2ANYA

Expression, crystallization and the three-dimensional structure of the catalytic domain of human plasma kallikrein: implications for structure-based design of protease inhibitors
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
238
structure length
238
Chain Sequence
IVGGTESSWGEWPWQVSLQVKLTAQRHLCGGSLIGHQWVLTAAHCFDGLPLQDVWRIYSGILELSDITKDTPFSQIKEIIIHQNYKVSEGNHDIALIKLQAPLEYTEFQKPISLPSKGDTSTIYTNCWVTGWGFSKEKGEIQNILQKVNIPLVTNEECQKRYQDYKITQRMVCAGYKEGGKDACKGDSGGPLVCKHNGMWRLVGITSWGEGCARREQPGVYTKVAEYMDWILEKTQSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Expression, crystallization, and three-dimensional structure of the catalytic domain of human plasma kallikrein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Blood clotting, hydrolase
molecule keywords plasma kallikrein, light chain
total genus 46
structure length 238
sequence length 238
ec nomenclature ec 3.4.21.34: Plasma kallikrein.
pdb deposition date 2005-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2anyA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2anyA01
5FPSA 3TVJB 2GGVB 3SUDA 3UOUA 3FZZA 1A3EH 4I8GA 1DLKB 5SGAE 2OXSA 3VPKA 1NRRH 3P95A 3MO9A 3TJVA 2VU8E 3F9HA 3K9XB 4I32A 4U30A 3PLBA 2SGPE 2ZPRA 2A4OA 5A8ZA 1UHBA 2EEKA 3VGCC 1UVUH 2EI8A 2G00A 4NWKA 5C3NA 1ZPBA 1SGEE 3RXRA 2ALPA 3PWCA 2CMYA 4Y0ZE 3UNRA 1INCA 1TRNA 3LT3A 2QAAA 4A1TA 5K7RA 4JMYA 1LHEH 1SVPA 2ZWLH 3JZ1B 3NZIA 1HGTH 5GWZA 1GI4A 2P94A 4FU8A 4XBBA 1GHZA 2C93B 1TFXA 5DGJA 4GHQA 1NROH 3A7VA 3MHWU 4GUXA 2XC5A 2BXUH 3O8DA 2FO9A 1OKXA 4YOGA 2GD4B 3EYDA 3VFEA 2ZU5A 3LGUA 1JOUB 2Y7ZA 1G3EA 2O8MA 3SU3A 1UCYH 1O3OA 2ZI2H 2HNTF 2EI7A 1AVWA 1W7GH 4CBOA 3FP8E 3FVFB 2OBQA 2ODPA 2Z3DA 1OYQA 2ZGCA 1O2LA 1SHYA 2XTTB 4FVDA 3B9FH 2ZQ2A 1BTXA 1PYTC 1FV9A 3IWMA 1HAOH 2TRMA 2I6SA 2AMPA 3M7QA 1YPHE 3PV4A 5EXLA 1GI2A 1C5RA 4LZ1H 2Y5FA 2JETB 1UTPA 1BHXF 1ZJDA 3SW2B 2XBXA 2BOHB 8LPRA 4ABHA 2J2UA 4BXWA 1EPTA 1XUJA 3PMAB 4BAOB 4NFEA 2FXRA 1BJVA 4X1SU 2O9QA 1IQNA 1C4Y2 4MNXA 4BTIB 4ZHLU 4Z6AH 2CF8H 1CHGA 2BLOA 1OWHA 1TOCB 4MDSA 4D8NA 1SSXA 5EW2H 1DLEA 1SR5C 1D9IA 1O2UA 3SGQE 4FU9A 4O9VA 5TJXA 1FPCH 1HAYB 2P8OC 3D23A 3PO1C 1K28D 2W3IA 1GHXH 4F49A 4D7GA 5EXNA 1Z7KA 1C5XB 2F9BH 2HALA 1EB1H 3A80A 1O5GH 4TPYA 2VIVA 2Z7FE 2VVVA 5FCRA 1CSOE 1YP9A 3UTUH 5C5OA 1LPKB 3CENA 3GDVA 3GY3A 1SLUB 4GCHG 2JH5D 1MTVA 3P92A 2TGPZ 1SOZA 4NSVA 1CBWB 3TGIE 1O38A 4ZKRU 4OGXA 4JK5A 4AG2A 1BZXE 2P95A 1FN8A 1HAIH 3ODDA 4E7RG 4GAWA 2ZU1A 4E06H 2A31A 1W0ZU 2SNWA 1MBQA 2KAIA 2NWNA 1P06A 1BRCE 3F6UH 3KQBA 4AFZA 5HGGA 3MYWA 1P02A 5DP6A 2Z9KA 1NZQH 1EZQA 3NXPA 1O5AB 4MPXA 5CHAC 1ZRBA 3ITIA 3Q3YA 1O33A 5EPNA 1LTOA 3CP7A 2PTCE 1FMGA 1O3KA 1SLVB 5J4QA 2ZGXH 1TIOA 5AFZH 1EPTB 5GXPA 1BBRE 1O2MA 4WMEA 1O37A 1W8BH 1VR1H 1DX5M 3LGIA 3SOSA 3MU8A 2BVXH 3V12A 3BTME 1BBRK 1P3CA 2BOKA 1ZPCA 1GDQA 1BUIA 1JRTA 1PPCE 1OYTH 4D7FA 3A8DA 5FAHA 2WV4A 2QCYA 2Y5GA 1ESTA 1QRXA 1MTNC 2PGQB 2H9TH 1D3DB 4BANB 1MCVA 1VCQA 1RIWB 3M3TA 3EDXB 2XWBI 3Q76A 1MD8A 2ASUB 1J17T 1MTUA 1HJAB 1IQHA 1IQLA 1AB9C 3U98H 2AERH 1CA8B 1D6WA 1PQ5A 3A7TA 1UTNA 4Y8ZA 3QZQA 1EKBB 4K1TA 2BLWA 2Q6DA 7ESTE 3SZNA 1AD8H 1LPGB 2ZU3A 4WY3A 3BIVH 1AVXA 1Q3XA 4YLQH 2BYAX 3GY6A 2K1QA 3K6ZA 2FODA 1WBGB 1FIWA 1QB1A 2PW8H 1H9IE 3P8FA 1GHWH 1SGNE 2F3CE 1E36B 2BD9A 2PKAB 1VZQH 2GV7A 1AZ8A 3M7UA 1IAUA 4CR9A 3ZYEA 1A7SA 2TPIZ 3Q3XA 5K0HA 1TQ0B 4JYVH 2FYQA 1D3PB 1Y59T 1Z6EA 1QA7A 1ZSKA 1DWDH 1KDQA 1YCPK 1GDNA 1P2OA 1SGCA 1MKWH 4Y76A 1QCPA 1K1MA 3MNXA 2FTLE 4NA9H 3ZYDA 4FVBA 2QYIA 2HLCA 4INKA 1S83A 3P8GA 7LPRA 1G2MA 2GCHF 1FY1A 4FU7A 1THSH 2ZDKA 4X8SH 3SJKA 1GL1A 3SN8A 2LNCA 4ABAA 1J14A 1E38B 3URDA 3T27A 2FI5E 1ELVA 1GCTC 1H4WA 1QNJA 2Z3EA 1GHYH 1UTQA 3F9FA 1WTGH 3UNQA 2ALVA 1FAXA 1SPJA 1SBWA 4XBDA 5CMXH 4CRBA 4FUEA 1KSNA 3BTHE 3STJA 1MQ6A 1NRSH 1YPJH 5A8YA 3LJJA 3VXEH 4LZ4B 2TGAA 1YPGH 4OS4A 4NG9H 3DD2H 1LQDB 2OTVA 4UONA 4K60A 3LIWA 5DP5A 3ZZ8A 3M61U 2OLGA 3MNCA 4UDWH 5FXLA 5EQQA 2JH6D 2SGDE 3TPIZ 1DITH 1SGPE 3G01A 4H4FA 1QJ1B 1C5OH 2BMGB 4NIXA 1YKTA 1BTYA 3FAOA 1DICA 2GX4A 1O2JA 3PROA 1M9UA 1LPZB 2QXGA 1HAZB 1SOTA 1GBEA 1VGCB 2V3OH 3RC6A 1TX7A 3RP2A 1AWFH 1K1IA 3MTYA 1FY3A 3QGNB 5TCAA 3PO1B 3ZVAA 3RC4A 1O3BA 1J15A 3MO6A 1C1TA 2ZDAH 2ZDNA 1ETTH 2R3UA 3LGTA 1BIOA 2B0FA 1PPEE 1RTFB 2G81E 2SGQE 5EXMA 1KLJH 3SHCH 1DDJA 1O5BB 1RIWC 2RA0A 3OTJE 2WPJS 3NUMA 1UMAH 1HAGE 3T2NA 3AAVA 1ELBA 3CS7A 3EE0B 3Q3KA 3SGAE 3UR6A 1BHXB 2PKSC 3S7HB 1O2YA 2PSYA 3RXEA 1O30A 4CHAB 1D4PB 1RGQA 1Y8TA 3GCOA 1B7XB 5FPYA 3L3TA 1GBLA 1GI8B 1S82A 1UK4A 5GCHG 1TX8A 3KQDA 4X2VA 1C1RA 3A85A 4DG4A 3T62A 1GJ9B 1OWEA 1EZSC 1ZTJA 5G4BA 4AGJA 1B0EA 1ELAA 1KXCA 5F8ZA 4B73A 5F8TA 1XUFA 3DT0H 5EW1H 1K1NA 2UUFB 1GBDA 2YOLA 4ZXXH 4B74A 2SGAA 5JBAS 1FUJA 1GI1A 3RMNH 1O34A 3ZZ5A 2GKVE 3TK6A 1C1VH 1EPTC 1NFYA 1CGHA 3ATWA 3RXHA 3M7TA 2VIQA 5ESBA 1V2TT 4CRDA 1DSTA 2STBE 3KHVA 1LHDH 1AQ7A 1UVSH 3QLPH 2ZCLP 3S9AA 1E34B 3GISB 4BTUB 3Q00A 1WYKA 3ZZ3A 4XSKU 2VJ1A 3SJ9A 3T28A 1F0TA 1XKBC 2A4QA 2RG3A 3V13A 4BTTB 3VEQB 1XKAC 2CHAB 3BEIB 3RXMA 2VH6A 2FYRA 3I78A 2F9PA 1WUNH 1UVTH 4LXBH 1CQQA 5AHGH 4ZHMU 1ETSH 3B8JA 3RXIA 4OS1A 3KQCA 3TU7H 2VVCA 2G5NA 1EAIA 1GBKA 4AFSA 1XMNB 1P9SA 5GPIB 4AN7A 4D9QA 1BTUA 1CT4E 1L0ZA 1V2KT 3E8LA 4MLFB 3SUEA 1E0FD 1EOJA 1UCYK 5EGMA 2VH0A 2ODYB 2J34A 2BD3A 4FUIA 1QHRB 4JK6A 2Z94A 1GBAA 4CHAC 1XVOA 3TIUA 4F4OC 2BZ6H 2ZEBA 4ABDA 1ZMNA 2Y7XA 2BY7X 1L2EA 1LVMA 1K2I1 4WWYA 2PSXA 4X2YA 2ZNKH 2NU3E 5A8XA 1V2ST 3GY5A 4DURA 1QQUA 1A1RA 5BPEA 4KGAA 4X2XA 3BTTE 4Y10E 2AIQA 5TCCA 3WY8A 1DS2E 4IC6A 1TYNA 1MH0A 1UTKA 3S0NA 2AIPA 4NIYA 2FEQH 2QY0B 1AUTC 1TQ7B 1ESAA 2H6MA 3LDXH 5JYIA 1C5WB 1SB1H 1XUIA 3A83A 5FPTA 5GJ4B 1FZZA 4A1VA 5E2PA 1G3DA 1HAXB 2ZG0H 2P3UB 1MU8B 2PR3A 1BRAA 4K1SA 1QRWA 4FUFA 2FI4E 1TNIA 5T3HA 2ZPSA 2GCTC 2PLXA 1Y3WA 3MH7A 4X8TH 3PMBB 2G51A 2ZFFH 2Y81A 3SJOA 2GZ7A 2W26A 4AORA 2F83A 2JETC 1ARCA 2M5TA 4X6MA 1C5QA 8KME2 5AVDA 5A0BA 1IQGA 1S0RA 1AY6H 1J8AA 1OOKB 1EASA 4ABJA 1O2ZA 3DFLA 4ZH8A 4NGAH 1SG8B 1Y5AT 1EAXA 3SNAA 3PB1E 1O3JA 1V2RT 1EXFA 3M5MA 2C8YB 2BX3A 3SI3H 2FS8A 5FBEA 2PUQH 2Y5HA 3OY6U 1UVPA 5GIBA 3MNSA 5I25A 5J4SA 3UY9A 3TH2H 3VB7A 2WINI 3TGKE 3SV9A 4YM9A 1BTZA 1LVBA 1MU6B 1SQOA 3NWUA 3V3MA 1CHOG 2P3TB 2GMTB 3GYLB 3EA7A 4ZMAH 2VGCB 5F03A 3UREA 3RXPA 1IOEA 2O8WA 3RXTA 4K69A 3NCLA 1THPB 4UEHH 1C4U2 3UQVA 1GL0E 3I29A 3S69A 4O03A 2GP9B 5ABWA 2ZFSA 3A8CA 2OBOA 4KTSA 2XYAA 1QFKH 1MKWK 4NCYA 8GCHG 2GZ9A 1K21H 1AWHB 3ZZ7A 3LGWA 1P9UA 3PLKA 4O3TA 2H9EH 4GLYA 5GDSH 4AYVB 3FZDA 1DY9A 1O0DH 2XW9A 5FHTA 2QXIA 1ARBA 2J94A 4NIVA 1AKSB 1BRBE 3UQOA 5LGOA 3TJOA 1O3IA 1W7XH 2AH4X 2D2DA 4YT6H 1TMBH 1GG6B 4OGYA 1H9HE 2A5KA 1HAVB 2ZA5A 1QIXB 4FXGH 5LPRA 3HATH 1TNKA 2G52A 1AVGH 1UTJA 1CE5A 1ABJH 2XCFA 1NU9A 1MMJN 2ZF0H 5EOKA 1O2OA 4YZUA 4SGBE 3T29A 2H1UA 4A92A 1AFQB 2HVXA 5IYTA 1EAUA 3FP7E 2ESTE 3UPEA 2BVRH 4JCNA 2B8OH 4PROA 1TNJA 1K22H 4WMFA 4NWLA 1G2LA 1EJNA 1GBMA 2ANYA 4A1XA 1V2UT 1O3LA 2BVSH 2WPMS 1C1NA 1OX1A 3ZVBA 1QBVH 4WVPE 3BEUA 1LKBA 5DP3A 2A5IA 1WV7H 4UE7H 1WU1A 4LK4A 2P8OB 5F6MA 4WH8A 1GI5A 3RU4E 9ESTA 3U8TH 1OXGA 5H4IB 4DIIH 3ZZBA 2UWPA 2VGCC 3LKWA 1C2MA 3RU4D 3SQEE 1TPOA 3GDSA 1P04A 1XUGA 3UOPA 1MUEB 1SFIA 1AIXH 1T8LA 4GSOA 2HOBA 5DP8A 5FCKA 1J16A 1L1NA 1BJUA 1XUHA 2UWOA 1ACBE 4AZ2B 1C9TA 1IQFA 1MZDA 5E0HA 1WCZA 5JDUB 1DPOA 3SNCA 1NO9H 1RFNA 2B7DH 1ZSJA 3DA9B 4ISOA 1XUKA 2D1JA 5LPFA 2BXTH 5I46H 4FUGA 3KEEA 4IC5A 4ABFA 1DY8A 1QJ6B 3A89A 3R0FA 4JZFH 1GGDC 4K5ZA 1O2PA 1ABIH 4TY7A 3ZV9A 2FS9A 1F92A 2GT8A 2ZFRH 1L1GA 1P01A 1LO6A 1BCUH 1LDTT 2VIPA 1O5FH 1SGYE 1HYLA 2CHAC 1D6RA 1FNIA 1YCPH 2Y6TA 3A7WA 3UUZA 3RMLH 2DE9A 4OS6A 5JB8S 1TGSZ 2QV1A 2FPZA 3BTQE 2FESH 5JBBS 1EX3A 2AS9A 1C5SA 4WH6A 1P2IA 1VJAU 2Q6FA 3EA9A 3QZRA 1O2RA 5DPAA 1EB2A 1A4WH 2Z9GA 2J4IA 1IQKA 2GTBA 4CRCA 1W10U 3BTEE 1P12E 4X0WU 1NS3A 2BDYA 2XBVA 2FWWA 2HPPH 2ZZUH 1UCYE 1G9IE 4CR5A 4JYUH 4RKOB 4BAMB 3S9BA 1GJBB 1MQ5A 2ZECA 3QWCH 1UTOA 2B9LA 3GCNA 1BDAA 2GT7A 3CS0A 1C2IA 1SLWB 2BD4A 1YPMH 5EU8A 3FFGA 1UVOA 3ZVFA 2ZFQH 2ODQA 4A7IB 1RRKA 3IITA 1DUEA 1C2LA 1YLDA 2FLBH 1C5NH 1GCTB 4INHA 4DIHH 2WYJA 3SV6A 2PKAA 4Y6DA 4IGDA 1MAXA 5FX5A 2OINA 3MNBA 5BRRE 3U69H 3P6ZB 2G55A 2W5EA 1C5PA 1PPFE 1QB6A 1YM0A 3UWIA 2BZAA 2Z6BD 5B6OA 3A87A 1ZPZA 3MOCA 1ELTA 1C2FA 1MZAA 4CBNA 3A7XA 2WPLS 1RTKA 2AMQA 1FY8E 2VWLA 1LCYA 1ZYOA 2R2WU 3MH5A 3BSQA 1YC0A 3VB3A 2Y82A 1O3FA 2BLVA 4X8VH 2XBYA 3GCHC 2THFB 4UFFH 1F0RA 3R3GB 3OYPA 1OP2A 1O2TA 1O2NA 1GHAF 1TPPA 3U8RH 2H9HA 3UFAA 2FOCA 2V0BA 3SNBA 4IBLH 1RJXB 1KXBA 1V6DA 1V2LT 2R9PA 2HNTC 4R0IA 5C1YA 3A81A 2HGTH 1C1MA 3P70B 3ATIA 1O5DH 1JMOH 3M3SA 1O2IA 3LC3A 1CO7E 1ANBA 1N8OC 5JPMH 2VIOA 2ZFTA 5L2YH 3W95A 2P93A 4AB8A 2FLRH 4H6TA 4MVNA 4KTCA 2DUCA 2C90B 3T26A 1P05A 1BMAA 1TA2A 4K3JA 1FY4A 4YT7H 1B5GH 3SNEA 1O3NA 1NRNH 4RN6A 1JBUH 1C1UH 2BDGA 4IMZA 3SU1A 1S0QA 4AYYB 4AFQA 2ZPQA 3QGJA 3SUFA 2ZC9H 1WSSH 2J38A 1GI3A 4ISHH 5C1UA 1KLIH 2OQUA 1GMDF 1TNGA 4U32A 5A0CA 8GCHF 2H2ZA 5EG4A 4NSYA 3L33A 1DT2A 1KXFA 2F9NA 1C5ZB 1KTSB 1KDQB 1A5HA 3SU2A 2BDAA 3QTOH 1A5GH 3E0NB 3C1KA 4ABBA 1BMMH 1O32A 2ZDLA 3O8BA 1FLEE 2VB0A 3A8BA 1LVYA 2A1DB 2BQ7B 1SGFG 1XXDA 1O3MA 1Y5BT 5T6GA 3VB6A 3VB4A 4KKDA 1ELEE 1P09A 2O8TA 4MNYA 2NU0E 3QDZB 3ZZDA 4WF8A 1QR3E 2CXVA 4ZHAA 1YPKH 3VGCB 1CA0C 5JBCS 3PMHB 1TRMA 4RKJB 3D62A 3AVZA 1GJ7B 1NTPA 1K1PA 1TMUH 1GMHF 3RU4T 2WYGA 1BMNH 2ZU4A 1TMTH 2XC0A 1UJ1A 4Y7BA 2SNVA 1SGFA 4ZROA 2FX6A 1TGNA 1C5TA 1HCGA 1MAYA 1NC6A 1YPEH 2AEIH 2TIOA 3P8OA 3BG8A 4CH8B 2FOBA 1O35A 2GV6A 4AFUA 4DVAU 4B76A 1CT2E 1C5MD 1DVAH 3HK3B 3F9EA 3B23B 5E0GA 1KXEA 4YOIA 4B75A 2VNTA 3JZ2B 3NK8A 2FM2A 1UO6A 5HM2A 1ID5H 2FTMA 3KIDU 2GVFA 1H9LB 5JBTA 1PPGE 1HJAC 3QX5H 1QA0A 1THRH 1NFUA 1TNLA 1O5CB 4Q2KA 2BHGA 3LU9B 1C5VA 1Z71A 3LONA 1YPHC 3M3VA 3M37A 1F5RA 1K9OE 1T8OA 1ORFA 3ZZ6A 3GICB 1NM6A 1A61H 1NN6A 4U2WA 2ILNA 2QXHA 2OC0A 1RTLA 1RXPA 4X1NU 2GDEH 4GPGA 4CRAA 4I8JA 4AG1A 4X1QU 1O3PB 2BD8A 1YLCA 3GY2A 1GI7B 3NKKA 2PFEA 1Q31A 3RXUA 3PM3A 1MBMA 2C3SA 3I77A 2PV9B 1P2QA 2ZDMA 4XBCA 1SGDE 2ZTXA 5A2MH 1P11E 1AI8H 3MFJA 2QC2A 1ZMLA 2FOEA 3DFJA 4YESB 1JIMA 3UIRA 1EOLA 3BG4B 4B2BA 1PJPA 3U1JB 3O8RA 2AFQB 3LGVA 1UTLM 1MKXH 1E37B 3RXKA 2BTCE 2BD2A 1ZTLA 2BY6X 4X8UH 3TLOA 1UHBB 2GZ8A 1IQJA 1S84A 2OC8A 2QIQA 1NPMA 2A2QH 3MH4A 2EC9H 2AGGX 1W3CA 3E6PH 3L6PA 4HI3A 4ZKSU 4DGJA 2BDCA 1ESBA 1PFXC 4E7NA 5HXFA 3A82A 1AFEH 1F5KU 3K6YA 2IN2A 2A7CA 3EAJA 3RM0H 4Y7AA 5DP9A 1SGTA 2BDBA 3S7KB 1BTWA 1PQAA 1P2JA 3BTKE 1O36A 1L1JA 1YPLH 3GY8A 1VITG 4X1RU 1C1SA 4JYTA 4ABEA 1V2VT 1FPHH 3LJOA 4JZIA 2LPRA 4ASHA 2ZKSA 4NA7A 2WPIS 2OUAA 3VXFH 2W7UA 2BLQA 3LH3A 3F9GA 3MH6A 3F68H 3ESTA 2FDAA 1SC8U 1QQ4A 3GCTF 1GCDA 1ETRH 1S85A 3A7YA 2BX4A 4XDEA 4D76A 1Q2WA 1GBFA 3KN2A 2VIWA 1Y3VA 3QTVH 4I7YH 2FX4A 2ZHFH 1Z1IA 3RLWH 1S6FA 1PPHE 2Z3CA 1SLXB 1A3BH 3PWBA 1VGCC 3SHAH 3OSYA 3BG4C 5ESTE 4Q7ZA 2OQ5A 2UUJB 1WAYB 1C4V2 1VITH 1CT0E 2FP7B 2XRCA 3RXQA 1DANH 4ZAEA 2I6QA 1DE7H 3FANA 1OWIA 3TJNA 1YYY1 1BQYA 1NT1A 4CRGA 6GCHG 2F9VA 3IG6B 2JH0D 1DWBH 5L6NH 1C1WH 2XWAA 3U8OH 4BAQB 1W12U 3RXDA 3MMGA 1GBBA 2BD5A 1AB9B 3OY5U 3PTNA 6CHAB 5GCHF 5HM9A 2XNIA 1TLDA 1GWAA 1ZMJA 2ZDVH 1WOFA 3RXBA 1GBTA 1V2QT 1ANDA 1K1LA 1BMLA 4BXSA 4I31A 4Q7YA 4R8TB 4FUDA 2TBSA 1A46H 2GMTC 2BB4A 7KMEH 1W0YH 1GG6C 2G5VA 1LMWB 4UD9H 2WUCA 1TGCA 4H42U 3GOVB 3TH4H 1UK2A 2XXLA 1A0HB 2WV5A 3AW0A 3ELAH 1V2NT 4BNRA 3AAUA 2FOFA 3HPTB 1HFDA 1OS8A 4MNWA 1SQTA 2HWLB 1K1OA 1QBNA 1Z8GA 2C4FH 4Y0YE 4IMQA 1SGIB 3SUGA 1NRPH 1QL8A 2BDIA 1LHCH 1GI9B 1T8MA 1VITF 3SORA 3RXGA 1DXPA 4ABGA 4DOQA 1GHBG 4UFDH 1ZTKA 3U1IB 1P0SH 4NZLA 4ZUHA 1KIGH 4OS5A 1NESE 4U01A 4A5TS 1N6XA 4XE4A 4K8YA 3MU0A 1BBRH 2YNAA 4DW2U 3H5CB 4WXVA 2FOGA 2QF0A 2VINA 1GJ6A 2SGEE 2NU1E 2VWMA 1MKXK 4TPIZ 1MTNB 2IOTA 3SO3A 1AO5A 1V2WT 1HLTH 3HK6B 2A7HA 1G30B 1W14U 4TY6A 4MPVA 2V6NA 3ENSB 5LH8A 4QT8C 1EP5A 4WXIA 1DXWA 3MO3A 1FN6A 2KAIB 5C67A 3QO6A 3D49H 1PYTD 3KCGH 2A0QB 1PQ7A 3RDZA 2ZCKP 3M35A 2OCVB 1MTWA 4GCHF 6CHAC 1GMCF 2WPHS 1KY9A 2RCEA 2PKSB 2UUKB 1D3QB 4TWYA 3KF2A 3T25A 4Y8XA 2ZQ1A 1WTHD 4XOJA 3URCA 1DUAA 1CHOF 1C5UA 1QGFA 1FI8A 3RM2H 4ABIA 2ZU2A 2P16A 3O8CA 1YCPM 3QN7A 5DP7A 2A32A 2CGAA 4NFFA 5E8EH 2AYWA 2ZTZA 3K2UA 4Y11E 2XCNA 1HAHH 1B0FA 1DFPA 4INLA 7GCHF 3AW1A 1S5SA 1GHVH 2FOMB 4Z0KA 4YLUA 5DP4A 4OS7A 3PMJA 1HJ9A 1OWKA 1MTSA 4LOYH 4KTUA 1BTHH 4NA8A 1ZHMA 3GCTG 4NZQA 1GBHA 1VCWA 2CV3A 1L4ZA 4BAKB 2ZHQH 3ZVDA 2PTNA 2C8WB 1KXAA 2Z9JA 3BTFE 3MI4A 1GVLA 2A5AA 1P3EA 2R2MB 1C2DA 1TGTA 1OWDA 3A88A 4X6PA 1G36A 2WPKS 2B5TB 5C2ZA 1RS0A 2ULLA 3STIA 1FONA 1AKSA 4Y8YA 4DY7B 1DM4B 1Z6JH 1MCTA 2PGBB 2YNBA 4NIWA 4Y79A 1AHTH 1C2EA 2W3KA 3GCHB 6LPRA 1GHBF 2PHBA 1RD3B 2G8TA 2BY5X 1H8IH 2W7SA 4O3UA 4ZXYH 3A7ZA 3BIUH 1EJAA 4KELA 4K1EA 3E16B 1VCPA 3H7OA 1GJAB 3RLYH 1GJ4H 4Q7XA 2TGTA 1UK3A 3V7TA 1VJ9U 2QN5T 3EGKH 1GMHG 2QXJA 1IQEA 2GCHG 1W2KH 4I8HA 3ZVCA 1O5EH 1Z1JA 4O97A 5CE1A 4FUHA 2OC7A 1A0JA 1O2VA 3S9CA 1D3TB 2O8UA 1ELFA 1PPBH 2F9UA 1G37A 3BTGE 2HPQH 1IQMA 2ZFPH 1AMHA 1U6QA 3BN9A 5JB9S 1TOMH 1Y3XA 4MPUA 4MTBA 3HKJB 1HNEE 3E91A 1ZOMA 3M36A 4K8BA 3RXJA 1HPGA 1GJ8B 1HV7A 1TPSA 1GJCB 1QRZA 1FDPA 3M5LA 1KXDA 2RA3A 5F8XA 3ZVGA 1Z8IB 3P8NA 1QURH 1BOQA 1O3HA 2AMDA 4Q80A 5T6FA 1SL3A 1EZUC 3SNDA 3UNSA 1E35B 2ZGHA 1C2JA 3HGPA 2G4UA 4FUBA 3TNSA 1DWEH 2STAE 2ZP0H 1EATA 3C27B 1FXYA 2V35A 1T4VH 1SI5H 1XX9A 1Y3YA 1DSUA 5CHAB 1OWJA 3QUMP 1T32A 1HB0B 1AE8H 2BM2A 2UWLA 4AOQA 1HBTH 4AB9A 2Q1JA 1H1BA 3ATMA 3LGYA 1T7CA 5E0JA 1F7ZA 1TPAE 4YOJA 4J1YA 1JWTA 1S81A 3OU0A 5EQSA 1Z8RA 4IS5A 3RC5A 3RXSA 3V0XA 1P8VC 5C1XA 8ESTE 2C8XB 1CVWH 1GJ5H 1N6YA 1QBOA 2H5DA 3MU4A 2DE8A 4RSPA 3K65B 3E1XB 3LPRA 3TH3H 5DKMA 1GBCA 1CBWC 1UTMA 1BT7A 2XC4A 1C2HA 1FIZA 3D65E 1O2GH 1NU7B 4ZKNU 1GHAG 3MU5A 2HNTE 1YBWA 3SU4A 5IDKA 1P57B 2PUXB 3SV8A 3P17H 1EP6A 6ESTA 1C9PA 4D9RA 2VWOA 5E2OA 3TNTA 2R0KA 3RMMH 3H7TA 1AUJA 1FJSA 2AGIX 1XXFA 4VGCB 1K1JA 4IN1A 2VWNA 1P2KA 4UFGH 3PTBA 4WJG2 1CU1A 1JRSA 1O2HA 1P03A 4TYDA 1NY22 3DUXH 1O3GA 1ELDE 4TWWA 4JZ1A 1TBZH 2ZGBH 1V2JT 1TGBA 1AGJA 1PQ8A 1FY5A 1A2CH 1F0SA 1WQVH 3KNXA 2G4TA 3E0PB 3M5OA 3FP6E 4X6OA 4JZDH 1TX6A 3GDUA 1V2PT 1HXFH 1TABE 1TA6A 1GGDB 2AGEX 4JZEH 2J9NA 1HIAB 1ELGA 2TGDA 1BB0B 4HFPB 4X2WA 4GHTA 4A6LA 4B2AA 3TGJE 1IHSH 1GI6A 4B1TA 2GDDA 1C2GA 2OD3B 1SMFE 1GI0A 4UFEH 3RXOA 3SBKA 1O2QA 1TWXB 1A0LA 2BQWB 1GVZA 4FUCA 4HGCA 3OX7U 1NRQH 1ZSLA 2A45B 1NFWA 2BQ6B 2FOHA 1TAWA 1YGCH 2VIDA 5DJ7A 2ZCHP 3SJIA 3SGBE 1EZXC 1IHTH 4ISIH 1T8NA 4M7GA 1W11U 1NFXA 2Q6GA 2SGFE 3ATLA 4IW4E 2FOAA 4OS2A 1N1LA 1T4UH 1L4DA 2R0LA 1AN1E 2P3FH 2NU4E 3E90B 1O3CA 3GYMA 6GCHF 2R3YA 5HYOA 1F2SE 5C20A 1BA8B 1HAVA 3GY4A 1G32B 4MG3A 1F5LA 2EA3A 2ZIQH 3RXVA 4BAHB 1EUFA 5L30H 1ZGVA 3GY7A 3BEFB 3EA8A 1C2KA 1AE5A 1SGQE 5A0AE 1C5LH 2QGRA 3M5NA 1ZLRA 1EQ9A 3MU1A 1QL9A 2UUYA 2XBWA 1O3AA 1J9CH 2WUBA 3KQEA 3MWIU 1KYNA 4DJZB 1F0UA 1A5IA 1HDTH 4CRFA 1ZHRA 3T5FH 3RXCA 4ISLA 4MNVA 1HJ8A 2BY9X 2D8WA 2ZTYA 3LH1A 4CREA 3SU0A 1BTPA 2V3HH 1GBJA 3F1SB 1O31A 2F91A 1HAPH 1BRUP 2D26C 1JIRA 1T31A 4I33A 4YTAA 4AGKA 1O3EA 3ODFA 3RUOA 2QA9E 1W13U 5FX6A 1C1PA 1SGRE 1MD7A 4MQAA 1ZRKA 2J92A 5AF9H 2F9OA 1AU8A 1DOJA 2EI6A 5C5NA 1O2XA 2CF9H 2CJIA 1BITA 3ATKA 1LVOA 4AX9H 1Y5UT 5AFYH 7GCHG 3BF6H 1ZHPA 2BDHA 2O8LA 1X7AC 1GVKB 3PYHA 2ANKH 3BTWE 3SJ8A 3A8AA 4X6NA 1GDUA 4HZHA 1QJ7B 1C1QA 2C8ZB 1ELCA 4HTCH 9LPRA 3AASA 3HKIB 2NU2E 3RXLA 1KLTA 4Y71A 3HGNA 3LC5A 4DCDA 1G3BA 3A86A 1P2MA 1TE0A 3TITA 2OP9A 1LHGH 1HXEH 1DWCH 3UWJH 4VGCC 4K2YA 2RDLA 1GBIA 2P59A 4WMDA 1O3DA 1TNHA 2ZHWH 1OPHB 4MPWA 1ZR0A 4THNH 5PTPA 2PWXA 1LQEA 2A4RA 2A7JA 5EODA 1CGJE 1LHFH 3RXAA 1TB6H 2A2XH 1ZGIA 1LKAA 2Y80A 2Z9IA 1QY6A 2FZZA 2CN0H 2BY8X 2HRVA 3ZV8A 2ZO3H 2VVUA 3ZZAA 1QTFA 3UR9A 3W94A 2OC1A 5ETXA 3Q77A 1TRYA 1AFQC 1EAWA 3E3TA 1XVMA 1GMCG 4IN2A 4ESTE 3PLPA 1V2OT 3BV9B 2QF3A 3SV2H 1ZZZA 2SFAA 3N7OA 3A84A 2ZGJA 2FI3E 2ZHEH 5T6DA 1H8DH 4I8KA 1FAKH 2ANMH 1ZJKA 3SQHE 1YF4A 3SU5A 1C5YB 4ISNA 1O39A 1HRTH 2FIRH 3ZZ9A 4CH2B 1IQIA 1CA0B 2BD7A 1GJDB 2IJOB 4I8LA 3RXFA 3ZZ4A 4SGAE 3LOXA 1FQ3A 2A4GA 3TK5A 1GMDG 1O2SA 2J95A 1OP0A 1CGIE 1OP8A 2ANWA 1QB9A 5DK1A 1AZZA 3KGPA 1N8OB 3NPSA 1Y3UA 3EQ0H 3VB5A 4KP0A 4GVUA 4B71A 2Z9LA 3DHKH 1OSSA 1TBQH 3RMOH 5A09A 1TONA 5L2ZH 3SV7A 4J2YB 3U9AH 3SU6A 1TBRH 1Z8JB 4H6SB 3KL6A 5LPEA 5EPYA 3SI4H 1P2NA 1G3CA 4XFQA 1GPZA 1SQAA 3TK9A 1TALA 4YO9A 3ZVEA 1O2WA 2IPHA 1PPZA 3TJUA 1ANCA 4DT7B 1SFQB 5FBIA 4B2CA 1XM1A 3QK1A 1V2MT 1ANEA 5DG6A 1HIAA 1WQSA 2JKHA 4X1PU 4ZKOU 1O2KA 2FMJA 2GCTB 5EQRA 3ZZCA 5DO4H 1HUTH 1SHHB 4BOHA 3BTDE 1S6HA 1EJMA 2H5CA 2ZHDA 1JXPA 4FUJA 4E05H 1QL7A 1KTTB 5HMAA 1P10A 1C1OA 1V3XA
chains in the Genus database with same CATH superfamily
5FPSA 3TVJB 2GGVB 3SUDA 3UOUA 3FZZA 1A3EH 4I8GA 1DLKB 5SGAE 2OXSA 3VPKA 1NRRH 3P95A 3MO9A 3TJVA 4F48B 2VU8E 3F9HA 3K9XB 4I32A 4U30A 3PLBA 2SGPE 2ZPRA 2A4OA 5A8ZA 1UHBA 2EEKA 3VGCC 1UVUH 2EI8A 2G00A 4NWKA 5C3NA 1ZPBA 1SGEE 3RXRA 3OAAD 2ALPA 3PWCA 3OTPA 2CMYA 4Y0ZE 3UNRA 1INCA 1TRNA 3LT3A 4B6FA 2QAAA 4A1TA 5K7RA 4JMYA 1LHEH 1SVPA 2ZWLH 3JZ1B 3NZIA 1HGTH 5GWZA 1GI4A 1SQRA 2P94A 4FU8A 4XBBA 1GHZA 2C93B 1TFXA 5DGJA 4GHQA 1NROH 3A7VA 3MHWU 4GUXA 2XC5A 2BXUH 3O8DA 2FO9A 1OKXA 4YOGA 1YY3A 2GD4B 3EYDA 3VFEA 2ZU5A 3LGUA 1JOUB 2Y7ZA 2O8MA 1G3EA 3SU3A 1UCYH 1O3OA 2ZI2H 2HNTF 2EI7A 1AVWA 1W7GH 4CBOA 1H8ED 3FP8E 3FVFB 2OBQA 2ODPA 2Z3DA 1OYQA 2ZGCA 1O2LA 1SHYA 2KFWA 2XTTB 4FVDA 3B9FH 2ZQ2A 1BTXA 1PYTC 4I86A 1FV9A 5HIZA 3IWMA 1HAOH 2TRMA 2I6SA 2AMPA 3M7QA 1YPHE 3PV4A 5EXLA 1GI2A 3N99A 1C5RA 4LZ1H 2Y5FA 2JETB 1UTPA 1BHXF 1ZJDA 3SW2B 1UW7A 2XBXA 2BOHB 8LPRA 4ABHA 2VBCA 2J2UA 4BXWA 1EPTA 1XUJA 3PMAB 4BAOB 4NFEA 2FXRA 1BJVA 4X1SU 2O9QA 2W6ID 1IQNA 1C4Y2 4MNXA 5EJLA 4BTIB 4Z6AH 4ZHLU 2CF8H 1CHGA 2BLOA 1OWHA 1TOCB 4MDSA 4D8NA 1SSXA 5EW2H 1DLEA 1SR5C 1D9IA 1O2UA 3SGQE 4FU9A 4O9VA 5KGOA 5TJXA 1FPCH 1HAYB 2P8OC 3D23A 3PO1C 1K28D 2W3IA 1GHXH 4F49A 3PRBA 4D7GA 5EXNA 1Z7KA 1C5XB 2F9BH 2HALA 1EB1H 3A80A 1O5GH 4TPYA 2VIVA 2Z7FE 2VVVA 5FCRA 1CSOE 1YP9A 3UTUH 5C5OA 1LPKB 3CENA 3GDVA 3GY3A 1SLUB 4GCHG 2JH5D 2J98A 1MTVA 3P92A 2TGPZ 1SOZA 4NSVA 1CBWB 3TGIE 1O38A 4ZKRU 4OGXA 4JK5A 4AG2A 1BZXE 2P95A 1FN8A 5T1VA 1HAIH 3ODDA 4E7RG 4GAWA 2ZU1A 4E06H 2A31A 1W0ZU 2SNWA 1MBQA 2KAIA 2NWNA 1P06A 1BRCE 3F6UH 3KQBA 4AFZA 5HGGA 3MYWA 1P02A 5DP6A 2Z9KA 1NZQH 1EZQA 3NXPA 1O5AB 4MPXA 5CHAC 3U28C 1ZRBA 3ITIA 1KMHB 3Q3YA 1O33A 5EPNA 1LTOA 3CP7A 2PTCE 1FMGA 1O3KA 1SLVB 5J4QA 3N7DA 1YWUA 2ZGXH 1TIOA 5AFZH 1EPTB 5GXPA 1BBRE 1O2MA 4WMEA 1O37A 1W8BH 1VR1H 1DX5M 3LGIA 3SOSA 3MU8A 2BVXH 3V12A 3BTME 1BBRK 1P3CA 2BOKA 1ZPCA 1GDQA 1BUIA 1JRTA 1PPCE 1OYTH 4D7FA 3A8DA 5FAHA 2WV4A 2QCYA 2Y5GA 1ESTA 1QRXA 1MTNC 2PGQB 2H9TH 2M2AA 1D3DB 4BANB 1MCVA 1VCQA 1RIWB 3M3TA 3EDXB 2XWBI 3Q76A 1MD8A 2ASUB 1J17T 1MTUA 1HJAB 1IQHA 3WWBA 1IQLA 1AB9C 5C17A 2WZQA 2AERH 3U98H 1CA8B 1D6WA 1PQ5A 3A7TA 1UTNA 4Y8ZA 3QZQA 1EKBB 4K1TA 2BLWA 2Q6DA 7ESTE 3SZNA 1AD8H 1LPGB 2ZU3A 4WY3A 3BIVH 1AVXA 1Q3XA 4YLQH 2BYAX 3GY6A 2K1QA 3K6ZA 2FODA 1WBGB 1FIWA 1QB1A 2PW8H 1H9IE 2K8IA 3P8FA 1GHWH 1SGNE 2F3CE 1E36B 2BD9A 2PKAB 1VZQH 2GV7A 1AZ8A 3M7UA 1IAUA 4CR9A 3ZYEA 1A7SA 2TPIZ 3Q3XA 5K0HA 1TQ0B 4JYVH 2FYQA 3WWFA 1D3PB 1Y59T 1Z6EA 1QA7A 1ZSKA 1DWDH 1KDQA 1YCPK 2F4LA 1GDNA 1P2OA 1SGCA 2QE7D 1MKWH 4Y76A 1QCPA 1K1MA 3MNXA 2FTLE 4NA9H 3ZYDA 4FVBA 2QYIA 2HLCA 4INKA 1S83A 3P8GA 7LPRA 1G2MA 2GCHF 1FY1A 4FU7A 1THSH 2ZDKA 4X8SH 3SJKA 1GL1A 3SN8A 2LNCA 4ABAA 1J14A 1E38B 3URDA 3T27A 2FI5E 1ELVA 1GCTC 1H4WA 1QNJA 2Z3EA 1GHYH 1UTQA 3F9FA 1WTGH 3UNQA 5EJ1A 2ALVA 1FAXA 1SPJA 1SBWA 4XBDA 5CMXH 4CRBA 4FUEA 1KSNA 3BTHE 4FETA 3STJA 1MQ6A 1NRSH 1YPJH 5A8YA 3LJJA 3VXEH 4LZ4B 2TGAA 1YPGH 4OS4A 4NG9H 3DD2H 1LQDB 2OTVA 4UONA 4K60A 3LIWA 5DP5A 2OK5A 3ZZ8A 3M61U 2OLGA 3MNCA 4UDWH 5FXLA 5EQQA 2JH6D 2SGDE 3TPIZ 1DITH 1SGPE 3G01A 4H4FA 1QJ1B 1C5OH 2BMGB 4NIXA 1YKTA 1BTYA 3FAOA 1DICA 2GX4A 1O2JA 3PROA 1M9UA 3AK5A 1LPZB 2QXGA 1HAZB 1SOTA 5KEDA 1GBEA 1VGCB 2V3OH 3RC6A 1TX7A 3RP2A 1AWFH 1K1IA 3MTYA 1FY3A 3QGNB 5TCAA 3PO1B 3ZVAA 3RC4A 1O3BA 1J15A 3MO6A 5DN6D 1C1TA 2ZDAH 2ZDNA 1ETTH 2R3UA 3LGTA 1BIOA 2B0FA 1PPEE 1RTFB 2G81E 2SGQE 5EXMA 1KLJH 3SHCH 1DDJA 1O5BB 1RIWC 2RA0A 3WW7A 3OTJE 2WPJS 3NUMA 1UMAH 1HAGE 3T2NA 3AAVA 1ELBA 3CS7A 3EE0B 3Q3KA 3SGAE 3UR6A 1BHXB 2PKSC 3S7HB 1O2YA 2PSYA 3RXEA 1O30A 4YXWD 4CHAB 1D4PB 1RGQA 3W1EA 1Y8TA 3GCOA 1B7XB 5FPYA 3L3TA 1GBLA 1GI8B 1S82A 1UK4A 5GCHG 1TX8A 3KQDA 4X2VA 1C1RA 3A85A 4DG4A 3T62A 3MQKC 1GJ9B 1OWEA 1EZSC 1ZTJA 5G4BA 4AGJA 1B0EA 1ELAA 1KXCA 5F8ZA 4B73A 5F8TA 1XUFA 3DT0H 5EW1H 1K1NA 2UUFB 1GBDA 2YOLA 4ZXXH 4B74A 2SGAA 5JBAS 1FUJA 1GI1A 3RMNH 1W0KD 1O34A 3ZZ5A 2GKVE 3TK6A 1C1VH 1EPTC 1NFYA 1CGHA 3ATWA 3RXHA 3M7TA 2VIQA 5ESBA 1V2TT 4CRDA 1DSTA 2STBE 2KR7A 3KHVA 1LHDH 1AQ7A 1UVSH 3QLPH 2ZCLP 3S9AA 1E34B 3GISB 4BTUB 3Q00A 1WYKA 3ZZ3A 4XSKU 2VJ1A 3SJ9A 3T28A 1F0TA 1XKBC 4RI0A 2A4QA 2RG3A 3V13A 4BTTB 3VEQB 1XKAC 2CHAB 3BEIB 3RXMA 2VH6A 2FYRA 3I78A 2F9PA 1WUNH 1UVTH 4LXBH 1CQQA 5AHGH 4ZHMU 1ETSH 3B8JA 3RXIA 4OS1A 3KQCA 3TU7H 2VVCA 2G5NA 1EAIA 1GBKA 4AFSA 1XMNB 1P9SA 5GPIB 4AN7A 4D9QA 1BTUA 1CT4E 3DCLA 1L0ZA 1V2KT 3E8LA 4MLFB 3F0OA 3SUEA 1E0FD 1EOJA 1UCYK 5EGMA 2VH0A 2ODYB 2J34A 2BD3A 4FUIA 1QHRB 4JK6A 2Z94A 1GBAA 4CHAC 1XVOA 3TIUA 4F4OC 2BZ6H 2ZEBA 4ABDA 1ZMNA 2Y7XA 2BY7X 1L2EA 1LVMA 1K2I1 4WWYA 2PSXA 4X2YA 2ZNKH 2NU3E 5A8XA 1V2ST 3GY5A 4DURA 1QQUA 1A1RA 5BPEA 4KGAA 4X2XA 3BTTE 4Y10E 2AIQA 5TCCA 3WY8A 1DS2E 4IC6A 1TYNA 1MH0A 1UTKA 3S0NA 2AIPA 4NIYA 2FEQH 2QY0B 1AUTC 1TQ7B 1ESAA 2H6MA 3LDXH 2HLDD 1C5WB 1SB1H 1XUIA 5JYIA 3A83A 5FPTA 5GJ4B 1FZZA 2EQNA 4A1VA 5E2PA 1G3DA 1HAXB 2ZG0H 2P3UB 1MU8B 2PR3A 1BRAA 4K1SA 1QRWA 4FUFA 2FI4E 1TNIA 5T3HA 2ZPSA 2GCTC 2PLXA 1Y3WA 3MH7A 4X8TH 3PMBB 2G51A 2ZFFH 2Y81A 3SJOA 2GZ7A 2W26A 4AORA 2F83A 2JETC 1ARCA 2M5TA 4X6MA 2YMSC 1C5QA 3PV5A 8KME2 5AVDA 5A0BA 1IQGA 1S0RA 1AY6H 1J8AA 1OOKB 1EASA 5GNDA 4ABJA 5IK2D 1O2ZA 3DFLA 4ZH8A 4NGAH 1SG8B 1Y5AT 1EAXA 3SNAA 3PB1E 1O3JA 1V2RT 1EXFA 3M5MA 2C8YB 2BX3A 3SI3H 3VG8A 2F43B 2FS8A 5FBEA 2PUQH 2Y5HA 3OY6U 1UVPA 5GIBA 3MNSA 5I25A 5J4SA 3UY9A 3TH2H 3VB7A 2WINI 3UAIC 3TGKE 2XNDD 3SV9A 4YM9A 1BTZA 1LVBA 1MU6B 1SQOA 3NWUA 3V3MA 1CHOG 2P3TB 2GMTB 3GYLB 3EA7A 4ZMAH 2VGCB 5F03A 4XD7D 3UREA 3RXPA 1IOEA 4FOUC 2O8WA 3RXTA 4K69A 3NCLA 1THPB 4P00A 2RFKC 4P02A 1C4U2 4UEHH 3UQVA 1GL0E 3I29A 2W6JD 3FOAA 3S69A 4O03A 2GP9B 5ABWA 2ZFSA 3A8CA 2OBOA 4KTSA 2XYAA 1QFKH 1MKWK 4NCYA 8GCHG 2GZ9A 1K21H 1AWHB 3ZZ7A 3LGWA 1P9UA 3PLKA 4O3TA 2H9EH 4GLYA 5GDSH 4AYVB 2KZ4A 3FZDA 1DY9A 3KYGA 1O0DH 2XW9A 5FHTA 2QXIA 2JIZD 1ARBA 2J94A 4NIVA 1AKSB 1BRBE 3UQOA 5LGOA 3TJOA 1O3IA 1W7XH 2AH4X 2D2DA 4YT6H 1TMBH 1GG6B 4OGYA 1H9HE 2A5KA 2J98B 1HAVB 2ZA5A 1QIXB 4FXGH 5LPRA 3HATH 1TNKA 2G52A 1AVGH 1UTJA 1CE5A 1ABJH 2XCFA 1NU9A 1MMJN 2ZF0H 5EOKA 1O2OA 4YZUA 4SGBE 3T29A 2H1UA 1COWD 4A92A 1AFQB 2HVXA 2JJ1D 5IYTA 2YMSB 1EAUA 4ACAA 3FP7E 2ESTE 3UPEA 2BVRH 4JCNA 2B8OH 4PROA 1TNJA 1K22H 4WMFA 4NWLA 1G2LA 1EJNA 1GBMA 2ANYA 4A1XA 1V2UT 1O3LA 2BVSH 2WPMS 1C1NA 1OX1A 3ZVBA 1QBVH 4WVPE 3BEUA 1LKBA 5DP3A 2A5IA 3F3BA 1WV7H 4UE7H 1WU1A 4LK4A 2P8OB 5F6MA 4WH8A 1GI5A 3RU4E 9ESTA 3U8TH 1OXGA 5H4IB 4DIIH 2IJD1 3ZZBA 2UWPA 2VGCC 3LKWA 1C2MA 3RU4D 3SQEE 1TPOA 3GDSA 1P04A 1XUGA 3UOPA 1MUEB 1SFIA 1AIXH 1T8LA 4GSOA 2HOBA 5DP8A 5FCKA 1J16A 1L1NA 1BJUA 1XUHA 2UWOA 1ACBE 4AZ2B 1C9TA 1IQFA 1MZDA 5E0HA 1WCZA 2XOKD 5JDUB 1DPOA 3GS9A 3SNCA 1NO9H 1RFNA 2B7DH 1ZSJA 3DA9B 4ISOA 2KX4A 1XUKA 2D1JA 5LPFA 2BXTH 5I46H 4FUGA 3KEEA 4IC5A 4ABFA 1DY8A 1QJ6B 3A89A 3R0FA 4JZFH 1GGDC 4K5ZA 1O2PA 1ABIH 1SKYE 4TY7A 3ZV9A 2FS9A 1F92A 2GT8A 3OEED 2ZFRH 1L1GA 1P01A 1LO6A 1BCUH 1LDTT 2VIPA 1O5FH 1SGYE 1HYLA 2CHAC 1D6RA 1FNIA 1YCPH 2Y6TA 3A7WA 3UUZA 3RMLH 2DE9A 4OS6A 5JB8S 1TGSZ 2QV1A 2FPZA 3BTQE 2FESH 5JBBS 1EX3A 1H8HD 2AS9A 1C5SA 4WH6A 2WSSD 1P2IA 1VJAU 2Q6FA 3EA9A 3QZRA 1O2RA 2IPQX 5DPAA 1EB2A 1A4WH 2Z9GA 2J4IA 1IQKA 2GTBA 4CRCA 1W10U 3BTEE 1P12E 4X0WU 1NS3A 2BDYA 2XBVA 2FWWA 2HPPH 2ZZUH 1UCYE 1G9IE 4CR5A 4JYUH 4RKOB 4BAMB 3S9BA 1GJBB 1MQ5A 2ZECA 3QWCH 1UTOA 2B9LA 3GCNA 1BDAA 2GT7A 3CS0A 1C2IA 1SLWB 2BD4A 1YPMH 5EU8A 3FFGA 1UVOA 3ZVFA 2ZFQH 2ODQA 4A7IB 1RRKA 3IITA 1DUEA 1C2LA 1YLDA 2FLBH 1C5NH 1GCTB 4INHA 4DIHH 2WYJA 3SV6A 2PKAA 4Y6DA 4IGDA 1MAXA 5FX5A 2OINA 3MNBA 3UB0A 3U69H 5BRRE 3P6ZB 2G55A 3SYJA 2W5EA 1C5PA 1PPFE 1QB6A 1YM0A 2EY4C 3UWIA 2BZAA 2Z6BD 5B6OA 3A87A 1ZPZA 3MOCA 1ELTA 1C2FA 1MZAA 4CBNA 4F55A 3A7XA 2WPLS 1RTKA 2AMQA 1FY8E 1K0HA 2VWLA 1LCYA 1ZYOA 2R2WU 3MH5A 3BSQA 1YC0A 3VB3A 2Y82A 1O3FA 2BLVA 4X8VH 2XBYA 3GCHC 2THFB 5CHBA 4UFFH 1F0RA 3R3GB 3OYPA 1OP2A 1O2TA 1O2NA 1GHAF 1TPPA 3U8RH 5B6LA 2H9HA 3UFAA 2FOCA 1FX0B 2V0BA 3SNBA 5C0TA 4IBLH 1RJXB 2QF5A 1KXBA 1V6DA 1V2LT 2R9PA 2AHME 2HNTC 4R0IA 5C1YA 3A81A 2HGTH 1C1MA 2LELA 3P70B 3ATIA 1O5DH 1JMOH 3M3SA 1O2IA 3OEHD 3LC3A 1CO7E 5HKKD 1ANBA 1N8OC 5JPMH 2VIOA 2ZFTA 5L2YH 3W95A 3DSPA 3F2HA 2P93A 5KECA 4AB8A 2FLRH 4H6TA 4MVNA 4KTCA 3F0PA 2DUCA 2C90B 2CK3D 3F2FA 3T26A 1P05A 1BMAA 1TA2A 4K3JA 1YLNA 1FY4A 4YT7H 1B5GH 3SNEA 1O3NA 1NRNH 4RN6A 1JBUH 2L74A 1C1UH 2BDGA 4IMZA 3SU1A 1S0QA 4AYYB 4AFQA 2ZPQA 3QGJA 3SUFA 2ZC9H 1WSSH 2J38A 1GI3A 4ISHH 5C1UA 1KLIH 2OQUA 1GMDF 1TNGA 4U32A 5A0CA 8GCHF 2H2ZA 5EG4A 4NSYA 3L33A 1DT2A 1KXFA 2F9NA 1C5ZB 1KTSB 1KDQB 1A5HA 3SU2A 2BDAA 3QTOH 1A5GH 3E0NB 3C1KA 4ABBA 1BMMH 1O32A 2ZDLA 3O8BA 1FLEE 2VB0A 3A8BA 1LVYA 2A1DB 2BQ7B 1SGFG 1XXDA 1O3MA 1Y5BT 5T6GA 3VB6A 3VB4A 4KKDA 1ELEE 1P09A 2O8TA 4MNYA 2NU0E 3QDZB 3ZZDA 4WF8A 1QR3E 2CXVA 4ZHAA 1YPKH 3VGCB 1CA0C 5JBCS 2WV9A 1TRMA 3PMHB 4RKJB 3D62A 3AVZA 1GJ7B 1NTPA 1K1PA 1TMUH 1GMHF 3RU4T 2WYGA 1BMNH 2ZU4A 1TMTH 2XC0A 1UJ1A 4Y7BA 3DSGA 2SNVA 1SGFA 4ZROA 2FX6A 1TGNA 1C5TA 1HCGA 1MAYA 1NC6A 1YPEH 2AEIH 2TIOA 3P8OA 3BG8A 4CH8B 2FOBA 2K0QA 1O35A 2GV6A 4AFUA 4DVAU 4B76A 1CT2E 1C5MD 1DVAH 3HK3B 3F9EA 3B23B 5E0GA 1KXEA 4YOIA 4B75A 2VNTA 3JZ2B 3NK8A 2FM2A 1UO6A 5HM2A 1ID5H 2FTMA 3KIDU 2GVFA 1H9LB 5JBTA 1PPGE 1HJAC 3QX5H 1QA0A 1THRH 1NFUA 1TNLA 1O5CB 1WDIA 4Q2KA 2BHGA 3LU9B 1C5VA 1Z71A 3LONA 1YPHC 3M3VA 2KM0A 3M37A 1F5RA 1K9OE 3ZIAD 1T8OA 1ORFA 3ZZ6A 3GICB 1NM6A 1A61H 1NN6A 4U2WA 2ILNA 2QXHA 2OC0A 1RTLA 1RXPA 4X1NU 2GDEH 1S6LA 4GPGA 4CRAA 4I8JA 4AG1A 4X1QU 1O3PB 2BD8A 1YLCA 3GY2A 1GI7B 3NKKA 2PFEA 1Q31A 3RXUA 3PM3A 2V3MA 1MBMA 2C3SA 3I77A 2PV9B 1P2QA 2ZDMA 4XBCA 4RT0A 1SGDE 2ZTXA 5A2MH 1P11E 1AI8H 3MFJA 2QC2A 1ZMLA 3PRDA 2FOEA 3DFJA 3SZEA 4YESB 1JIMA 3UIRA 1EOLA 3BG4B 4B2BA 1PJPA 3U1JB 3O8RA 2AFQB 3LGVA 1UTLM 1MKXH 1E37B 3RXKA 2BTCE 2BD2A 1ZTLA 2BY6X 4X8UH 3TLOA 1UHBB 2GZ8A 1IQJA 1S84A 2OC8A 2QIQA 1NPMA 2A2QH 3MH4A 2EC9H 2AGGX 1W3CA 3E6PH 3L6PA 4HI3A 4ZKSU 4DGJA 2BDCA 1ESBA 1PFXC 4E7NA 5HXFA 3A82A 1AFEH 1F5KU 3K6YA 2IN2A 2A7CA 3EAJA 3RM0H 4Y7AA 5DP9A 1SGTA 2BDBA 3S7KB 1BTWA 1PQAA 1P2JA 3BTKE 1O36A 1L1JA 1YPLH 2V7QD 3GY8A 1VITG 4X1RU 1C1SA 4JYTA 4ABEA 1V2VT 1FPHH 3LJOA 4JZIA 2LPRA 4AC9A 4ASHA 2ZKSA 4NA7A 2WPIS 2OUAA 3VXFH 2PP6A 2W7UA 2BLQA 3LH3A 3F9GA 3MH6A 1BMFD 3F68H 3ESTA 2FDAA 3EE7A 1SC8U 1QQ4A 3GCTF 1GCDA 1ETRH 1S85A 3A7YA 2BX4A 4XDEA 4D76A 1Q2WA 1GBFA 3KN2A 2VIWA 1Y3VA 3QTVH 4I7YH 2FX4A 2ZHFH 1Z1IA 3RLWH 1S6FA 1PPHE 2Z3CA 1SLXB 1A3BH 3PWBA 1VGCC 3SHAH 3OSYA 3BG4C 5ESTE 4Q7ZA 2OQ5A 2UUJB 1WAYB 1C4V2 1VITH 1CT0E 2FP7B 2XRCA 3RXQA 1DANH 4ZAEA 2I6QA 1DE7H 3FANA 1OWIA 2RDEA 3TJNA 1YYY1 1BQYA 1NT1A 4CRGA 6GCHG 2F9VA 3IG6B 2JH0D 3OFND 1DWBH 5L6NH 1C1WH 2XWAA 3U8OH 4BAQB 1W12U 3RXDA 3MMGA 1GBBA 2BD5A 1AB9B 3OY5U 3PTNA 6CHAB 5GCHF 1WXRA 5HM9A 2XNIA 1TLDA 1GWAA 1ZMJA 2ZDVH 1WOFA 3RXBA 1GBTA 1V2QT 1ANDA 1K1LA 1BMLA 4BXSA 4I31A 4Q7YA 4R8TB 4FUDA 2TBSA 1A46H 2GMTC 2BB4A 7KMEH 1W0YH 1GG6C 2G5VA 1LMWB 4UD9H 2WUCA 1TGCA 4H42U 3GOVB 3TH4H 1UK2A 2XXLA 1A0HB 2WV5A 3AW0A 3ELAH 1V2NT 4BNRA 3AAUA 2FOFA 3HPTB 1HFDA 1OS8A 4MNWA 1SQTA 2HWLB 1K1OA 1QBNA 1Z8GA 2C4FH 4Y0YE 4IMQA 1SGIB 3SUGA 1NRPH 1QL8A 2BDIA 1NBMD 1OHHD 1LHCH 1GI9B 1T8MA 1VITF 3SORA 3RXGA 1DXPA 4ABGA 4DOQA 1GHBG 4UFDH 1ZTKA 3U1IB 1P0SH 4NZLA 4ZUHA 1KIGH 4OS5A 1NESE 4U01A 4A5TS 1N6XA 4XE4A 2LP6A 4K8YA 3MU0A 1BBRH 2YNAA 4DW2U 3H5CB 4WXVA 2FOGA 2QF0A 2VINA 1GJ6A 2SGEE 2NU1E 2VWMA 1MKXK 4TPIZ 3H09A 1MTNB 2IOTA 3SO3A 1AO5A 1V2WT 1HLTH 3HK6B 2A7HA 1G30B 1W14U 4TY6A 4MPVA 2V6NA 3ENSB 5LH8A 4QT8C 1EP5A 4WXIA 3KQ5A 1DXWA 3MO3A 1FN6A 2KAIB 5C67A 3QO6A 3D49H 1PYTD 3KCGH 2A0QB 1PQ7A 3RDZA 2ZCKP 3M35A 2OCVB 1MTWA 2J97A 4GCHF 6CHAC 1GMCF 2WPHS 1KY9A 2RCEA 2PKSB 2UUKB 1D3QB 4TWYA 3KF2A 4RT1A 3T25A 4Y8XA 2ZQ1A 1WTHD 4XOJA 3URCA 1DUAA 1CHOF 1C5UA 2WHXA 1QGFA 1FI8A 3RM2H 4ABIA 2ZU2A 2P16A 3O8CA 1YCPM 3QN7A 5DP7A 2A32A 2CGAA 4NFFA 5E8EH 2AYWA 2ZTZA 3K2UA 4Y11E 2XCNA 1HAHH 1B0FA 1DFPA 4INLA 7GCHF 3AW1A 1S5SA 1GHVH 2FOMB 4Z0KA 4YLUA 5DP4A 4OS7A 3PMJA 1HJ9A 1OWKA 1MTSA 4LOYH 2J5UA 4KTUA 5DSFA 1BTHH 3FO8D 4NA8A 1ZHMA 3GCTG 4NZQA 1GBHA 1VCWA 2CV3A 1L4ZA 3PV2A 4BAKB 2ZHQH 3ZVDA 2PTNA 2C8WB 1KXAA 2Z9JA 3BTFE 3MI4A 1GVLA 2YMSD 2A5AA 1P3EA 2R2MB 1C2DA 1TGTA 1OWDA 3A88A 4X6PA 1G36A 2WPKS 2B5TB 5C2ZA 1RS0A 2ULLA 3STIA 1FONA 1AKSA 4Y8YA 4DY7B 5F53A 1DM4B 1Z6JH 1MCTA 2PGBB 2YNBA 4NIWA 4Y79A 1AHTH 1C2EA 2W3KA 3GCHB 6LPRA 3N7EA 1GHBF 2PHBA 1RD3B 2G8TA 2BY5X 1H8IH 2W7SA 4O3UA 4ZXYH 5EIYA 3A7ZA 3BIUH 4ACBA 1EJAA 4KELA 4K1EA 3E16B 1VCPA 3H7OA 1GJAB 3RLYH 1GJ4H 4Q7XA 2TGTA 1UK3A 3V7TA 1VJ9U 2QN5T 3EGKH 1GMHG 2QXJA 1IQEA 2GCHG 1W2KH 4I8HA 3ZVCA 1O5EH 1Z1JA 4O97A 5CE1A 2WPDD 4FUHA 2OC7A 1A0JA 1O2VA 3S9CA 1D3TB 2O8UA 1ELFA 1PPBH 1E79D 2F9UA 1G37A 3BTGE 2JJ2D 2HPQH 3CNRA 1IQMA 2ZFPH 1AMHA 1U6QA 3BN9A 5JB9S 1TOMH 1Y3XA 4MPUA 4MTBA 3HKJB 1HNEE 3E91A 3OE7D 1ZOMA 3M36A 4K8BA 3RXJA 3DSOA 1HPGA 1GJ8B 1HV7A 4XRNA 1TPSA 1GJCB 1QRZA 4ZCNA 1FDPA 3M5LA 1KXDA 2RA3A 5F8XA 3ZVGA 1Z8IB 3P8NA 1QURH 1BOQA 1O3HA 2AMDA 4Q80A 5T6FA 1SL3A 1EZUC 3SNDA 3UNSA 1E35B 2ZGHA 1C2JA 3HGPA 2G4UA 4FUBA 3TNSA 1DWEH 2STAE 2ZP0H 1EATA 3C27B 1FXYA 2V35A 1T4VH 1QZ8A 1SI5H 1XX9A 1Y3YA 1DSUA 5CHAB 1OWJA 3QUMP 1T32A 1HB0B 1AE8H 2BM2A 2UWLA 4AOQA 1HBTH 4AB9A 2Q1JA 3NRLA 1H1BA 3ATMA 3LGYA 1T7CA 5E0JA 1F7ZA 1TPAE 4YOJA 4J1YA 1JWTA 1S81A 3OU0A 5EQSA 1Z8RA 4IS5A 4Q63A 3RC5A 3RXSA 1P8VC 3V0XA 5C1XA 2C8XB 1CVWH 8ESTE 1GJ5H 1N6YA 1QBOA 2H5DA 3MU4A 2DE8A 4RSPA 3K65B 3E1XB 3LPRA 3TH3H 5DKMA 1GBCA 1CBWC 1UTMA 1BT7A 2XC4A 1C2HA 1FIZA 3D65E 1O2GH 1NU7B 4ZKNU 1GHAG 3MU5A 2KCYA 4Q4LA 2HNTE 1YBWA 3SU4A 5IDKA 1P57B 1E1QD 2PUXB 3SV8A 3P17H 1EP6A 6ESTA 1C9PA 4D9RA 2VWOA 5E2OA 3TNTA 2R0KA 3RMMH 3H7TA 1AUJA 1FJSA 2AGIX 1XXFA 4VGCB 1K1JA 3F2GA 2VWNA 4IN1A 1P2KA 4UFGH 3PTBA 4WJG2 1CU1A 1JRSA 1O2HA 1P03A 4TYDA 1NY22 3DUXH 1O3GA 1ELDE 4TWWA 4JZ1A 1TBZH 2ZGBH 1V2JT 1TGBA 1AGJA 1PQ8A 1FY5A 1A2CH 1F0SA 1WQVH 4DT4A 3KNXA 2G4TA 3E0PB 3M5OA 3FP6E 4X6OA 4JZDH 1TX6A 4TT3D 3GDUA 1V2PT 1HXFH 1TABE 1TA6A 1GGDB 2AGEX 4JZEH 2J9NA 1HIAB 1ELGA 2TGDA 1BB0B 4HFPB 4X2WA 4GHTA 4A6LA 4B2AA 3TGJE 1IHSH 1GI6A 4B1TA 2GDDA 1C2GA 4ASUD 2OD3B 1SMFE 1GI0A 4UFEH 3RXOA 3SBKA 1O2QA 1TWXB 1A0LA 2BQWB 1GVZA 4FUCA 4HGCA 3OX7U 1NRQH 1ZSLA 2A45B 1NFWA 2BQ6B 2FOHA 1TAWA 1YGCH 2VIDA 5DJ7A 2ZCHP 3SJIA 3SGBE 1EZXC 1IHTH 4ISIH 4M9FA 1T8NA 4M7GA 1W11U 1NFXA 2Q6GA 2SGFE 3ATLA 4IW4E 2FOAA 4OS2A 1N1LA 1T4UH 1L4DA 2R0LA 1AN1E 2P3FH 2NU4E 3E90B 1O3CA 3GYMA 6GCHF 2R3YA 5HYOA 3FN8A 1F2SE 5C20A 1BA8B 1HAVA 3GY4A 1G32B 4MG3A 1E1RD 1F5LA 2EA3A 2ZIQH 3RXVA 4BAHB 1EUFA 5L30H 1ZGVA 3GY7A 3BEFB 3EA8A 1C2KA 2KCPA 1AE5A 1SGQE 5A0AE 1C5LH 2QGRA 3M5NA 1ZLRA 1EQ9A 3FKSD 3MU1A 1QL9A 2UUYA 1O3AA 1J9CH 2XBWA 2WUBA 3KQEA 3MWIU 1KYNA 4DJZB 1F0UA 1A5IA 1HDTH 4CRFA 1ZHRA 3T5FH 3RXCA 4ISLA 5C94A 4MNVA 1HJ8A 2BY9X 2D8WA 2ZTYA 3LH1A 4CREA 3SU0A 1BTPA 2V3HH 1GBJA 3F1SB 1O31A 2F91A 1HAPH 1BRUP 2D26C 1JIRA 1T31A 4I33A 4YTAA 4AGKA 4TSFD 1O3EA 3ODFA 3RUOA 2QA9E 1W13U 5FX6A 1C1PA 1SGRE 1MD7A 4MQAA 1ZRKA 2J92A 5AF9H 2F9OA 1AU8A 1DOJA 2EI6A 5C5NA 1O2XA 2CF9H 2CJIA 1BITA 3ATKA 1EFRD 1LVOA 4AX9H 1Y5UT 5AFYH 7GCHG 3BF6H 1ZHPA 2BDHA 2O8LA 1X7AC 1GVKB 3PYHA 2ANKH 1W0JD 2L6OA 3BTWE 3SJ8A 3A8AA 4X6NA 1GDUA 4HZHA 1QJ7B 1C1QA 2C8ZB 1ELCA 4HTCH 9LPRA 3AASA 3HKIB 2NU2E 3RXLA 1KLTA 4Y71A 3HGNA 3LC5A 4DCDA 1G3BA 2KCOA 1P2MA 3A86A 1TE0A 3TITA 2OP9A 1LHGH 1HXEH 2QF4A 4OM9A 1DWCH 3UWJH 4VGCC 4K2YA 2RDLA 1GBIA 2P59A 4WMDA 1O3DA 1TNHA 2ZHWH 1OPHB 4MPWA 1ZR0A 4THNH 5PTPA 2PWXA 1LQEA 2A4RA 2A7JA 5EODA 1CGJE 1LHFH 3RXAA 1TB6H 5CDFE 2A2XH 1ZGIA 1LKAA 2Y80A 2Z9IA 1QY6A 2FZZA 2CN0H 2BY8X 2HRVA 3ZV8A 2ZO3H 2VVUA 3ZZAA 1QTFA 3UR9A 3W94A 2OC1A 5ETXA 1MABB 3Q77A 1TRYA 1AFQC 2JDID 1EAWA 3E3TA 1XVMA 1GMCG 4IN2A 4HG6A 4ESTE 3PLPA 1V2OT 3BV9B 2KCAA 2QF3A 4Z1MD 3SV2H 1ZZZA 2SFAA 3N7OA 3A84A 2ZGJA 2FI3E 2ZHEH 5T6DA 1H8DH 4I8KA 1FAKH 2ANMH 1ZJKA 3SQHE 1YF4A 3SU5A 1C5YB 4ISNA 1O39A 1HRTH 2FIRH 3ZZ9A 4CH2B 1IQIA 1CA0B 2GJGA 2BD7A 1GJDB 2IJOB 4I8LA 3RXFA 3ZZ4A 4SGAE 5EJZA 3LOXA 5C0UA 1FQ3A 2A4GA 3TK5A 1GMDG 1O2SA 2J95A 1VKYA 1OP0A 1CGIE 1OP8A 2ANWA 1QB9A 5DK1A 1AZZA 3KGPA 1N8OB 3NPSA 1Y3UA 3EQ0H 3VB5A 4KP0A 4GVUA 4B71A 2Z9LA 3DHKH 1OSSA 1TBQH 3RMOH 5A09A 1TONA 5L2ZH 3SV7A 4J2YB 3U9AH 3SU6A 1TBRH 1Z8JB 4H6SB 3KL6A 5LPEA 5EPYA 3SI4H 1P2NA 1G3CA 4XFQA 1GPZA 1SQAA 5FL7D 3TK9A 1TALA 4YO9A 3ZVEA 1O2WA 4B6EA 2IPHA 1PPZA 3TJUA 1ANCA 4DT7B 1SFQB 5FBIA 4B2CA 1XM1A 3QK1A 1V2MT 1ANEA 5DG6A 1HIAA 3KYFA 1WQSA 2JKHA 4X1PU 4ZKOU 1O2KA 2FMJA 2GCTB 5EQRA 3ZZCA 5DO4H 1HUTH 1SHHB 4BOHA 3BTDE 1S6HA 1EJMA 2HVYB 2H5CA 2ZHDA 1JXPA 4FUJA 4E05H 1QL7A 5HIYA 1KTTB 5HMAA 1P10A 1C1OA 1NBME 1V3XA
chains in the Genus database with same CATH topology
5FPSA 3TVJB 2GGVB 3SUDA 3UOUA 3FZZA 1A3EH 4I8GA 1DLKB 5SGAE 2OXSA 3VPKA 1NRRH 3P95A 3MO9A 3TJVA 2VU8E 3F9HA 3K9XB 4I32A 4U30A 3PLBA 2SGPE 2ZPRA 2A4OA 5A8ZA 1UHBA 2EEKA 3VGCC 1UVUH 2EI8A 2G00A 4NWKA 5C3NA 1ZPBA 1SGEE 3RXRA 2ALPA 3PWCA 2CMYA 4Y0ZE 3UNRA 1INCA 1TRNA 3LT3A 2QAAA 4A1TA 5K7RA 4JMYA 1LHEH 1SVPA 2ZWLH 3JZ1B 3NZIA 1HGTH 5GWZA 1GI4A 2P94A 4FU8A 4XBBA 1GHZA 2C93B 1TFXA 5DGJA 4GHQA 1NROH 3A7VA 3MHWU 4GUXA 2XC5A 2BXUH 3O8DA 2FO9A 1OKXA 4YOGA 2GD4B 3EYDA 3VFEA 2ZU5A 3LGUA 1JOUB 2Y7ZA 1G3EA 2O8MA 3SU3A 1UCYH 1O3OA 2ZI2H 2HNTF 2EI7A 1AVWA 1W7GH 4CBOA 3FP8E 3FVFB 2OBQA 2ODPA 2Z3DA 1OYQA 2ZGCA 1O2LA 1SHYA 2XTTB 4FVDA 3B9FH 2ZQ2A 1BTXA 1PYTC 1FV9A 3IWMA 1HAOH 2TRMA 2I6SA 2AMPA 3M7QA 1YPHE 3PV4A 5EXLA 1GI2A 1C5RA 4LZ1H 2Y5FA 2JETB 1UTPA 1BHXF 1ZJDA 3SW2B 2XBXA 2BOHB 8LPRA 4ABHA 2J2UA 4BXWA 1EPTA 1XUJA 3PMAB 4BAOB 4NFEA 2FXRA 1BJVA 4X1SU 2O9QA 1IQNA 1C4Y2 4MNXA 4BTIB 4ZHLU 4Z6AH 2CF8H 1CHGA 2BLOA 1OWHA 1TOCB 4MDSA 4D8NA 1SSXA 5EW2H 1DLEA 1SR5C 1D9IA 1O2UA 3SGQE 4FU9A 4O9VA 5TJXA 1FPCH 1HAYB 2P8OC 3D23A 3PO1C 1K28D 2W3IA 1GHXH 4F49A 4D7GA 5EXNA 1Z7KA 1C5XB 2F9BH 2HALA 1EB1H 3A80A 1O5GH 4TPYA 2VIVA 2Z7FE 2VVVA 5FCRA 1CSOE 1YP9A 3UTUH 5C5OA 1LPKB 3CENA 3GDVA 3GY3A 1SLUB 4GCHG 2JH5D 1MTVA 3P92A 2TGPZ 1SOZA 4NSVA 1CBWB 3TGIE 1O38A 4ZKRU 4OGXA 4JK5A 4AG2A 1BZXE 2P95A 1FN8A 1HAIH 3ODDA 4E7RG 4GAWA 2ZU1A 4E06H 2A31A 1W0ZU 2SNWA 1MBQA 2KAIA 2NWNA 1P06A 1BRCE 3F6UH 3KQBA 4AFZA 5HGGA 3MYWA 1P02A 5DP6A 2Z9KA 1NZQH 1EZQA 3NXPA 1O5AB 4MPXA 5CHAC 1ZRBA 3ITIA 3Q3YA 1O33A 5EPNA 1LTOA 3CP7A 2PTCE 1FMGA 1O3KA 1SLVB 5J4QA 2ZGXH 1TIOA 5AFZH 1EPTB 5GXPA 1BBRE 1O2MA 4WMEA 1O37A 1W8BH 1VR1H 1DX5M 3LGIA 3SOSA 3MU8A 2BVXH 3V12A 3BTME 1BBRK 1P3CA 2BOKA 1ZPCA 1GDQA 1BUIA 1JRTA 1PPCE 1OYTH 4D7FA 3A8DA 5FAHA 2WV4A 2QCYA 2Y5GA 1ESTA 1QRXA 1MTNC 2PGQB 2H9TH 1D3DB 4BANB 1MCVA 1VCQA 1RIWB 3M3TA 3EDXB 2XWBI 3Q76A 1MD8A 2ASUB 1J17T 1MTUA 1HJAB 1IQHA 1IQLA 1AB9C 3U98H 2AERH 1CA8B 1D6WA 1PQ5A 3A7TA 1UTNA 4Y8ZA 3QZQA 1EKBB 4K1TA 2BLWA 2Q6DA 7ESTE 3SZNA 1AD8H 1LPGB 2ZU3A 4WY3A 3BIVH 1AVXA 1Q3XA 4YLQH 2BYAX 3GY6A 2K1QA 3K6ZA 2FODA 1WBGB 1FIWA 1QB1A 2PW8H 1H9IE 3P8FA 1GHWH 1SGNE 2F3CE 1E36B 2BD9A 2PKAB 1VZQH 2GV7A 1AZ8A 3M7UA 1IAUA 4CR9A 3ZYEA 1A7SA 2TPIZ 3Q3XA 5K0HA 1TQ0B 4JYVH 2FYQA 1D3PB 1Y59T 1Z6EA 1QA7A 1ZSKA 1DWDH 1KDQA 1YCPK 1GDNA 1P2OA 1SGCA 1MKWH 4Y76A 1QCPA 1K1MA 3MNXA 2FTLE 4NA9H 3ZYDA 4FVBA 2QYIA 2HLCA 4INKA 1S83A 3P8GA 7LPRA 1G2MA 2GCHF 1FY1A 4FU7A 1THSH 2ZDKA 4X8SH 3SJKA 1GL1A 3SN8A 2LNCA 4ABAA 1J14A 1E38B 3URDA 3T27A 2FI5E 1ELVA 1GCTC 1H4WA 1QNJA 2Z3EA 1GHYH 1UTQA 3F9FA 1WTGH 3UNQA 2ALVA 1FAXA 1SPJA 1SBWA 4XBDA 5CMXH 4CRBA 4FUEA 1KSNA 3BTHE 3STJA 1MQ6A 1NRSH 1YPJH 5A8YA 3LJJA 3VXEH 4LZ4B 2TGAA 1YPGH 4OS4A 4NG9H 3DD2H 1LQDB 2OTVA 4UONA 4K60A 3LIWA 5DP5A 3ZZ8A 3M61U 2OLGA 3MNCA 4UDWH 5FXLA 5EQQA 2JH6D 2SGDE 3TPIZ 1DITH 1SGPE 3G01A 4H4FA 1QJ1B 1C5OH 2BMGB 4NIXA 1YKTA 1BTYA 3FAOA 1DICA 2GX4A 1O2JA 3PROA 1M9UA 1LPZB 2QXGA 1HAZB 1SOTA 1GBEA 1VGCB 2V3OH 3RC6A 1TX7A 3RP2A 1AWFH 1K1IA 3MTYA 1FY3A 3QGNB 5TCAA 3PO1B 3ZVAA 3RC4A 1O3BA 1J15A 3MO6A 1C1TA 2ZDAH 2ZDNA 1ETTH 2R3UA 3LGTA 1BIOA 2B0FA 1PPEE 1RTFB 2G81E 2SGQE 5EXMA 1KLJH 3SHCH 1DDJA 1O5BB 1RIWC 2RA0A 3OTJE 2WPJS 3NUMA 1UMAH 1HAGE 3T2NA 3AAVA 1ELBA 3CS7A 3EE0B 3Q3KA 3SGAE 3UR6A 1BHXB 2PKSC 3S7HB 1O2YA 2PSYA 3RXEA 1O30A 4CHAB 1D4PB 1RGQA 1Y8TA 3GCOA 1B7XB 5FPYA 3L3TA 1GBLA 1GI8B 1S82A 1UK4A 5GCHG 1TX8A 3KQDA 4X2VA 1C1RA 3A85A 4DG4A 3T62A 1GJ9B 1OWEA 1EZSC 1ZTJA 5G4BA 4AGJA 1B0EA 1ELAA 1KXCA 5F8ZA 4B73A 5F8TA 1XUFA 3DT0H 5EW1H 1K1NA 2UUFB 1GBDA 2YOLA 4ZXXH 4B74A 2SGAA 5JBAS 1FUJA 1GI1A 3RMNH 1O34A 3ZZ5A 2GKVE 3TK6A 1C1VH 1EPTC 1NFYA 1CGHA 3ATWA 3RXHA 3M7TA 2VIQA 5ESBA 1V2TT 4CRDA 1DSTA 2STBE 3KHVA 1LHDH 1AQ7A 1UVSH 3QLPH 2ZCLP 3S9AA 1E34B 3GISB 4BTUB 3Q00A 1WYKA 3ZZ3A 4XSKU 2VJ1A 3SJ9A 3T28A 1F0TA 1XKBC 2A4QA 2RG3A 3V13A 4BTTB 3VEQB 1XKAC 2CHAB 3BEIB 3RXMA 2VH6A 2FYRA 3I78A 2F9PA 1WUNH 1UVTH 4LXBH 1CQQA 5AHGH 4ZHMU 1ETSH 3B8JA 3RXIA 4OS1A 3KQCA 3TU7H 2VVCA 2G5NA 1EAIA 1GBKA 4AFSA 1XMNB 1P9SA 5GPIB 4AN7A 4D9QA 1BTUA 1CT4E 1L0ZA 1V2KT 3E8LA 4MLFB 3SUEA 1E0FD 1EOJA 1UCYK 5EGMA 2VH0A 2ODYB 2J34A 2BD3A 4FUIA 1QHRB 4JK6A 2Z94A 1GBAA 4CHAC 1XVOA 3TIUA 4F4OC 2BZ6H 2ZEBA 4ABDA 1ZMNA 2Y7XA 2BY7X 1L2EA 1LVMA 1K2I1 4WWYA 2PSXA 4X2YA 2ZNKH 2NU3E 5A8XA 1V2ST 3GY5A 4DURA 1QQUA 1A1RA 5BPEA 4KGAA 4X2XA 3BTTE 4Y10E 2AIQA 5TCCA 3WY8A 1DS2E 4IC6A 1TYNA 1MH0A 1UTKA 3S0NA 2AIPA 4NIYA 2FEQH 2QY0B 1AUTC 1TQ7B 1ESAA 2H6MA 3LDXH 5JYIA 1C5WB 1SB1H 1XUIA 3A83A 5FPTA 5GJ4B 1FZZA 4A1VA 5E2PA 1G3DA 1HAXB 2ZG0H 2P3UB 1MU8B 2PR3A 1BRAA 4K1SA 1QRWA 4FUFA 2FI4E 1TNIA 5T3HA 2ZPSA 2GCTC 2PLXA 1Y3WA 3MH7A 4X8TH 3PMBB 2G51A 2ZFFH 2Y81A 3SJOA 2GZ7A 2W26A 4AORA 2F83A 2JETC 1ARCA 2M5TA 4X6MA 1C5QA 8KME2 5AVDA 5A0BA 1IQGA 1S0RA 1AY6H 1J8AA 1OOKB 1EASA 4ABJA 1O2ZA 3DFLA 4ZH8A 4NGAH 1SG8B 1Y5AT 1EAXA 3SNAA 3PB1E 1O3JA 1V2RT 1EXFA 3M5MA 2C8YB 2BX3A 3SI3H 2FS8A 5FBEA 2PUQH 2Y5HA 3OY6U 1UVPA 5GIBA 3MNSA 5I25A 5J4SA 3UY9A 3TH2H 3VB7A 2WINI 3TGKE 3SV9A 4YM9A 1BTZA 1LVBA 1MU6B 1SQOA 3NWUA 3V3MA 1CHOG 2P3TB 2GMTB 3GYLB 3EA7A 4ZMAH 2VGCB 5F03A 3UREA 3RXPA 1IOEA 2O8WA 3RXTA 4K69A 3NCLA 1THPB 4UEHH 1C4U2 3UQVA 1GL0E 3I29A 3S69A 4O03A 2GP9B 5ABWA 2ZFSA 3A8CA 2OBOA 4KTSA 2XYAA 1QFKH 1MKWK 4NCYA 8GCHG 2GZ9A 1K21H 1AWHB 3ZZ7A 3LGWA 1P9UA 3PLKA 4O3TA 2H9EH 4GLYA 5GDSH 4AYVB 3FZDA 1DY9A 1O0DH 2XW9A 5FHTA 2QXIA 1ARBA 2J94A 4NIVA 1AKSB 1BRBE 3UQOA 5LGOA 3TJOA 1O3IA 1W7XH 2AH4X 2D2DA 4YT6H 1TMBH 1GG6B 4OGYA 1H9HE 2A5KA 1HAVB 2ZA5A 1QIXB 4FXGH 5LPRA 3HATH 1TNKA 2G52A 1AVGH 1UTJA 1CE5A 1ABJH 2XCFA 1NU9A 1MMJN 2ZF0H 5EOKA 1O2OA 4YZUA 4SGBE 3T29A 2H1UA 4A92A 1AFQB 2HVXA 5IYTA 1EAUA 3FP7E 2ESTE 3UPEA 2BVRH 4JCNA 2B8OH 4PROA 1TNJA 1K22H 4WMFA 4NWLA 1G2LA 1EJNA 1GBMA 2ANYA 4A1XA 1V2UT 1O3LA 2BVSH 2WPMS 1C1NA 1OX1A 3ZVBA 1QBVH 4WVPE 3BEUA 1LKBA 5DP3A 2A5IA 1WV7H 4UE7H 1WU1A 4LK4A 2P8OB 5F6MA 4WH8A 1GI5A 3RU4E 9ESTA 3U8TH 1OXGA 5H4IB 4DIIH 3ZZBA 2UWPA 2VGCC 3LKWA 1C2MA 3RU4D 3SQEE 1TPOA 3GDSA 1P04A 1XUGA 3UOPA 1MUEB 1SFIA 1AIXH 1T8LA 4GSOA 2HOBA 5DP8A 5FCKA 1J16A 1L1NA 1BJUA 1XUHA 2UWOA 1ACBE 4AZ2B 1C9TA 1IQFA 1MZDA 5E0HA 1WCZA 5JDUB 1DPOA 3SNCA 1NO9H 1RFNA 2B7DH 1ZSJA 3DA9B 4ISOA 1XUKA 2D1JA 5LPFA 2BXTH 5I46H 4FUGA 3KEEA 4IC5A 4ABFA 1DY8A 1QJ6B 3A89A 3R0FA 4JZFH 1GGDC 4K5ZA 1O2PA 1ABIH 4TY7A 3ZV9A 2FS9A 1F92A 2GT8A 2ZFRH 1L1GA 1P01A 1LO6A 1BCUH 1LDTT 2VIPA 1O5FH 1SGYE 1HYLA 2CHAC 1D6RA 1FNIA 1YCPH 2Y6TA 3A7WA 3UUZA 3RMLH 2DE9A 4OS6A 5JB8S 1TGSZ 2QV1A 2FPZA 3BTQE 2FESH 5JBBS 1EX3A 2AS9A 1C5SA 4WH6A 1P2IA 1VJAU 2Q6FA 3EA9A 3QZRA 1O2RA 5DPAA 1EB2A 1A4WH 2Z9GA 2J4IA 1IQKA 2GTBA 4CRCA 1W10U 3BTEE 1P12E 4X0WU 1NS3A 2BDYA 2XBVA 2FWWA 2HPPH 2ZZUH 1UCYE 1G9IE 4CR5A 4JYUH 4RKOB 4BAMB 3S9BA 1GJBB 1MQ5A 2ZECA 3QWCH 1UTOA 2B9LA 3GCNA 1BDAA 2GT7A 3CS0A 1C2IA 1SLWB 2BD4A 1YPMH 5EU8A 3FFGA 1UVOA 3ZVFA 2ZFQH 2ODQA 4A7IB 1RRKA 3IITA 1DUEA 1C2LA 1YLDA 2FLBH 1C5NH 1GCTB 4INHA 4DIHH 2WYJA 3SV6A 2PKAA 4Y6DA 4IGDA 1MAXA 5FX5A 2OINA 3MNBA 5BRRE 3U69H 3P6ZB 2G55A 2W5EA 1C5PA 1PPFE 1QB6A 1YM0A 3UWIA 2BZAA 2Z6BD 5B6OA 3A87A 1ZPZA 3MOCA 1ELTA 1C2FA 1MZAA 4CBNA 3A7XA 2WPLS 1RTKA 2AMQA 1FY8E 2VWLA 1LCYA 1ZYOA 2R2WU 3MH5A 3BSQA 1YC0A 3VB3A 2Y82A 1O3FA 2BLVA 4X8VH 2XBYA 3GCHC 2THFB 4UFFH 1F0RA 3R3GB 3OYPA 1OP2A 1O2TA 1O2NA 1GHAF 1TPPA 3U8RH 2H9HA 3UFAA 2FOCA 2V0BA 3SNBA 4IBLH 1RJXB 1KXBA 1V6DA 1V2LT 2R9PA 2HNTC 4R0IA 5C1YA 3A81A 2HGTH 1C1MA 3P70B 3ATIA 1O5DH 1JMOH 3M3SA 1O2IA 3LC3A 1CO7E 1ANBA 1N8OC 5JPMH 2VIOA 2ZFTA 5L2YH 3W95A 2P93A 4AB8A 2FLRH 4H6TA 4MVNA 4KTCA 2DUCA 2C90B 3T26A 1P05A 1BMAA 1TA2A 4K3JA 1FY4A 4YT7H 1B5GH 3SNEA 1O3NA 1NRNH 4RN6A 1JBUH 1C1UH 2BDGA 4IMZA 3SU1A 1S0QA 4AYYB 4AFQA 2ZPQA 3QGJA 3SUFA 2ZC9H 1WSSH 2J38A 1GI3A 4ISHH 5C1UA 1KLIH 2OQUA 1GMDF 1TNGA 4U32A 5A0CA 8GCHF 2H2ZA 5EG4A 4NSYA 3L33A 1DT2A 1KXFA 2F9NA 1C5ZB