9B 4EPYA 3ZS9A 3T1OA 1GL7A 2YWGA 2PT5A 2ZJOA 1HT1E 3PUWA 2ZRDA 3IGFA 4TMTA 1KOFA 2O8BA 3PEUA 4NCKA 3PJRA 1OKKA 2J0QA 1IN4A 2JASA 4OYHA 2IF0A 4WVFA 2EW1A 4X8OA 1FP7A 1IN5A 4ZIRB 1OHHD 1V43A 3CF2A 1S1MA 4S2EA 5CM9C 3UWKA 2XGJA 1NBME 1R5BA 3KDSE 5JWOA 1XJ0A 2ZANA 4TL9A 5FBVB 2FFQA 3THYB 1XF9A 1UFQA 2ZS7A 1JQLB 3CKLA 4JMPA 3VKGA 2IYSA 4YMTA 1Z3IX 3HR8A 1E9AA 1Q0UA 3FKSD 3GLGB 5DHAA 3AF3A 1DAKA 2ZRPA 2BEJA 2AK2A 3VKHA 3VR5A 4A1FA 2QZ4A 5J4KA 3KUDA 3D3QA 3HPRA 1IN7A 1LS6A 1GKYA 1DBSA 4NCHA 1M2OB 4LK2A 2FPLA 1AA9A 3LBIA 4Z8XA 2YV5A 3BRWD 3UG7A 1YR8A 2WIAA 2XITA 1Z29A 2WOOA 3OAAA 1CEEA 1KHTA 2R62A 3CNNA 4YXWD 1XZPA 4UXIA 2WM9B 4PQYA 2V9PA 1OXTA 3L82B 3V9PA 1WA5A 1G4UR 4DSNA 1NIJA 3C5CA 4LBZA 4DLVA 3W3AA 4UNRA 3OF5A 2GDJA 4B3FX 1QHNA 1YZQA 1Z6XA 1Z0JA 2GWHA 4DCTA 4MYCA 5JS8A 2XTMA 1XCPA 4LDJA 4LBVA 1J8MF 2W58A 4QJ3A 1QF9A 5BYJA 1KAGA 5HKKD 4PZLA 1XEFA 4HAZA 1XCGB 2Q3MA 5FTKA 3CRVA 3K70D 3ZJYA 3SI7A 1AZSC 3C15C 4WZBE 4DC9A 1ZUNB 5KSZA 3B5JA 1W4CA 5K8TA 1E2PA 4Q1EA 5FUWA 1XTQA 3T1QA 5FPSA 1KO5A 2ZJBA 5E7MA 4IFBA 4JYCA 1ZC4A 2B6HA 4MITA 4PO1A 4F92B 4E09A 4JKIA 5FBRB 2KE5A 2WOJA 1NN1A 2MSEB 1HY3A 3K0FB 4BLPA 4Q4HA 2ZS8A 1G19A 3LQRA 2ZPTX 4URZR 5B57C 5UKDA 2JJ1D 5A0FA 2FF7A 1E1QD 4W7SA 2PL3A 3OIUA 2XTZA 3SQXA 3L0SA 4AKGA 3MWLA 1VCMA 4ERNA 3DZDA 1D2EA 2BMDA 3HR7A 1DELA 2ZE5A 3EARA 4LHZA 3VU9A 3U6BA 4JS0A 4RCYA 4Q9KA 1RYHA 5JWRA 4LJ6A 4UJ5A 3RS7A 1W1WA 2J0VA 2AD5A 2P6NA 4LYJA 3CRRA 1BYUA 3PG5A 1YZUA 2AXNA 1MKYA 5DN6A 1M6NA 1Q1BA 2FZLA 3L0OA 1KO7A 3I8XA 4MKFA 1AGPA 4F4JA 1Z83A 4I81A 5TMPA 2KWIA 3W8NA 3FVQA 1P60A 1ZNWA 1XTSA 4ZV4A 1RZ3A 4LI0A 2GVZC 1Q20A 2VHJA 4W5WA 3QG5A 2Q9CA 4MQBA 3U3MA 4LBYA 1LFDB 3VQTA 4MDEA 3I32A 1E9DA 3C5HA 4Q1FA 4BPBA 5HR5A 3RSLA 1KSGA 1TEVA 1G7RA 1GTVA 2ZSDA 5FR2A 2CE7A 1F6BA 4Q9IA 1UAAA 1EFUA 1BKDR 1S2MA 2XNSA 1LV7A 3TUIC 2DCUA 4ESHA 4KODA 2VP4A 3U44A 1KI8A 1FQJA 4DHEA 4IRUB 2IYUA 3X1WA 2WWXA 4QOSA 4V0ME 2GVDC 4Q02A 4IDNA 1WXQA 3SHFA 3CF0A 3DMNA 2GF9A 3DDCA 1II0A 4NBSA 2WWYA 4M1WA 1YHNA 6Q21A 1G17A 2QBYA 4HI0E 5L8VA 4YLGA 2HJVA 3EG5A 4ARZA 1S3GA 4B47A 2DWPA 4YQFA 2CEAA 4B2PA 4Q4LA 1XBTA 1XDBA 2KBEA 2G77B 3QXJA 2KSQA 3OEHA 1FMLA 2ZSBA 4KBFA 1U0LA 3P1JA 2OLKA 4OK5A 3LBHA 4BLSA 1OYYA 2N42A 2C04A 2QE7D 3QKTA 4A9AA 3LXXA 4LYFA 2IXFA 1DS6A 3PUYA 5GVSA 1EG7A 1AS0A 4Q1CA 3DKPA 4IJMA 2VP5A 3O8CA 4KLNA 4XD7A 3T06B 4D4KA 5EE9A 2ANCA 4FW9A 4HLUC 2O5VA 2GA8A 2YZ2A 2O0JA 4EPXA 1U90A 1OH7A 1OH8A 1Z0DA 2JLRA 1E9RA 2CDNA 3W9YA 4H1VA 2WWGA 2OEPA 2C9CA 3VHXA 5TVKA 5EE3A 2IYVA 2QAGB 4EFMA 1GKUB 1OF1A 1LTQA 3ONWA 2P5SA 4NPHA 2WICA 3ZQ6A 3U4QB 1L4UA 2VPPA 1OXUA 2YWEA 3NHAA 3TNFA 2GEDA 3FYHA 4HB2A 1NLYA 5JJKA 1VIAA 2A9KA 4BE7B 3UMSA 4FMCB 1OB5A 4RKFA 2C77A 4P33A 2O52A 5G3YA 2CCGA 3X1XA 1BIFA 2AK3A 2FE4A 2ZYVX 3EPKA 1JR3D 1YE8A 5IDVA 2YWHA 1E2FA 4F4IA 4PZYA 3TLXA 1DAGA 1MO6A 2BWJA 2B8WA 1D5CA 2ZUCA 4YMWA 4EIWA 1GNQA 4ACAA 2GILA 3RVBA 4TL6A 4A92A 1G4AE 1GOTA 1TAGA 2RGEA 5LD2C 4EAQA 1DOAA 4PFSA 4O3MA 2ZSEA 3BGWA 1RJ9B 4LV8B 2FV8A 4TMWA 3RC3A 2ONKA 3NBFA 3PEVA 5EE5B 2FNAA 4Q03A 1S8FA 2FN4A 2REXB 1P9NA 1KO1A 5G40A 3RS0A 3KXKA 1PLKA 2G3YA 1EWRA 3AVPA 1CJKC 1S4QA 1HE1C 1R7RA 3MSXA 3K70C 2Q6TA 4JJKA 2RHDA 3MCAA 2V3CC 1AS2A 4NZYA 1UKVY 1W46A 2QUZA 3GLHE 4EPRA 2ZR7A 1IXZA 3BB1A 1OLOA 4LJ5A 2TMKA 3GFOA 3QXXA 4AG5A 2ZJAA 4PSKA 5B30A 1XCMA 1G5PA 3GFPA 2OFOA 1VECA 1E2NA 1P6XA 4EUNA 1IJEA 1UF9A 3B1WA 2IYRA 2RGDA 4ZPXA 3NEJA 4IOKA 4JYBA 4TMKA 4TTQA 1NMXA 4WIAA 4IW3B 3U5ZB 3CPHA 1VHLA 4DLSA 2PEYA 3QY0A 2V8OA 1NL3A 2ZI9A 3Q72A 2B8TA 4IFEA 5FL7D 1AJEA 1P61B 4N3NA 4O2LA 3BOSA 5CITA 1Z47A 4A2PA 4FMCF 3T5DA 2PMDA 1SKYB 2D2EA 2GBLC 3KXIA 2ZJ8A 2QMHA 3A8TA 2J5XA 1XZQA 1FNMA 2W83A 5JRZA 1I4DD 3CRW1 4XJXA 1E9SA 2IYZA 3WRYC 2O8FB 3N2IA 1E0KA 3U7EB 1XPRA 2A5GA 1ZJ6A 4NCJA 2E87A 3FMPB 5F2EA 3BC1A 3EC1A 2JAQA 5EE0A 3NH9A 3SYLA 3THWB 1PV4A 4QJ5A 3NIBA 4HUQB 3MJHA 2WWWA 3UMFA 1WRBA 3GJ4A 4DT1B 5FH9A 3GJ8A 2QL6A 3BD9A 1UBGA 3AF1A 4C3ZA 3AVTA 3P4XA 3VHLB 1K8RA 1AKYA 3EA5A 4MYHA 2BM1A 1KI6B 2WWFA 3M6AA 2GZAA 2H1LA 1XMVA 1Z8FA 3U44B 2QNRA 4HDOB 3OFNA 2W2VA 4KFUA 1IHUA 4BRUA 1NKSA 4PQRA 1XXHB 3B9PA 3NKVA 4Q01A 3ZVLA 5E4FA 1W4AA 1TEXA 2IBMA 4ABYA 4QC2A 4ASUD 1SXJB 3MWYW 5EP3A 1JEEA 1ZYUA 3T61A 3ADKA 5EQTA 4Z54A 1E9BA 1U8YA 1E2IA 4PPQA 2XSZA 3EZ6A 4IOMA 5FI0B 3SE0A 3KB2A 2RGGA 3D6TB 1UKYA 1EESA 2VLIA 2ECKA 2ZQ5A 1JQJC 1SXJA 1XRJA 4D82A 3CF6R 3GJXC 1II8A 3A4LA 2PLRA 2ZRBA 3DVLA 1Y63A 2ZRMA 4QHYA 4XOIA 1P2TA 2DFTA 1VHTA 2VSFA 4TMXA 5FTMA 4RVCA 2BBSA 3AP1A 5BQ5A 2YKGA 3QF4B 1Q57A 2GXUA 1KI9A 3NWJA 2XXAA 1CBUA 1XEWY 4MRVA 3WNBA 3LRPA 1I4TD 3K09A 3P20A 4MRSA 3RRZA 1VPLA 4LJ8A 1E6CA 4K81B 5DO9A 3NDBB 221PA 1I2MA 1QZXA 2ZYUX 5FBQB 3OFND 4DLUA 4DVGA 1P62B 3LV8A 4URYR 5FBLB 2OG2A 3GQBA 4M53A 3D31A 4AK9A 1XEXA 2NG1A 3L8YA 2XNDD 4OHWA 5TB5A 4R71A 1U9IA 4W5JA 2NO0A 3GJ5A 4RFSB 1LNZA 4QGAA 4B32A 4C2TA 2K5UA 3BIFA 2PEZA 1KMHA 3THXB 5KNDA 4QBHA 4HEJA 3QJYA 2HT6A 4PXAA 3CUEF 4DDUA 1N6LA 1NVVR 4PO8A 2VF8A 3RANA 1SVMA 1KI4A 2JCSA 3QUSA 1FUKA 1JB1A 1SHKA 3TK1A 3IBGA 1G9XA 4X8LA 4DSOA 1E99A 1YR6A 1YZKA 1GIAA 1NLFA 1UM8A 3QBTA 1EFCA 2CCKA 2FGJA 2ZIAA 5KSPA 5IF9A 3OIYA 2MMGA 3LVQE 3RRYA 5LB2A 4B3XA 1FL9A 5J4YA 1C4OA 2ZU0C 2RGXA 2VHQA 3U3OA 4DBLC 4OHYA 1QBKC 4PC7A 5E7JA 3CBQA 1DG1G 4PPGA 1VG1A 1AZTA 2FDCA 1HEIA 1AN0A 1OIWA 2KBFA 4LOAA 2O8CA 2R6AA 1YKSA 1Z0KA 2Z6VA 4HZIA 1X86B 2HT1A 1Z6GA 3CH5A 3PEWA 2XNDA 2ZYWX 2J45A 1SVIA 4DCVA 4PC1A 2P65A 1MOZA 1TADA 1KNXA 2OFWA 3GLFB 1NN3A 3L8ZA 2F7SA 1N0WA 3SYNA 1ZUHA 2OO7A 3WP0A 1HA3A 4MGYR 2JLVA 4TWZA 4DJTA 4RCZA 2P5TB 2RAPA 2E1RA 2Z4SA 3BE4A 3DPUA 1T0JB 521PA 4B71A 4XWKA 1R0ZA 1US8B 3AP3A 5E3HA 2ERYA 3H4MA 1IXRC 1UPTA 1E0JA 2ZRKA 4JL6A 3FHTA 3U4QA 3R9IA 2WV9A 1KK1A 3QKSB 2VP2A 2YJTD 5TXGA 1RRCA 1E1RA 1SVSA 3HYRA 1TUIA 3IPXA 4JLNA 1ZM9A 3KZ1E 3TVDA 1AKEA 4FWTA 4ZKEA 2ZSFA 4Q4JA 3C4JA 1FTNA 4YMVA 3CZQA 5DLQC 5JEEA 3W8RA 3B82A 4EQ6A 1VDZA 4C0JA 2R6CA 1C9KA 1W0KA 3M0EA 2QU8A 2ZJ5A 1OV4A 3OEHD 2QY9A 4L9SA 4B43A 2D06A 2NGRA 3PUZA 4NYJQ 3EZ7A 1TF2A 3K0EA 5D3QA 2ZUBA 4URVR 4G0NA 2YYZA 3CPJB 4LC0A 3J81k 2BM0A 2WSMA 3B7GA 2IYWA 3QE0A 1E79D 1GM5A 1W36B 1QHIA 2ZU6A 3AKEA 2EFDB 1N5LA 1Z07A 1J2JA 2YOFA 4GBMA 4OI4A 5SZJA 3ICEA 4PQFA 2DBYA 1I4LD 1COWD 4NKRA 4PSAA 3B2EA 2IT1A 3BS4A 2OXRA 4FI3C 1AGRA 2OHFA 1E3MA 3JZMA 1SVOA 4BASA 1PVOA 3THOA 1ZM2A 3SHWA 1XEWX 4PHTA 3LAWA 1HH4A 3GJ7A 1G5RA 4N0EA 4B44A 1VIYA 3FDIA 4CEIB 5KTYA 3CNLA 3LBNA 3WNCA 4TZ0A 4JBXA 3IO3A 1TTTA 3SZRA 2J7PD 1VG0B 1Z2CA 3QENA 4OK6A 3BH7A 4NYIQ 2G83A 3VX3A 4B76A 1GDDA 3ZGXA 1EWQA 2QG6A 2GBLA 2CHQA 3P4YA 3VR2A 1HQCA 1H8HD 1JJVA 4DDTA 3B1VA 2AHOA 4AYTA 1R8QA 4TQ9A 1A1VA 3K8YA 3SS8A 4GMXA 1NG9A 4GMDA 4A0HA 3F3YA 2FMXA 5H68A 5C2JB 2D7DA 1IXSB 3TBKA 5L3SA 1NN0A 2AR7A 2CJWB 3OEED 2VF7A 4ZCIA 2ANBA 2F43A 5HE8A 1G3MA 1YR7A 2EFHB 3RS2A 3B8HA 3TQFA 3SOPA 4TZ6A 3GMTA 1MRNA 3NH6A 5FTNA 2JLWA 3CR8A 4JLDA 1E0AA 4PX9A 4TYWA 4KHZA 2VP0A 3T5GA 2ZUDA 2D62A 2AFHE 3G82C 4HAXA 5TV2A 2CK3D 4KYIB 1N5IA 2GK7A 3I62A 1WB9A 1KK3A 1NMYA 3A1WA 2ZRNA 4B48A 4A82A 1P2UA 3LLUA 2ZREA 1R8SA 2GAOA 2XEXA 2OM2A 2XB4A 3E5HA 1NG1A 3EASA 4MH0R 3T15A 3REGA 1U94A 4NMMA 1YRAA 4PHHA 1NJGA 4BZPA 3IKJA 5J4HA 3R8CA 2IUUA 3O8RA 3GPLA 2IHBA 4MRNA 4C0KA 1QHHB 2W0SA 3DM5A 2ZAMA 1ZNXA 3MWKA 3N2EA 5CYOA 4GI7A 2VHTA 1LY1A 2P6RA 3LVRE 2WPDD 2IF2A 4KO8A 3PV0A 1AK2A 2VP6A 1FPMA 1CRPA 1MO5A 3Q8XB 2ZEJA 2HLDA 4HAWA 5EE1A 2A30A 3VFDA 1MO3A 2B7CA 3A6PC 2QAGC 1ANKA 2BJWA 2WKPA 4KBGA 3WYFA 421PA 4CVNA 4B6EA 4CT5A 5BYKA 4AYXA 5TY0A 2CBZA 2XB2A 2HUPA 4BFWA 2PT7A 1HURA 1T3LA 1ZNZA 5JMTA 1WBBA 1W5SA 4OHZA 1NIPA 721PA 3LX8A 4FCWA 1X8LA 2GJ8A 3K0CA 4BFZA 1KZ7B 1JXOA 1DADA 4R98A 2FFHA 4C0BA 2DFNA 2QMEA 3HYTA 2QSYA 1OXVA 1TQDA 2WIBA 5EZ5A 1ZU4A 2JATA 3AUYA 4C0HA 1X8JA 5F9FA 3ZZUA 3PEYA 4A0GA 1AIPA 1CR0A 4FCVA 1YJ5A 1RE0A 1YZTA 4ASUA 3TRFA 4IVPA 2ODEA 3QKSA 3Q3JB 5HE9A 2R44A 3FKQA 2ZRIA 2Q9BA 2ORIA 4DRZA 2JLZA 2F9LA 2FSGA 2P0EA 2F9MA 2GCOA 1GL6A 1Z6TA 1WDTA 4TL7A 3KQUA 3LFUA 4YDHB 1W44A 5DI3B 2NO1A 3EPLA 4XWOA 3KXLA 4DLWA 2QI9C 1G21E 2J59A 4YC7A 4D81A 1D8TA 5CM8B 2WTUA 2BKUA 1U99A 4TTRA 3RAPR 3EX7C 2JJ2A 1S0UA 1U0HC 3BFVA 3VMFA 4CEHB 2XXAB 4X8MA 3KQNA 1NVWQ 1G7TA 1KYIA 2QROA 5CJPA 5KNCA 5KYKA 1RVDA 5BXQC 1LF0A 1XD2B 3OIWA 4KU4A 1GITA 2OFXA 3BK7A 3Q85A 3TGPA 4ESVA 1F2TA 2FEOA 3UATA 4IXMA 2X2FA 4YMSA 3AVXA 5HCNA 4BZXA 1Z6YA 2QTVB 1R0WA 4XVUA 5JI2E 4A0FA 4M9XA 3KTAB 4RD1A 3OESA 4B2IA 1NSFA 3QF7A 4NU0A 3P27A 4GZMA 3ZIAD 4F7WA 1N5JA 4WA7A 4E07A 3SC3A 4I1VA 2DYKA 2V54A 4MDFA 3MLEA 3DKVA 4BFXA 1Z2AA 1E2LA 4BZQA 1E2EA 5FL3A 1T8UA 2V55B 3QEOA 2J0UA 1RFLA 4Z8YA 3U61B 2O8EA 1G3UA 2PZEA 3LNCA 1GVNB 1TX4B 1CKEA 1XFAA 2OBMA 5AWFC 4G5OA 1IONA 1W2HA 1UKZA 3DZ8A 1IBRA 2Q0HA 5AJZA 1E4YA 4D0GA 1B23P 1KJZA 5M04A 3REFA 4QRHA 3MAAC 1XP8A 1KJYA 5CJ2A 4DT1A 4TLBA 3CLVA 2W6JD 1D9XA 3SEAA 3SU8A 2BCGY 2CVHA 5DE3A 2ZRFA 1KMQA 2J41A 4RD0A 5FOXA 1Z5ZA 4A2WA 1G5TA 3PCRB 4TT3A 4B2LA 5DN6D 5JJIA 3P26A 3UMRA 5D3MB 1R6BX 4W9MC 3FGNA 2ZRJA 1P2SA 2IWHA 1QVRA 4Q18A 5KOYA 2V6IA 2JIZA 2A5FA 4PHFA 2G0NA 4G01B 4NCIA 1ZBDA 1MR3F 2C5LA 1X1RA 4Q4HB 4Q4AA 3MUFA 4GP6A 1H65A 4DB2A 2FA9A 2GKSA 5IT5A 4QL3A 4R9UC 5KU1A 2P3SA 1OXSC 2WKQA 2H18A 4KCGA 5G53C 2GCOB 1A4RA 5H1YA 2H57A 2R2AA 2CHGA 2WAYA 4MYTA 2WPDA 3QQ5A 2R6GA 3IHLA 2ZRAA 4LPKA 4BRWA 2A2ZA 3AQ4A 1GWNA 1AM4D 4V02A 2DPXA 3ZZTA 4NHOA 2FG5A 5KPDA 2ZJZA 4JBWA 2W2XA 1BMFD 4QJ4A 1G8PA 2RHMA 1ZP6A 4YDSA 4M1MA 2ZM5A 4KVAA 2IYXA 4P0TA 5A4JA 1UEIA 4FMBB 5JSZB 3AB3A 1N6HA 3RRMA 1HTWA 4JSTA 3TJZA 4CF7A 1A82A 3Q7QA 1WP9A 1JECA 3AF4A 2ASEA 2HYIC 4M22A 4QGHA 1PZNA 1Z6AA 3TAHA 121PA 3BJIC 1XPOA 3QXHA 1ETUA 4IOLA 5AK0A 5EP1A 4MRRA 2IYYA 1YU9A 5FOTA 2XX3A 1K6MA 3IIKA 1KO4A 2OAP1 1E2KA 5GADl 2OESA 1IN6A 2DHRA 3CRQA 3B6EA 4C9BA 1RJ9A 4Q7JB 1GRNA 5HZKA 4ZCMA 3A1SA 3LW7A 1KSFX 3W5JA 4DCNA 4L15A 1EFRA 1BYIA 4LGMA 1NVXQ 5EXSA 5EUMA 2OSBA 2MSDB 4G3XA 4PPNA 3BB4A 2C99A 1UKEA 5H8WA 1VG9B 2IS4A 4L8GA 5FOSA 1TQ2A 1ZD1A 2GRJA 1W36C 4CT4B 3K53A 1NY5A 4JT4A 1KI3A 4DIDA 3CX6A 4R2HA 1GSIA 4DLTA 3A37A 1ZIPA 4BLQA 1CULC 3OE7A 4Y0AA 4B73A 1XWIA 4MGIR 4I4LA 4RZUA 3OIVA 3UXMA 3HP1A 4Q5IA 3WMFA 4US1R 3TAUA 3A36A 4NTZA 2BKEA 4EFLA 2AL7A 3GD7A 4NE2A 1G3QA 1BH2A 2BMEA 2QE7A 3I73A 4C2UA 3MJRA 2ZJYA 1MRSA 3EWSA 1OIVA 4KV9A 4CGZA 4C7OB 3NBYC 3IIJA 3OEEA 3WP1B 4D4MA 4V0KA 3GP8A 2Z5FA 2BEKA 1JALA 4S35A 3SBDA 3X1ZA 5F9HA 1M1YE 2GETA 2ZVQX 2ZSAA 3DO6A 4A36A 1E1QA 5LBIA 1IM2A 3MD0A 2P2LA 2WJVA 4MGZR 2OLJA 3VR6A 1FTSA 2ZRGA 3EXAA 5EZ6B 3CONA 2AFIE 1KJWA 1OJLA 2IYLD 3IQXA 4M4SA 2WAXA 5FUYA 3KQLA 4BUJA 4WZ6A 2AWOA 2QTFA 2O0KA 2CVFA 1ZNYA 4TSFD 5FPYA 4US2R 3LX5A 3TIFA 2R6FA 2A5YB 3A58B 1E2JA 2IX3A 4KYUA 2OCPA 2IS6A 1M7HA 2YWFA 2ZROA 1TU3A 3K9HA 3VKWA 3UK6A 1VYTA 2F55A 4IKEA 4B75A 4TLAA 2FX3A 5FOUA 3OZXA 4JSYA 4WW0A 1ZVQA 1B0UA 4P4SA 1Q44A 3SQWA 3L0IB 1HQYE 2G88A 2RCNA 5E95A 3U3JA 2VSXA 2BHRA 2PX3A 4XWAA 1EFHA 2H92A 4LYHA 4BLRA 3IUYA 4UQOA 3K09C 2ATVA 5KDOA 1XB2A 2H5EA 4PC3A 4A8JC 2QSZA 1Q21A 2W6ID 3N70A 2O8DA 3KJEA 2F43B 1FQKA 3B1YA 3AUXA 621PA 2BIFA 2XJ9A 1R4AA 4M9ZA 2VBCA 3CX7A 4B74A 2VIIA 1XU4A 4FINA 4M1SA 4LRWA 3KKOA 3TR5A 1NMZA 2DFKB 1G3IA 4P32A 4Q4JB 5AJVB 1SKYE 2W6JA 2RB4A 1KI2A 1QDEA 3GLGE 3NHBA 1FUUA 4IDPA 4JVSB 4V0MA 4XSGA 3E1SA 1BMFA 3KJIA 3RDPA 1ZRHA 4M2LA 1YQTA 4GRAA 4LWZA 3V4FA 4FMDB 1TQ6A 2BBTA 5J47A 2WJHA 1FW6A 4GNKA 2HV8A 1EGAA 2C9OA 4CEJB 2CHVA 1S9DA 1KSHA 4F38A 4P4SB 2QT1A 1ZM4A 3W3ZB 3FFBA 2UZIR 1TF5A 5DIFA 2VH5R 5JWHA 3EZ2A 3PXGA 4RSGA 5IRCD 4NYIR 4OI2A 1CS4C 3H2YA 4CW7A 1IJFA 5C1BA 5JCZA 1T9HA 1U9IC 3VNVA 4TLCA 4WOPA 3GJ3A 2RMKA 4TQUS 1AQUA 3NG1A 1FX0B 3CWZA 4I1SA 1A7JA 4A8JA 1Q1EA 2XOKD 3GEEA 3TW8B 3LW8A 3ZS8A 2QGNA 3SFZA 1IY2A 4C0QC 4D4JA 4EPVA 2R8RA 1PLJA 3IEVA 3TVTA 3CIOA 4LJ7A 3SN6A 1EFTA 1X3SA 1PLLA 3FWYA 5L3VA 3AGPA 3EIQA 2GJKA 4CZ2A 3U7FB 1HT2E 1WMSA 4DWJA 1CP2A 2MSCB 4TLEA 4Z1MA 2ZE6A 3QKRB 3C7KA 4NYJR 2QN6A 4LZZA 3CR7A 1E96A 1ODFA 1G16A 1GNPA 5HPYB 2BCJQ 2QM8A 2OUKA 3IBYA 3C8UA 3ZVRA 4HAUA 3RHFA 1W49A 1S3SA 1W0JD 1JR3A 3EWAA 2ZRHA 2W0MA 5HZHA 2J46A 1OFTA 1SZPA 4AD8A 5KO2A 1H8EA 2YHSA 3QPUA 3TR0A 3UPUA 2ZR9A 4TYYA 1SXJD 4A4DA 4YMUA 3K9GA 1OH6A 4M1TA 1FZQA 3GLFA 2WSSA 2FFBA 5JHHB 1OPXA 5EP2A 4JBYA 2EWWA 2VL7A 5F98A 2ZI3A 3E2IA 1DG3A 5ELXA 4C0AC 4M0LA 1JNYA 1T3SA 2PMKA 2PBRA 2PCJA 2C9YA 3CPEA 1JXMA 1M7BA 1Q1QA 3B1ZA 1OT3A 2YOGA 4QNRA 4UNPA 4XSHA 4B3CA 1IOZA 4YXWA 1ONBA 1DARA 4DCSA 4IHQA 2LKDA 2IC5A 4XH9B 4IEEA 3SFVA 4ZO4A 5DSZA 2GXAA 3HJNA 4LUCA 1RPZA 3JVUA 2IUSA 2JA1A 2HJGA 2Z0MA 2W00A 3W6PA 5FUVA 4TYNA 2RGNC 3OHMA 4U7DA 3AVQA 3R9XA 3AGQA 4OKSA 3R20A 2I4IA 3NBXX 1J90A 1G8FA 2GXSA 2A3RA 5J40A 2JLSA 1NI3A 3BH6A 5J4VA 4B33A 2XZLA 2D7CA 2EU8A 1XX6A 4F93B 1LS1A 3IEUA 2VHUA 5JI3E 2UVQA 1CJTC 1X6VA 3GCGA 2JDIA 4ZI3A 1NLZA 1UBEA 2QPTA 2I1VB 1GRQA 3SJCA 1KDOA 3PVSA 2NPFA 4HAYA 1IQPA 3K70B 4TMZA 4M1KA 5GJWC 1ZIOA 2YINC 4C0LA 2W6IA 3DM9B 3K9LA 2P6UA 2ZJ2A 1NVVQ 1QHSA 3MWJA 4DDVA 5DI9A 1F48A 2AXPA 1P3JA 2V1UA 1KKMA 1KZGB 2EQBA 1GG2A 2B21A 3IPYA 2C95A 4PHGA 4XIGS 5FR1A 3SYKA 3O47A 3RRNA 1DAMA 2OE2A 3GLGA 1E69A 1XXHE 2IXGA 4Q9LA 4AC9A 1DAHA 2F3TA 2XTNA 4TMVA 4Q9JA 1XMIA 1XD2A 3WRXC 4FWIB 4B35A 2JJ8A 4JLBA 2DWOA 3ASYA 3RS4A 5CLLA 3DL0A 4NH0A 4IVRA 3TUZC 3ZD7A 4HZUA 5GVRA 5CB8A 2KJQA 3PFIA 1P2VA 4QM7A 4HLCA 2EFEB 1N6KA 5DI3A 1OKKD 4ZDWA 1S96A 3W34A 2F1IA 3MMPA 5B2ZA 1ZAKA 4AIIA 1E9FA 2JEOA 2EFCB 4PAMA 1GILA 1OFUX 2JDID 3KQKA 3WNDA 4ITRC 3B9QA 1J99A 5KPJA 1PUIA 2ODWA 2VP9A 4RKEA 2Z83A 3PENA 2DFLA 3I5YA 2PJZA 1SULA 2ZETA 5BW8A 2H8KA 3AVOA 4G5RA 2DR3A 2F1JA 4IOJA 5KSOA 4RD6A 3RYTC 4Q7LA 4FCTA 1G1MA 3K0CC 3LH5A 3U3KA 3VR1A 2QMUA 1CXZA 1CJUC 4DZZA 3AH8A 2GJAA 3QNUA 3TE6A 1G20E 3RWMB 2GK6A 3U6KA 4DUGD 4DEYA 4JLVA 4XTCS 3GFTA 3FOZA 2QENA 3H1TA 3A4NA 4NDZA 5IK2D 4DSUA 4R7ZA 3AKDA 2Q3FA 2CLDX 2WJGA 5JECA 4UNQA 1OFIA 2GZDA 4LPSA 4U02A 3BBPA 3M4YA 3MGCA 4KFRA 4URUR 4BEBA 2BBOA 1XMJA 4Q9HA
chains in the Genus database with same CATH superfamily
3IT2A 1V1MA 1J8QA 3I6MA 4JEUA 5JAIA 2BSQA 2Q4TA 3KPUA 4BNLA 1B00A 1YBMA 4RDIA 4QPJC 1F5NA 2F1RA 3EVGA 3PXXA 4FXPA 1P7CA 4NAVA 4LSGA 4XVHA 3RHTA 1CZOA 2UXCB 1WDLA 2EYUA 4A3SA 2QVGA 4L8LA 1IHOA 4HGZA 4JELA 3T1NA 4YT5A 3AG5A 3AINA 1NJ6A 3HUUA 2ZBVA 3N2YA 4DQVA 2JGNA 5HQTA 5IM4F 3VR3D 2OP1A 3JAMA 3K0SA 4FGZA 1YMVA 1AKVA 4CIDA 1SC1A 5BN4B 4RGYA 3VPCA 4NI5A 4IG9A 5DYYA 3Q9NA 5ENZA 3NYQA 1YK0A 1N4DA 3KBBA 1IWPB 2II6A 1KY5A 1V9CA 4BTVA 5C18A 2HRDA 2NWQA 1U9CA 1RC1A 2G9NA 1FDTA 5DISB 1VCIA 2BEWB 3B53X 4HEA1 4O4JA 1JDUA 3C3PA 2TMDA 2AN9A 3P2JA 4HX9A 1Z06A 1B6RA 2WIKA 5TQJA 4KXXA 3UENA 1U81A 1V6CA 4FJ1A 1FJHA 2H0RA 1RKVA 2B82A 2H59A 3C0KA 1VP9A 3D7NA 5LQAA 1LDNA 2WSIA 1R50A 3N7UA 2JLBA 1NNSA 1VTKA 1LVUA 1NY6A 2X86A 4Q3CA 2ISSD 3AW9A 4V38A 3NDIA 1RRKA 3O3NB 2QZJA 4M1OA 4Y9UA 3G59A 2QUKA 3HU1A 1QHXA 2H7XA 2ODQA 3R7WA 4RVOA 3I4LA 5C4GB 1AS3A 3FB4A 4BC1A 5H16A 5JXGA 5KNLA 2ATIA 1E1RD 1MOSA 1UIRA 4GQBA 4OJTA 4XTRA 2IS1A 4ZAFA 1SR8A 4OJYA 3DPSA 4KQCA 2YX1A 3IIIA 4MUIA 4X63A 4DUPA 4G8JA 1KR5A 1OTHA 4JC8A 1UMCA 1KMHB 2GCNA 4HATA 5NLLA 3VTZA 1FFAA 3FJ1A 3O5AA 2FPMA 2IHVA 5J2UB 5CXQA 3IP9A 1M75A 4IGAA 4D43A 5JS7A 1A4IA 3SWWA 5ALVA 4CDGA 3KL4A 4IXNA 3BMOB 4J6EA 1H1TA 1KH3A 1OFHA 4GOXA 4K87A 4LBWA 3K4QA 4D56A 2KHZA 1R10A 1LWOA 1JDSA 4WE3A 5FPHA 4BFSA 4UFPA 3L8HA 4BGEA 1QNLA 4G26A 3UYLA 5JD4A 1KORA 1Z08A 1JSZA 5KEIA 1N1EA 3LY9A 3F6BX 4LHWA 2NO7A 5F76A 5K3FB 5J2TA 2PZFA 3U4AA 1W4RA 3K1JA 1K7XB 2WM8A 1T2EA 4GYKA 2GEBA 1U1FA 2DTEA 3UWSA 4DY6A 4XYGA 4KLAA 5JLJA 1UPCA 3BEDA 4WXRA 3VMMA 2K4MA 1IPHA 5JAMA 1CF4A 3FHOA 4QOHA 4K9SA 4Y0NA 4YFYA 1CIPA 4I5IA 4M21A 2D0DA 2X2OA 4UNSA 3KKPA 1Q91A 2X9GA 1ADJA 4IP0A 3X3HA 4QUJA 2MOKA 4Z1MD 3BXHA 2EKBA 2VPWA 3AQIA 4NZ9A 3RROA 2I9KA 1P5JA 2HW8A 3Q2KA 3GFRA 3ZDRA 5B5SA 1XPJA 1YB2A 1PJBA 4DLLA 3DEHA 2D4HA 2GZRA 4RK5A 1Y7LA 3W9SA 2DZDA 2X23A 1DTWB 2IZZA 3PUXA 5BV2P 1QS0B 1KDPA 1VKJA 2R6JA 2R8ZA 1YQEA 3OJLA 4FR5A 2XGGA 3HLTA 4RJIA 1OXXK 1JHYA 5CLIA 4GOLD 2XUPA 2HHLA 2ZSJA 4G2TA 1Q50A 4MWGA 1ESZA 2O1EA 2ZYIA 4DADA 3COJA 1NW6A 3ER9A 4JXZA 1H4QA 4QBFA 2W2TA 1VLVA 2ONCA 2C4KA 3EAFA 5F4BA 1ONSA 5ADVA 3ZHQA 4YBZA 3T0FA 1GL9B 1Z4IA 2J9YB 5E6RB 3BICA 4GVPA 4WQMA 1HQKA 1Z7WA 3WK5A 5HIKA 2QN3A 3TZCA 1NVAA 3IIMA 2F9FA 3P94A 2GJSA 4JVNA 2XZPA 1KJNA 1C30A 4L8FA 4YRLA 3ZDAA 5JHGB 1BNCA 1C8BA 3NQ41 1C8LA 2V03A 2WFMA 2XB6A 3H5AA 2QLJA 3FX2A 4U6SA 5JZBA 4YMTA 5HBRA 4BECA 5AIAA 5BPFA 2CNDA 4HWRA 4MKGA 3I61A 1E7SA 2RK6A 3HXOA 1N1MA 2X8LA 1HLDA 4RM2A 2PV7A 4UPVA 3C16C 2PSJA 1QGUA 2HRRA 4P93A 1E2MA 2H2WA 4OATA 3RAGA 4P38A 2PYIA 1SM4A 1KDRA 2JIBA 3GEPA 1VGVA 3KYJB 1YBVA 4CKEB 3T5AA 3D4PA 4L0CA 1ADYA 4GQAA 2B8EA 2BFWA 4TTPA 1BOFA 4J0IA 3NDPA 5U4QA 5GZ3A 3SDZA 1JL3A 3A04A 3ZQJA 3L0DA 5K8UA 4P4TA 5LC1A 3WMEA 5F2NA 3GLHA 2SCUA 5F1YA 3I9V1 3K0BA 3K0AA 4B4UA 1G6Q1 2ORED 3GDOA 4Q21A 3FDZB 4X66B 1GPYA 1ZCBA 1O9GA 4YJGB 4NBUA 5C32A 2VI5A 3ND6A 4BVBA 2UZ4A 1NPDA 3IR6A 3BTUA 4H7PA 5DB4A 2OVBA 3F5FA 4YACA 3T3EA 4E6PA 2ZUUA 3VOSA 4YEDA 4B6FA 4B3GA 1G1AA 3W90A 2XRZA 3OE5A 2DPLA 3EQ2A 3LLCA 2OGTA 1LU9A 2I3GA 1CY0A 3QX8A 4GC5A 1Q1NA 3DTVA 3ON5A 4MLZA 4URFA 3U7QA 2EBHX 4GBED 2QD5A 1WZ2A 4L9WA 1YGPA 2ZT6A 3GJ6A 1KY3A 1PV1A 3QVVA 5FORA 1EVKA 4R01A 1X7YB 1LKZA 1OE0A 3KS9A 1QHYA 3L93A 4QDTA 4B5KA 5C9ZA 2PVPA 2NO9A 1VCOA 3BXGA 3DZKA 2Q2VA 4ZEVA 1KZ4A 2VSQA 1TLFA 3UV7A 2JGIA 3KJXA 5IBCA 5K0GA 3QG1A 2H9AA 4JEIA 1ZM7A 2N46A 4F6RA 5LM3A 5FLXA 2HI0A 1UBFA 3THRA 1J00A 1L5FA 1QP7A 3AI3A 5JRJA 1Y7PA 3LLVA 1EYZA 4ND7A 3U4QB 3RLFA 2PO5A 1K5GA 1NF2A 3FDZA 5A5GA 3NHPA 4FGUA 1HUQA 3HZZA 4MUAA 3JQ7B 4F4CA 3K0AB 2CLIB 5KS2A 1R74A 5F5NA 1XJQA 4BLOA 4V03A 3BWBA 3ROEA 1E9CA 4P7FA 1GG9A 3CZ4A 1NMEA 4BO2A 2IUTA 1G7CA 4GE3A 4Q4CA 6ADHA 1RM5A 1REQB 3I83A 3V8QA 1HL3A 3V55A 3O03A 3TTUA 2VK8A 2Y99A 2HREA 2ZI5A 4GOOD 3TSWA 5DHQA 4MUMA 1XZBA 2A0FA 3VR5D 3L8MA 1I4WA 1A69A 2O2EA 3HCAA 4V0LA 3QIAA 3DLIA 4QODA 3PQEA 3KD2A 4POAA 4ZI5A 3WAJA 2DBQA 3HU2A 3GCWA 3GL9A 3WWZA 1SQ5A 5F51A 3P97A 5CFPA 2R2GA 1HRDA 1PVDA 3QA9A 4JLKA 1HZJA 4P84A 3KSDO 4ZTZB 2PX8A 1GYQA 2WF8A 1TPZA 3QF4A 3L0BA 4JZKA 2QNBA 3DD1A 1NMQA 3IBCA 4D96A 2NUPA 1GRRA 4Z4IA 2FB9A 2O3RA 1GU0A 2VHXA 4RBNA 4CFZA 3BXZA 5BV1A 3ZNOA 4U7JA 2YFYA 4DIEA 2G28A 4G1MB 1XRSB 1O08A 1USVA 2QAJA 2Z43A 3D8TA 4EBBA 1WBJB 1MTZA 3EOAI 4MQLA 2BF7A 3DCYA 3LQFA 4K2AA 3VHXB 2JVIA 3FPBA 1EXMA 4LTNA 4B4VA 3PS9A 3LXRA 5CA0A 3V8VA 3KVVA 3I2HA 3QU2A 3REOA 4RIHA 1E4VA 1RACA 1YKGA 1ZVMA 1Z6PA 2GZHA 4JOBA 1W0JA 4RX1A 1SK9A 5CK5A 4BO6A 3H4VA 1M74A 2R9VA 5C1PA 1DO8A 1L5SA 1S89A 1OLSA 3AR8A 4ZZ0A 1UKBA 3KYIB 5G3ZA 4EMTA 4YP6A 3PPVA 3KQHA 2H17A 2PAAA 3O9MA 1ZUIA 2AOWA 2YIVX 4KLZA 5FTLA 5CP8A 4N0DA 4O0MA 1Z4LA 2DH5A 2MR5A 3EG9A 1R4NA 1WPGA 1YZYA 5AKEA 3QXGA 4ZKDA 3DUWA 1E94E 3HBLA 3OMXA 4XUEA 3TL6A 4AKEA 1I3OA 2YMLA 3RU7A 3SD7A 3AT1A 4UMEA 4CQNA 1FSFA 2A9RA 3C8ZA 4NU6A 1YUNA 4CEIA 2LIPA 1DMRA 1NBMA 1JR6A 2GCIA 4INAA 1V2GA 3IAXA 2JCVA 2QA5A 3SC2A 4B81A 4PTZA 3T34A 2D5CA 1CJVC 4HYYA 5JO9A 1WULS 3H4TA 3M83A 4E21A 3AOEC 5B58C 5DJ5A 3H17A 2RC5A 4I1YA 4JVOA 4Q05A 3W2IA 1U1DA 4EOGA 3PUKA 3NHYA 4W5NA 1H42A 4EDHA 3MBKA 2FPPA 2O4UX 4G63A 4P7KA 5ANRB 1ODLA 5I7FA 3WQQA 2CMHA 1XR3A 3IMFA 3PTLA 2CVQA 5FTJA 3R7AA 2KI5A 2Q1XA 1P3DA 3CLSD 4MCJA 2OHGA 3ASZA 3SMQA 3WLQA 4ZYVA 2HPVA 3U3DA 2I87A 1ILEA 5GONB 1GGNA 1K89A 1Y80A 1RRPA 3ECCA 4DLXA 2BEVB 3OSZA 3HDQA 1KR2A 3QWHA 4LNAA 1OFVA 1L5OA 1U2ZA 1XLUA 2BGKA 2FSIA 1XZIA 2HHJA 4LY9A 3ZDYB 3QPWA 4AFNA 2O8CB 3R4CA 2CL7X 3VC3A 2J7KA 1HNZB 1ZAYA 3D6NB 1ZX1A 3ADPA 3C3EA 2FY8A 1L8OA 1AKTA 3WL8A 2ZAOA 4TT8A 1UMCB 3IAEA 1Y9AA 2CUNA 3GUHA 3AETA 1AQYA 2WBLC 4IKOA 3G9ZA 2DSNA 4QUBA 3ZWNA 3TG2A 1LK0A 4FKZA 3RS3A 4WZAE 4MUBA 4B4OA 3CTMA 3UFBA 3NCTA 4C87A 3OQNA 1DLJA 2GYVA 5F73A 1IHYA 2JCYA 1NRWA 2B37A 3CTPA 4D2IA 1CLUA 2HADA 2H9IA 4NBKA 2Z4TA 3RC1A 1MOQA 1AX9A 2YH2A 3ASVA 3CSSA 1MQ8B 4PLCA 1ZL2A 2CVPA 2YL2A 3PHIA 3QIVA 2R00A 3PDWA 3BKWA 1K68A 3R6GA 4HQOA 4LDNA 4UREA 5G41A 3KX2A 3SJZA 4QNMA 1CYEA 3RW9A 1Z56C 3L0ZA 2VPZA 4TTAA 3QI7A 3U7GA 4OHXA 1Y1SA 1M2EA 2V1XA 4XA8A 4UZEA 3ZG6A 2Z8ZA 1NRIA 1ZW1A 3O91A 3WDMA 4FFOA 4B40A 1NX9A 1G8HA 1Q14A 2JFVA 3M81A 3C48A 2FSHA 4JB8A 1CU1A 4R8VA 2J8ZA 4G0MA 1Q3HA 1Z4PX 2Q45A 1NZFA 4TSRA 3MOIA 5HQ3B 3T9EA 4XVRA 3W4JA 3X2EA 2QUJA 3ILHA 1C5KA 1JH8A 3ZWKA 1VKZA 3T0GA 2CV0A 1P1HA 2GN8A 3K0FA 3RYIA 3BMOA 2D74A 3BWVA 4NNJA 1SOWA 3S1AB 3MRVA 2OAQ1 5E9AA 3BL6A 2MSKA 1A5ZA 5L3RA 4RZ2A 4FYMA 4HH3C 4FDMA 2ZIFA 3FYDA 1C3VA 1FTWA 3EVFA 3KLMX 5AXCA 1P5ZB 1AV7A 3BTSA 3ZZ0A 5JEDA 4FEEA 1LWNA 1ENYA 1G8SA 2AOUA 3E22B 4MQEA 4NE9A 4YRPA 2JAXA 5BRJA 3QXSA 3TIVA 3AEKB 3GVCA 1P9RA 3S1LA 4JT2A 1ZC3A 3HVJA 1Q1GA 1VG8A 5LLSA 4ALIA 1RYFA 2FEMA 3H1BA 3IH5A 4MQ5A 4Q3NA 1P0PA 1SBIA 2WILA 1GGKA 3G5LA 1XCLA 3TL3A 3BULA 3EHDA 2J9RA 1LX7A 4WAUA 5IK2A 2Y1WA 4U7WA 3FZQA 3NAZA 4IQGA 4QPPA 3RUCA 4GKKB 2ALJA 2D7JA 4MUGA 4UEJA 5E4TA 3CKYA 2EF0A 3RTEA 4PGHA 5COQA 1CUSA 3IPRA 3X1DA 2KPOA 3OM0A 3QHPA 4UTRA 1VLZA 5L3QA 3IDZA 4L4UA 2PS9A 2W11A 1KSJA 1LSOA 1P0IA 2BEUB 1XCBA 4WXYB 2AKYA 1OA0A 3I01M 3S70A 1BS1A 3W6UA 5ES4B 8OHMA 2DH6A 4TRMA 4RDXA 5HKBA 2X0DA 2AN4A 2W4IA 5BRNA 3IUEA 3UPDA 1ZJYA 2Q6IA 3BMXA 4BB5A 1VPEA 3L77A 4QECA 5BR8B 3FETA 4M37A 5E7IA 4P31A 2GEFA 1FC0A 3I8SA 3I3SR 4K03A 4UJ3A 4MWDA 3AF0A 3RK1A 2N3ZA 1N6IA 4KDCA 4XGKA 2YXBA 5AP9A 5EQJB 5FO0A 4F9TA 1Z25A 3BJZA 4HXFB 4ZJUA 2X0NA 3UB3A 1T25A 1PW7A 1JEJA 4IF6A 2A0KA 3UHOA 3HRIA 1WY7A 3NX4A 1UPXA 4BGDA 2DT5A 4EUKA 3QLEA 4DV3B 1HGXA 1Z2PX 3IVCA 1IPFA 2IYQA 3PGKA 2FWIA 4I1OA 4R2XA 3Q87B 3WXMA 3WZLA 3KP1A 3CLRD 4CMCA 2NUTB 1EP2B 3TNLA 2AG8A 4NS1A 4JJZA 3W1VA 1JWLA 1C1XB 3LL4A 2HA5A 3NBUA 1BMQA 4XCVA 1L2TA 2UUPA 2A4KA 2QPAA 2B2CA 1Y5NA 4RD3A 1T36A 5ILGA 3CWQA 4H08A 3VSCA 4F7DA 2VRCA 4L5BA 2NIPA 5I9TA 3RRBA 4HLDA 3B1XA 5DP2A 3I5AA 3TQRA 1XXLA 4UVEA 1SFRA 3OLCX 4UEQA 4KJZA 2Q5JA 1KJJA 1JQAA 5CDFE 3JQ7A 2F3SA 2O2JA 4AQYB 3KD3A 1ZK3A 3G79A 2DECA 2HXYA 4G56A 2KM1A 2OCXA 4HX5A 4U7GA 4CUZA 4NAHA 2FJUA 3RC8A 2BGLA 4G1UC 4IDQA 3IS3A 3I05A 3NP7A 4OJNA 4DCJA 2ZJ0A 5HKKA 4HYEA 5JMOA 2R5FA 2O54A 3ANTA 5K6AC 2PKQO 2OAGA 3B48A 5AUQA 1UP4A 3B85A 1RYNA 2IHNA 1X80B 2JCBA 1GCUA 5IG2A 3MJCA 4RFLA 5TQ2A 3PQDA 4P8RA 4DE5A 1EAMA 3DL7A 2G1JA 1RZUA 2X1LA 3IPLA 4XGRA 5SZKB 2XE6A 3SR3A 3BB3A 3OAAD 3EC7A 3T7RA 1TYAE 3ZK7A 6LDHA 1Y8CA 4KGXA 2H2FA 4IWXA 1KAOA 3IYLW 2B3DA 3N86A 3LCJA 3M34A 3V1NA 4G0OA 1NSTA 3Q15C 4ALNA 1NKTA 3MZ0A 2GEUA 1QG6A 2EZ4A 3I09A 2FMHA 3IESA 1KP3A 4TRJA 5EXTA 5JQGF 5JYEA 5KQMA 5ARDA 2D0IA 1ZK1A 2J1LA 5AVZA 5LQKA 4J0FA 1TU4A 2H7VA 4Z86A 3EIFA 2DWQA 4PYOA 1P1JA 2RKOA 3BYZA 4L6CA 1DVRA 3BIXA 1XT6A 4OQLA 1R1DA 4UQPA 3VUEA 4IFIA 5E8JA 3ZV4A 2ZAIA 4MA4A 2IX9A 3I72A 1X9IA 5JPDA 1RWNA 4ZVKA 1OYWA 5EVCA 1IIBA 2FSSA 4CKWB 2JKZA 4XYBA 5ARCA 1JG2A 4C4AA 5J2TB 4G6ZA 3ZHUA 5B1EA 1FX1A 2EJTA 4FYPA 2Z2KA 1FMJA 5FLYA 4YX9A 1XPUA 3K16A 1U0JA 2BFDA 2WU4A 2P6MA 1VRCA 1U7ZA 2A9JA 2DQZA 2VFAA 3IHTA 1D4ZA 2GBGA 2CMFA 1SXJC 2WUDA 2Z08A 1MX9A 5DT2A 4ZOQI 2WA1A 3M4NA 2I62A 3BSWA 2BGTA 5C8YB 5JNSA 4IKPA 3FMFA 3BD8A 3NBAA 4UOEA 3EDMA 4IRXA 5CW2A 3DA8A 3AOGA 1BVYF 2VAMA 2K6GA 4K86A 5IUKC 2OFFA 1IB6A 1TQHA 4AICA 1IM8A 4HVLA 3GARA 2WZBA 5JS2A 2QZZA 1KE1A 2HF2A 2QRJA 2RK3A 4B34A 3E9RA 3H9UA 4BDTA 4KBYA 1PGPA 2AOTB 2A88A 4FHDA 2Q2WA 2GZ2A 3EZLA 4M9SA 1HYQA 2A5DA 5F77A 5KDDA 3JZAA 4DGSA 1L3IA 3PSAA 3J81A 4MCHA 5FA6A 1PZEA 3OWXA 3G0BA 2ZKLA 4RHCA 3RU2A 5BSWA 4RJLA 3UANA 1P0FA 3KWLA 5HMMA 5AKGA 1MC8A 1MO4A 5EXXA 1A0OA 1QH8A 1YQWA 3K6RA 5LBUA 1UDWA 4BU0A 4K6OA 1W29A 2FWBA 3K2QA 1FP1D 4J0DA 5H83A 4ZT4A 5KREA 4UE6A 5DNVA 4F12A 2VJDA 1QGED 2RGBA 3L7IA 5CG1A 4EEZA 2WMDA 4JLSA 1IG0A 5BWNA 1MIOB 5EIBD 2CNWA 5GINE 2R65A 4MB6A 3L7BA 1C7IA 2VUTA 2JIOA 3KKEA 4D4LA 4NBTA 4O25A 3E35A 3PE6A 2HPHA 2C03A 2WSLA 1K5DA 2QUBA 3S2SA 1SD2A 4JVLA 1RC8A 2VK4A 4KFCA 5BN4A 1KDZA 1T2DA 2GESA 2NZXA 3LBFA 3MYRA 4KXLA 3EPHA 2YFKA 1TVKA 1N6OA 2ECPA 2IV2X 1J9ZA 3GEIA 4CLHA 4EJFA 1J7JA 5JALA 2G9RA 1PFQA 3ITEA 1BE1A 4M49A 4MW9A 2XD4A 1XYGA 1QIEA 5H70A 2WYOA 3ZLJA 3UK2A 2VK1A 5CT9A 3WJ7A 1WW2A 4BO3A 3ET5A 3K30A 2YC2C 2CXXA 4KRGA 3HRHA 4RD2A 4CN9A 3SSOA 3QOFA 3UKJA 1RZRA 1PNTA 3HN6A 3NMUF 3G2JA 3TFOA 5L40A 2PQ2A 2EVWX 4BJHB 2QL7A 3PR1A 4Q19A 2Q50A 1XD9A 1OI4A 1SEPA 1HMYA 4UAVA 5JSZA 1PW5A 4R9VA 1NW8A 5A0TA 2HEIA 2G9UA 4M99A 4UXJA 4H7JA 1N8KA 3IOCA 2JJ1A 1WXHA 2QIOA 3AIIA 4QHTA 2LE0A 3UG6A 3RFVA 1DIHA 1B74A 1CUBA 4RIGA 1K7FB 3A9TA 3EVZA 1TAHA 4WESA 5BY2A 2FSVC 3L4JA 1VL6A 2YYSA 5DBGA 1YZNA 1LD3A 2IXEA 3LKVA 1JIXA 3ZE7A 1UDXA 4QM6A 4PCUA 1GAJA 2VA8A 3FSEA 3IAM6 4ZDIA 3KE8A 4G0UA 1PYDA 1YZGA 1X1DA 5IH3A 5L3SB 1GAXA 1FYXA 2PPLA 2X4LA 3DOCA 1LW6E 2V6BA 4QRDA 2IYAA 1P2FA 1CB7A 2XTAA 1USKA 3QVSA 2NZ8A 3L6CA 2VO1A 4FXOA 4WUTA 4DV0B 1PG2A 2PUVA 1TZ2A 1RBQA 3CF4A 4TYQA 4S04A 1SBYA 4P3OA 2WC1A 2R48A 4EX6A 4UUBA 2OCBA 1MT3A 5A04A 1UXOA 4UVDA 3UIEA 1QRAA 2IYPA 4S3MA 5I9SA 1I7QB 4TKVB 3G2LA 3VR3A 5CH3A 3FMOB 4UUPA 2VPYA 4JZYA 2WSBA 2OXTA 3U4DA 4E5UA 3ICQB 1TU0A 1OSNA 1CVIA 2J0EA 2O2DA 4P6VF 5DXJA 2VTKA 1TT5A 2GSWA 3DHVA 5GZ6A 4ZMBA 4R83A 4LDZA 1OT5A 5AK3A 1A3CA 2BFEA 4HDCA 2FFAA 4F8EA 4WJLA 2QJOA 2O0LA 4CEHA 4BMNA 1EE1A 1WPXA 4XJTA 1I9CA 4EG1A 4YT4A 1FU7A 4PS1A 2CLMB 3TH5A 2I2DA 1N25A 3E5NA 3G68A 3F4KA 5FA8A 3QELA 2QQEA 4YONB 4KFSA 2A78A 2WDPA 3DBHB 4PNEA 5K03A 3D1LA 2QJRA 3RTGA 3ZLVA 4BWFB 3K71B 2I6TA 2QX6A 5I7UA 1LRKA 5ULLA 3GIWA 4XKJA 3AVVA 1A9QA 4H3KB 3U4GA 3L1UA 3GLFE 1R4MA 4EPWA 2PJRA 2XUDA 4R3WA 1A4XA 3IAS6 2P8SA 2ASVA 4HY3A 4JWKA 3K9NA 2BONA 4Q82A 3LMKA 4I55B 1J0DA 4TKZA 5B7QA 2RBGA 3IBTA 4NG4A 4LYAA 3S68A 1OQAA 3MLBA 4HFJA 3FWPA 3S29A 3R24A 3EXFA 1W8IA 1QLJA 2EL7A 2H31A 1F2UB 1FDIA 2R7LA 4RWEA 4D02A 3PYXA 5GJVC 4JYPA 3H0KA 3REQA 3UHJA 4BQFA 2COUA 1KI1A 1LXCA 2VAWA 4FGSA 3F67A 4LHVA 4WN3A 3NORA 5AM3A 2I5PO 2DUUA 4DPMA 2XQVA 3LUBA 3NJ8A 2PZJA 1S01A 2W2NA 4EKNB 2WZCA 1HE8B 2OD7A 4EPYA 1M6EX 2AFIA 3ZS9A 2EGUA 2O3QA 4Y2QA 3T1OA 2H00A 4CTKA 2P78A 2GNPA 2P0YA 2GH1A 3BQMB 4KUEA 2MTBA 3WB0A 4LFAB 1KL7A 4WY8A 4D8YA 2ZRDA 3IGFA 5KI6A 1G20B 3QLUA 3PEUA 4MHTA 2HBQA 2QX8A 4NCKA 1OKKA 4K9DA 2QR3A 4X61A 5I7AA 4BNNA 2GERA 2IF0A 2WNHA 4YAIA 2EW1A 3V46A 4RA9B 5DM4A 1FP7A 1MQ9A 4BTLA 4ZIRB 1RP7A 4II2A 1OHHD 3PGJA 4S2EA 1K92A 4TKLA 5GONF 1N2XA 3SQLA 3UWKA 1Q95A 2W4MA 1N7JA 2PYDA 3T7AA 3E23A 1BW9B 4GKBA 5EKSA 1OBVA 4JIGA 5AVRA 1F51E 1NC1A 4RTMA 3HVUA 4Y2UA 1IEXA 1EHIA 3HKBA 1UFQA 2ZS7A 2HJHA 3IP6A 5KKNB 2O2CA 2P5UA 2ZTUA 2V4UA 1ABBA 3OOYA 4KO2S 5EKXA 4FFNA 1GKKA 1Q0UA 3FKSD 1J8DA 1PSWA 3TSAA 1XVVA 5F7ZA 2ZRPA 3D7LA 3L6OO 4A1FA 1AO0A 2YV1A 2QZ4A 3MSCA 3KUDA 5J4KA 2RBKA 2IH2A 4ZI7A 1PWYE 1XZLA 2HCTA 3LFTA 3AHFA 4DV5B 2OHXA 4QATA 5TS2A 4S0XA 4BEVA 3EMDA 1M2OB 1F2VA 5DYNA 3JD2A 1I4OA 5HUHA 5IT9A 2WJ6A 1NAIA 3UBMA 2IBSA 2WIAA 4BNKA 2DY0A 3B36A 4FB5A 3IVXA 2HBZA 1KHTA 2SNIE 3CNNA 2A9VA 1XZPA 3C4VA 2WM9B 3DWIA 3T9AA 3LT2A 3U4IA 3UZUA 3MILA 3E5MA 1WA5A 1A95A 5DWDA 3IKLA 4R69A 3UAVA 4DSNA 1N1GA 1QO0A 5D85A 4Q9DA 3RVKA 3AR9A 1E1KA 2V96A 2GDJA 2RH4A 2XVAA 1ZK2A 3OF5A 1YZQA 1ORIA 1Z6XA 2R11A 4B3FX 4DIFA 4EY6A 4MYCA 4MPRA 3BDIA 3GQVA 1XCPA 4LBVA 4R2WA 4XJSA 1J8MF 4LRYA 3LTNC 1KAGA 2GSDA 4QRIA 4JP8A 2P40A 2XCSB 2XBUA 1XCGB 2ZK7A 3CRVA 3ZJUA 3ZJYA 4OGFA 3D2LA 4HSGA 2PWZA 3C15C 4LVUA 5KSZA 2VP3A 3EGWA 2PHZA 4YBRA 5K8TA 3TMYA 3BDAA 2FW9A 4GOND 4BQNA 1XTQA 3OOWA 4R8MA 1PK7A 1KO5A 1Y89A 5FPSA 3T1QA 4CR7A 1UWCA 1DBVO 2B5WA 4JYCA 5HF6A 4KDRA 4ZD6A 1GA4A 1IB0A 2IKQA 3HCCA 3MT0A 5FBRB 2QHXA 2VDKB 4QWWA 1UQTA 2MSEB 3OQ6A 1HY3A 3QELB 4BLPA 6GPBA 3OU7A 3L7NA 4N41A 1P44A 3OU6A 4GBJA 4OXIA 2DCMA 4G4IA 3FOWA 3WBBA 3KTFA 2FF7A 3GBSA 4W7SA 2PL3A 5EJGA 1J4AA 1VKHA 2E18A 1KPIA 3OIUA 1POXA 3KYBA 4AKGA 2LCQA 1VCMA 3LCUA 2EBWA 1D2EA 1WNFA 2B8NA 4CM4B 5JJBA 4NOKA 2B36A 2OHJA 3G1WA 3HR7A 1VOTA 3EARA 5H3HA 3U6BA 3DMYA 4Q9KA 1VL1A 3KLBA 2JKYA 1W1WA 3H16A 1PKEA 4LYJA 1BYUA 5HDBB 1AKUA 1XIVA 3M8KA 4C7BA 1DBPA 2F1KA 2JIRA 1KO7A 3AF5A 4FNMA 4REQB 5ALYA 2XUJA 4MKFA 1NR5A 4JITA 4PGAA 5HF8A 3SEQA 3WE7A 4I81A 5TMPA 1V1RA 1LSSA 2XHEA 5F5XA 2B5VA 3OLZA 1QV9A 2NZUG 4W5QA 3GLUA 1ZNWA 4LI0A 4KO1S 5J9FA 3TCXB 2WJWA 3IUJA 4RZQA 1V8OA 2I67A 4J4HA 2Q9CA 4LS3A 4MQBA 2QYOA 1LFDB 4I8IA 5DGTA 2WU1A 3VQTA 5FV7A 1U04A 2VDPB 3WB2A 4OUKX 1E9DA 1EUDB 4JBLA 3VC2A 5HR5A 2Z6UA 1M8FA 4IIGA 1TEVA 1G7RA 1N9ZA 1NXWA 4WN9A 1E59A 2FLVA 2R1TB 4NOJA 2ZSDA 1MF7A 4O2BA 5FRDA 5B1DA 5DZSA 1NTRA 5ITZA 2OWDA 3ZW9A 4Q9IA 3JQBC 1DDIA 5BURA 4BMPB 4IIJF 4TX1A 2DCUA 2AJCA 3SXPA 2VP4A 1JYSA 1KI8A 3R3UA 1JKJA 4IRUB 1GFSA 1XMXA 4HN4B 1WABA 5FLEX 1ECPA 5EIOA 3X1WA 4V0ME 1E3SA 1UC8A 2R60A 4OLAA 2Q99A 3CF0A 5C80A 3HKCB 4N5NA 5CNKA 2O20A 1KIAA 3M5CA 3O2JA 3QWBA 4M1WA 3ZX5A 5H5JA 3I37X 2K7ZA 2JFGA 1RMQA 1V25A 2QLNA 1C1XA 1G17A 3CNEA 3U49A 3HXMA 4RXTA 4TXMA 1W93A 2G36A 2QTNA 2YWRA 4MINA 5L8VA 3EG5A 4FR0A 4ARZA 4R1MA 5JSKA 2D4AA 2DWPA 5EC8A 2VWPA 5EWJA 4QT4A 5IJAA 2CEAA 3QBEA 4AMBA 4JD5A 4Z4QA 1TAQA 2KBEA 4KBFA 3OM8A 1P19A 4NCXA 3P1JA 2OLKA 4WOBA 3LBHA 1EFPB 2CXQA 1JVNA 3AXSA 3DZJA 4BLSA 1UP6A 5FLKA 4NV3A 2AJ8A 2VQDA 4XI9A 2BGNA 3FCAA 4D92A 1Z6ZA 2IXFA 1DS6A 2OORC 4ICIA 3JXEA 4Q1CA 1UBOS 3DKPA 4CCWA 4CV1A 3FXAA 1HF3A 4FLEA 3EQ9A 4IJMA 4ZYUA 4ABTA 3HZRA 1K7SN 3DE5X 3Q0TA 4EB8A 5EE9A 3B6KA 2K2QB 2CZQA 3UJHA 4HDAA 4Y2PA 3U26A 4LXGA 1IEWA 2O0JA 4EPXA 5A5DA 1KVTA 1ZOIA 3GPBA 3NIFB 1OH7A 4J94A 4ZQHA 3T4PA 1YCDA 4Z6KA 2C59A 3W9YA 1KF0A 3MINB 1DNPA 2BAGA 2YHBA 2WWGA 3V2GA 2OEPA 4OEHA 1EXWA 3MVEA 5DK6A 3VPFA 1OF1A 3R7SA 3ZE9A 1MVNA 3C1TA 4GSLA 2Y1GA 3ZQ6A 4UPEA 2YWEA 5I9NA 1OXUA 2PSSA 2FE1A 3RJMA 3FYHA 3VJMA 4E1AA 1Q92A 4B4WA 2B9EA 2A9KA 1WDMA 3VO9A 3UMJA 1M1UA 3UMSA 1K08A 1TDJA 2AF3C 1Q0LA 5G3YA 1RAFA 4QYMA 1U3DA 1U3UA 2WTNA 3JTEA 1T4CA 2WVAA 2ZSKA 3BK2A 4NECA 3S40A 4E31A 1MB0A 4F04A 4LRUA 1YCFA 4EF6A 5IC5A 2BWJA 2ZUCA 3VV2A 3P19A 2BGRA 4OUDB 2H4YA 2DG2A 1O2DA 4GOMD 4HPJB 4WLFA 1DJQA 2BGMA 2M1ZA 5BOVA 1UJNA 4WFKA 3I1IA 1TAGA 2RGEA 4AX8A 4BBJA 2IXBA 4ETWA 5K0JA 1JIVA 2BFDB 2FV8A 4TMWA 3DQZA 4EKGA 3TIGA 3UUFA 4OB7A 4UDYX 1OYOA 5H7XA 1WSBA 5LMZA 1W5AA 4OOEA 2REXB 2EL9A 3TSCA 3RHZA 3KQVA 2ZBPA 1KO1A 5G40A 3RS0A 4HGQA 1C41A 4OX9Y 3AVPA 5BPHA 5IWAB 2PGXA 1R7RA 1UK7A 3MSXA 4LZLA 1P74A 3LHIA 3LXMA 2Z2ZA 5SY4A 1WB6A 4BQIA 2UDPA 2V3CC 2J5RA 2YVLA 3A1DA 3F90A 3JYLA 1ZGJA 3U4HA 2PWBA 2IHJA 1H2ZA 4KXQA 1ODCA 1L8LA 2Q8QA 5T3UA 4EPRA 1P81A 3H18A 3LCVB 3O7MA 1Z0ZA 2YS7A 3BB1A 4LJ5A 5A2QA 4E4RA 1XE3A 5K7SA 5B30A 1G5PA 4BMZA 3DG9A 4CLXA 1BU8A 2CD9A 3ZXSA 5CVCA 1MD9A 4MV8A 4XEHA 1UF9A 2YVAA 3JQ6A 3A4VA 1EKXA 3HCBA 4IAOA 4U2KA 1BROA 2H51A 3F47A 1NXVA 2WIDA 4IOKA 3D59A 4TMKA 1H1DA 3ZGNA 1A5SB 3CPHA 1L5LA 4DA8A 1P4AA 2CXRA 5CRIA 5IJ9B 3HTXA 2V8OA 3Q72A 1AJEA 2F4VB 3H3XA 2NM0A 4LYYA 5ESXA 4HXYA 1C7FA 4OB6A 2Q7DA 1Z74A 4D9CA 2DTXA 4TUYF 5CITA 1XN4A 4FMCF 1OTXA 1SKYB 1QF6A 3DB2A 2HRZA 3KXIA 1UBLS 4G23A 4DJDC 2JPDA 5LVAA 2X8BA 5ETJA 3JD1A 2QMHA 3DZFA 4JQOA 2X7HA 2PMWB 1XZQA 3S81A 5JRZA 3CRW1 4XJXA 4KR9A 3MWFA 1JJAA 3AM3A 3C3XA 1BWSA 3TLBA 1E0KA 3ABQB 3AU9A 3HFSA 4NNPA 3U7EB 5LJLA 4L22A 2A5GA 4MYSA 5IH7A 1HYEA 3E05A 4WK2B 5JISA 1PV4A 3I04M 3KB6A 4BO7A 3QHQA 4HUQB 5KQRA 2J85A 1WRBA 2HK6A 4GGMX 4KWIA 3D0QA 3N0VA 2VCHA 3K4HA 4ZWNA 3ZIDA 3H8SA 5CT6A 5FH9A 3D2CA 3FNHA 3KKZA 3SC2B 3OZ7A 1HYBA 4ZYTA 3Q5GA 2LZ0A 2LR0A 2PRKA 3IE2A 4IDBA 3UKOA 3P4XA 3VHLB 2JCGA 1P17A 1QOQB 4JH0A 2HX1A 2FXVA 1AKYA 3DYIA 1DX6A 4PQEA 1KI6B 1EIZA 2JFHA 3M6AA 2WG2A 4L0MA 4RY8A 4OOFA 2H1LA 2V4MA 1YDWA 2XA2A 1U0EA 3IA2A 4LK3A 3U44B 1YI8A 4HDOB 1NW7A 4BRUA 2A3NA 3JQAA 3OJXA 2ZQYA 4UHJA 4WY5A 4Q3BA 4B9AA 2G5CA 1XFDA 3IE0A 3NVMB 4OF4A 1W4AA 1TEXA 3BMNA 5E4FA 3V8MA 3O4JA 3WWDA 4A91A 4ABYA 3IQZA 4ASUD 4CM3A 3KC2A 4TVKA 1V3TA 2H1IA 5M5BA 1M3SA 1AMNA 4O33A 1C1DB 4XIIA 3ZGZA 4H16A 4BV9A 3ADKA 2VN8A 1DUSA 3WNZA 1K0FA 3AR2A 1IBLB 3F6YA 3UH0A 2VDNB 4Z0N