2AOTB

Histamine methyltransferase complexed with the antihistamine drug diphenhydramine
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
288
structure length
286
Chain Sequence
MRSLFSDHGKYVESFRRFLNHSTEHQCMQEFMDKKLPGIIGRIGDTKSEIKILSIGGGAGEIDLQILSKVQAQYPGVINNEVVEPSAEQIAKYKELVAKTSNLENVKFAWHKETSSEYQSRMLEKKELQKWDFIHMIQMLYYVKDIPATLKFFHSLLGTNAKMLIIVVSGSSGWDKLWKKYGSRFPQDDLCQYITSDDLTQMLDNLGLKYECYDLLSTMDISDCFIDGNENGDLLWDFLTETNFNATAPPDLRAELGKDLQEPEFSAKKEGKVLFNNTLSFIVIEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for inhibition of histamine N-methyltransferase by diverse drugs
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Histamine N-methyltransferase
total genus 105
structure length 286
sequence length 288
ec nomenclature ec 2.1.1.8: Histamine N-methyltransferase.
pdb deposition date 2005-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13489 Methyltransf_23 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2aotB00
3MGGA 4YMHA 1EQAA 1P39A 3UJBA 2NP7A 3HCFA 2FCAA 1XXLA 4E2YA 2CL5A 3MCTA 1JR4A 4BP1A 1RJGA 2JG3A 3AXTA 3I64A 2PBFA 3E7PA 4GOND 3NTVA 2ZZKA 2OZVA 4XUDA 4YUYA 4GC9A 2OBFA 4EK9A 2UYQA 4FR0A 4E70A 1P1BA 1ZHFA 2GH1A 3LSTA 2XYVA 2ZBRA 1G8AA 3D2LA 2OKCA 3EVAA 3FPHA 3GWZA 5GM1A 4CTKA 5HOQA 4RTMA 1SUSA 2B9EA 3NWEA 4LWPA 3LBYA 2Z6AA 3FTDA 4OA8A 2ZBPA 4MTLA 4ATNA 1KYWA 2YTZA 3B7PA 3ME5A 2CWWA 3UJCA 5MHTA 5F2OA 3LKDA 4C06A 4CKBA 3GIWA 4E30A 4DA4A 3OU6A 4RVFA 3EVBA 3P97A 4IV8A 4ISCA 5KQRA 5DM4A 5F2KA 2EFJA 4FGZA 5HIMA 2YXLA 2YVLA 2E5WA 1IY9A 2JH8A 3G2PA 1XDZA 3BWCA 4FT4A 5K0LA 2NXJA 3ELDA 5K0EA 5FUBA 3FUUA 5GM2A 3P2EA 4MWZA 3EPPA 5FQOA 1TW3A 4Y2HA 1L1EA 5GWXA 5DTMA 3TR6A 2A14A 3UJ6A 4QDKA 3ER8A 5G02A 3MCZA 3REOA 3KPWA 5K0JA 2ZWAA 5LQAA 4FSDA 4X1OA 5E1BA 1Q0TA 2I62A 5KS2A 3EVFA 3KQQA 4PIPA 5EGSA 3R24A 4G56A 2YQZA 2IH4A 3HEMA 2VDWA 1R18A 5CUQA 1P1CA 2ZW9A 3MQ2A 2I9KA 5FHQA 1QZZA 5CIYA 2AOTB 3S68A 3NJRA 4PGHA 1D2CA 5FCDA 2VP3A 4C04A 3KQTA 1JSXA 2HMYB 4Z2YA 4KIGA 4RTSA 3NMUF 1G6Q1 4BY9E 2BR3A 2AN5A 3HP7A 4C4AA 3P2KA 4LG1A 3LCCA 1UFKA 3OZSA 4CWAA 2IBTA 1NW7A 2P7IA 1RI2A 2PKWA 3A27A 1M6YA 3OFJA 5HIKA 2FHPA 4AUKA 3LDGA 3E23A 3KQWA 1ORHA 5CVUA 5CVEA 3HA5A 1NBHA 4ER7A 3HCEA 1NW5A 3IEIA 3PB3A 3P9CA 2AN3A 5KVAA 3FYDA 5LQCA 2OXTA 5ICGA 1F3LA 4V0RA 3C6MA 2I6GA 3NVMB 3ANXA 5E9WA 3LL7A 4M37A 2ADMA 5LR6A 4HGYA 3DTNA 1FP1D 2DPMA 4M7RA 1QAMA 4IWNA 1N7JA 3EVGA 2VS1A 3MB5A 4QPNA 1SVUA 5FULA 3VYWA 5C1IA 5LQNA 5CCBA 2PT6A 1ORIA 2NYUA 2YUIA 4KIFA 3UJDA 1RI3A 2CMHA 2JHAA 1XCLA 2EX4A 5EMKA 4DCGA 3B3JA 3JWHA 3G89A 4C03A 5DXAA 4RX1A 3KPUA 2GB4A 2PWPA 2IP2A 4PGGA 2VDUE 2PSSA 3GNLA 1NW8A 3H2BA 3ERCA 3BKWA 3M4XA 2QM3A 3DMHA 3PVCA 4XCXA 1WY7A 3UBTA 2P1DA 3M70A 3SVZA 1ZGJA 5K01A 2Z6UA 3HVHA 1L9KA 3EVEA 2B3TA 4YUZA 1R6AA 3EEYA 1FJXA 1RJDA 3G8AA 1JQ3A 2XVMA 3OE5A 7MHTA 4GC5A 1KPGA 2QYOA 3T7TA 3A7EA 2C7QA 3I58A 4PYLA 4OBXA 5FA5A 5E1OA 4P7GA 3EGIA 3FTEA 5EHIA 2GS9A 1XDUA 2JJQA 5LQJA 1YF3A 2PV0A 3ID6C 5EIWA 1N7IA 5EQJB 3VC1A 3GRUA 3THSA 4QPPA 5DPMA 2IH5A 1R8XA 1RI1A 3PX2A 3UJ9A 5EHGA 2WK1A 1EJ6A 4O29A 4P7JA 4MQ4A 4EQZA 1NV9A 4WVLA 2PXAA 4Y30A 4PYMA 1G38A 3GRZA 3PS9A 1O9GA 3TKAA 3UZUA 1TPYA 2B2CA 2ZWVA 5CM2Z 3LHDA 1AQJA 3CJRA 3LPMA 4R8SA 4PYJA 3UJAA 3CCFA 3JWGA 5B1SA 4U7PB 1WXWA 4GOOD 3OFKA 5GIOE 1Z3CA 3TOSA 3KR1A 1EJ0A 4M38A 2PX4A 3AJDA 4YV1A 5K0GA 1JQEA 3GRRA 4R05A 8MHTA 2NXEA 3A26A 3RIEA 3SX0A 4FS8A 4KDCA 5H02A 3IYLW 4LECA 4PIMA 3O31A 3LECA 5E1DA 1FBNA 3O4FA 4M36A 2G71A 4RWZA 3KPYA 3G88A 3FZGA 4EMSA 1JG1A 3DR5A 2PWYA 3OCJA 4AZVA 4BLWA 3O7WA 5EZQA 5DWQA 4DZRA 4C05A 1VQ1A 3T0IA 4E31A 5ICCA 3PX3A 5DX1A 5EMJA 3UFBA 4PCAA 1KPHA 5F2NA 2AOUA 2VDVE 4QQNA 1YZ3A 2PJDA 1G55A 2PT9A 1JG2A 4GF5A 5E2BA 4DM3A 1YFJA 3P8ZA 3HM2A 3FPJA 1JQDA 5EC8A 5FHRA 4HC4A 4DKJA 5K05A 3BT7A 9MHTA 3CBGA 3R9XB 1QYRA 3V8VA 2UYHA 1SQGA 3MHTA 5LQKA 3OPNA 4RYLA 4KRGA 1IXKA 5EZSA 5HEKA 2EJUA 3ELWA 4C07A 2YX1A 4GOMD 1JTEA 3DUWA 5CVDA 1NE2A 1U2ZA 3KHKA 2G1PA 4YV0A 1X1AA 2AR0A 3KPJA 4MHTA 1PJZA 5C0OE 3E05A 1WG8A 2FYTA 2HNKA 1BC5A 3VC2A 5K03A 4YUVA 3HTXA 3LCVB 4PYIA 3M6WA 5DSXA 3EMBA 5KYGA 2K4MA 1RI5A 2PGXA 4KDRA 2XVAA 1X1CA 3CKKA 3GDHA 4K6MA 1BHJA 2FK8A 3FTCA 1TW2A 4X61A 3GJYA 5DTQA 3MAGA 3G5TA 3ORHA 1XTPA 5E8JA 3P9KA 5EOVA 5EG5A 4ZTBA 5IKMA 3DXXA 1BOOA 3BUSA 3TM4A 4PNEA 5BW5A 4PWYA 2QRVA 5DM2A 4RTPA 2XBMA 2ZCJA 3OU2A 2ONYA 2AOUB 1KXZA 1KPIA 2ZVJA 1M6EX 3KQSA 2IBSA 1XVAA 1PRYA 4EVIA 2FPOA 2OB2A 4PYKA 3TPZA 2G72A 3DLIA 3FRHA 3G8BA 2NP6A 4BLUA 3R6TA 1M0EA 3HCCA 5DRTA 5EPEA 4PYNA 4YUXA 1INLA 3CGGA 1FP2A 5BW4A 2UZ4A 4HRAA 3TMAA 2ESRA 3UWPA 3G2QA 4KW7A 4C08A 3SXJA 5CD1A 1FPQA 1RJEA 2CMGA 2PVCA 1NT2A 4FSXA 4HGZA 5CVJA 3TQSA 1XDSA 1XJ5A 5FTWA 4DCMA 2WA2A 2LD4A 3BZBA 3KKZA 2IGTA 1OR8A 1R00A 3ELUA 3Q7EA 3R3HA 2PX2A 2BM8A 3EVZA 5FA8A 1G60A 3NW9A 1O9HA 1VPTA 3A25A 5GIPE 2C7PA 3ELYA 3V97A 1D2GA 3LKZA 3WSTA 1VBFA 5P8WA 3HA7A 2HTEA 4R8RA 1B42A 3BGIA 4FP9A 4RVHA 5K0NA 1KYZA 2GA9A 3FTFA 3SSOA 4GOLD 4A6EA 3CVOA 4NECA 4QVGA 4RVDA 5DRYA 4B17A 2WA1A 3I53A 1O54A 5T6BA 1DCTA 4POOA 3BKXA 2ZLBA 1MJFA 1NW6A 2DULA 2IDKA 3DH0A 3OZRA 3DXYA 4R6XA 4YV2A 4RTQA 3GCZA 2ZIGA 5HFJA 4DF3A 1I4WA 5JUWA 1SQFA 3OZTA 4WXHA 1T43A 4PCLA 5FWDA 2R3SA 1IM8A 5EKXA 4P7FA 5DLYA 3HCBA 3PTAA 3M6VA 3I9FA 3SR4A 4GQBA 3MTIA 3EEOA 5DTRA 2HV9A 4HG2A 4AZTA 2P8JA 4CKEA 1SKMA 3HVKA 3HA3A 3KR2A 3LBFA 1VIDA 3RODA 1NV8A 3KR9A 1R8YA 4RV9A 4V0QA 2IDJA 4RSRA 5LQUA 3K0BA 2NNWB 4OQEA 2ZBQA 3P71T 3B5IA 4HTFA 4QVKA 4RTOA 4LWOA 2OPBA 4BP3A 1HMYA 3KQPA 3TRKA 5GP1A 4UOEA 2UYOA 2PXXA 3LCUA 3SMQA 5E9JA 3TLJA 1VLMA 3UJ7A 3KPVA 1ZQ9A 3AXSA 2AOXA 1I1NA 3B89A 4H0NA 2EJTA 2OB1A 4QQKA 3BGVA 2I7CA 3BWYA 5FQNA 2AOWA 5HIJA 5EKUA 4ER3A 5CCXA 5LQRA 4EKIA 1NBIA 3JWIA 4F84A 3FUXA 3M33A 2JHCA 5T64A 3BXOA 3LDFA 3NDIA 3QOXA 2Y1WA 2ZFUA 3A7DA 2N47A 3DXZA 3GGDA 2O06A 2O57A 4RVGA 4DQ0A 2BM9A 3VSEA 4RTLA 3SM3A 1H1DA 3SSMA 2ZZNA 4P58A 4OA5A 3B3FA 3G2OA 2H1RA 5GOZA 5EIFA 3B3GA 5DX8A 3FPGA 2G8NA 3TKYA 4FT2A 1YFLA 1VE3A 3IHTA 3FPEA 3IV6A 5EMMA 3PFGA 4IV0A 4PYOA 5U4XA 3SGLA 1EG2A 3BWBA 2BH2A 1QAOA 4CXMA 4R6WA 5K8VA 2QE6A 3DULA 4GBED 2AOTA 2YXEA 2IIPA 2O07A 1HNNA 3PT9A 2JH9A 10MHA 1YB2A 2AOVA 3G2MA 4HH4A 4PYQA 3T7RA 4X41A 5DX0A 1P91A 4A6DA 2OYRA 2FRXA 3A4TA 4GUAA 1EAMA 1NW3A 3JWJA 3EGVA 1R74A 1VP3A 3TM5A 2AVDA 3CJTA 1RI4A 2C7OA 2Z6QA 1Y8CA 1ZGAA 2P35A 2CKDA 1N2XA 1WXXA 1X19A 5D1NA 4AZSA 3MERA 3UJ8A 3CC8A 4EKGA 3P9NA 3DLCA 2ZULA 4QTTB 2AN4A 1KR5A 3G5LA 5DM0A 2BR4A 4CTJA 1YZHA 5KQSA 3ER9A 5K09A 1QANA 2HWKA 3KQYA 3MTEA 1JTFA 2HR1A 2R6ZA 2AVNA 4QTUB 4E2WA 3X0DA 2FK7A 2H11A 2JHPA 3DMFA 3DOUA 3EVCA 2F8LA 3FUVA 5IH3A 3UA3A 4ER6A 2IPXA 4RTRA 1KP9A 2PXCA 3HCDA 5E8RA 4ER5A 4PINA 4YUWA 3I5UA 1BKYA 2C7RA 5E9QA 3BGDA 5EEGA 3T7SA 4CKCA 2ZZMA 4XUCA 5FWAA 3C6KA 3K6RA 1I9GA 3CJQA 1RJFA 2ZTHA 3PFHA 3EVDA 4P7KA 2P41A 2AS0A 4DMGA 5EEHA 5FADA 2O05A 5JR3A 3FUTA 2YXDA 4JXJA 3TFWA 2PX8A 3QOWA 2GAFA 1AQIA 2IH2A 2IFTA 1X1BA 1KHHA 5HILA 4E2XA 2P3QA 3KQMA 5K0FA 3C3YA 3EMDA 5E2AA 4KWCA 4MIKA 3FYCA 5K0BA 5EMLA 1X1DA 3DP7A 3U81A 2AZTA 4FZVA 2P40A 3R0QA 2XYQA 4BLVA 1KIAA 1YUBA 3OU7A 2ZIEA 5E1MA 3SSNA 5C9ZA 1MHTA 3NDJA 4RTKA 5D1HA 2NXNA 3BWMA 1ZG3A 5DSTA 2V7EA 1AV6A 1UWVA 1JG3A 2Y1XA 2O0LA 3FRIA 2B78A 2ZIFA 3UA4A 4F85A 2B25A 3GO4A 3OE4A 1EIZA 5EVJA 4E32A 4AZWA 2V74B 3PLAE 3QV2A 5BP7A 1XCJA 3KR0A 3LGAA 2ERCA 3THRA 2ZSUA 2VZ9A 1NKVA 4OX9Y 5ERGB 3LDUA 1ZKDA 3C0KA 2GPYA 3Q87B 4HTFB 1DL5A 3F4KA 3RW9A 3L8DA 1VP9A 4PONA 2UYCA 3DMGA 4QDJA 2BZGA 1DUSA 4X63A 5DM1A 5HZMA 4X60A 2GLUA 3KU1A 5GINE 1VL5A 2NXCA 2PY6A 5ICEA 1AF7A 1D2HA 3GXOA 5HIIA 3FUWA 3NVKI 3AWIA 3GU3A 2OO3A 1JG4A 2G70A 4U7TB 3P9IA 1SUIA 1JSZA 3HNRA 4E33A 1V39A 1Q0SA 2QY6A 3M6UA 2P7HA 2QRVB 3HCAA 4OBWA 5K0CA 1L3IA 4XUEA 3G7UA 4E2ZA 5ICFA 2P3LA 3AY0A 3HVJA 3HVIA 2ONZA 5BXYA 3EGEA 1WZNA 2PX5A 3P2IA 4RTNA 2OY0A 2P3OA 4AX8A 5T67A 3KQVA 3KQOA 4ER0A 5DXJA 2PLWA 4RTJA 1QAQA 4IKPA 1WS6A 2KW5A 4OQDA 2Q41A 5LSAA 2BR5A 4HSGA 4F86A 1SG9A 4KVZA 3M6XA 2H00A 4YMGA 5M5BA 2YR0A 3LX6A 5DT2A 3GRYA 4L7VA 3FPFA 1L3CA 3NWBA 4GEKA 1G8SA 3C3PA 3GRVA 2EG5A 1L3BA 1UIRA 3E8SA 1F38A 2XYRA 2ORED 5CVVA
chains in the Genus database with same CATH superfamily
2JFQA 3IQFA 1E1MA 1U9IA 3CWCA 4F7DA 2MR5A 1RLJA 5IJ9A 3W5AA 4HH0A 3TI9A 1SCQA 3ZNOA 1NX9A 4N5NA 4RQBA 1Z2NX 1HF3A 4TLLB 2XZLA 1DOZA 2OZVA 5L6MB 3GJ6A 5ALXA 3KTFA 4R1QA 3KZ1E 1G2QA 2ZBRA 3FMIA 2OKCA 1JKMA 4HB2A 4FFPA 4BMSA 4QXPA 5LNK1 2QV7A 2WFLB 2ZDHA 3F6RA 1JKFA 3RU3A 3TZBA 4J4BA 5IZ4A 1HX7A 2XOXA 1QHHB 1XQ6A 3L77A 4JASB 1WETA 1SXIA 5ETJA 5KAPA 1P1IA 4AK9A 1L7OA 1GQRA 5FWXA 1VL6A 4Q3KA 5F2OA 5CFMA 1J22A 5AW4A 1MIOA 4F2PA 5IT9A 2HJWA 3H4TA 3TIIA 1VM6A 4DA4A 1LDEA 1IEQA 1UM9A 4BU0A 5BWLA 4EM6A 2VJAA 1EVJA 1N1GA 2FOIA 2YKGA 4FDLA 1H6BA 1A82A 3AUKA 2GFQA 1P2DA 3C1OA 2O1SA 2EL9A 2FZ5A 3JZMA 1MV8A 3RSFA 2B4AA 1Z0SA 2J3HA 5ILGA 2O2EA 2XGJA 3BWCA 2C8KA 4AT1A 2NXJA 5CHYA 5CFRA 1OYWA 2P9QA 3D7KA 1FDSA 1G4AE 1L4KA 4RHYA 5GM2A 1ZUNA 3G5AA 4W1QA 3TTVA 3SSAA 2QTCA 1AGRA 2AI3A 1NLUA 2HHCA 3FSEA 4RNDB 4YJ2B 4D0RA 4YHHB 2W42A 3FIUA 2R8OA 1Z17A 2QVXX 2VCYA 3OLYA 4CR8A 3DFZA 1ZINA 3A8TA 4FQ8A 3RS9A 5EJ9A 2SHKA 1U2DA 221PA 3DOEA 2A57A 3VKFA 2HRRA 1F1JA 4L5AA 1WZ2A 1PJSA 3QWAA 1MQ8B 3PUXA 3SHTA 3MT7A 4Q12A 4YAEA 5AK6A 1MG0A 1BVHA 3CLTD 1GUZA 3WQRA 2BV3A 1BQ4A 1X92A 4G84A 5A1TA 4WERA 5IF3A 3IBYA 4DNFA 3HKEB 2FRVA 4KHZA 2JATA 3RYFB 2MCFA 1GGVA 3KAPA 1MAAA 2OGUA 3CEHA 1CY4A 3G8DA 3ZVKA 1MIOB 4AG6A 3K4PA 2P7IA 3A27A 4YXFA 2FETA 2H59A 5AW9A 1GG8A 3E9EA 3TAXA 3P26A 2R79A 5DW3A 2SKEA 4YWHA 4BBPA 3SBXA 5BSWA 5IXJA 1F12A 1RE1A 2EZUA 5CVUA 5JASA 5BSTA 1X8XA 1HDEA 3RJ9A 1EVYA 4RY9A 1FMTA 1ODTC 2ADMA 1OKKD 1YVEI 4GM1A 4C21A 3OCUA 1SQSA 4AJHA 1ZNWA 4PX2A 1RAGA 1N6IA 2HDNB 2Q99A 1MA0A 5IYZF 4X66B 1RVDA 3VPHA 2NYUA 1JR2A 1BZYA 3K0FB 4CF4A 5DP2A 4CKWA 1I1OA 3VX4A 1NSYA 4PW0A 1CV2A 1KO8A 4NFSA 5J5AA 3U3RA 3ZHZA 2ZYVX 3LQKA 4HDKB 2VQDA 1E89A 3RVBA 4ALMA 4BLSA 1W59A 2C84A 1H5NA 4CM4A 5KSOA 4JP8A 3HK2A 3QYPA 5H02A 5JDCA 1QBGA 2C2YA 2NTEA 2VDLB 1NP3A 5H70A 4EENA 2PJUA 4WLVA 2V3CC 3ERCA 3TR0A 3JASB 1FBTA 1NVVR 1UJCA 2BM1A 4MTCA 2WE7A 5IEBA 1IL0A 3HVHA 2HMSA 4B82A 4TS4A 5A4MS 1L9KA 2FMFA 1NXTA 3TE7A 4ZQGA 2CHEA 4MPJA 2XXAB 3I3OA 1M2OA 2JFPA 1YA6A 1PGJA 1UMDA 2PX0A 2QYOA 2ZPTX 3Q40A 4GE3A 1PVVA 3UHJA 4UUBA 4ZHSA 1NI3A 1YNSA 1YO6A 1XRQA 3O1LA 3Q9SA 1BXZA 2NYAA 3RTBA 3EFEA 4G9BA 1PZXA 1NPYA 5LLSA 3DG9A 5TF4A 2WSBA 4Y6PA 4YRNA 1MUUA 1BAPA 1TO1E 2OHJA 2HA5A 3BEDA 3AZPA 1HDYA 3NZEA 4FR2A 4LDZA 4HWTA 5HCNA 3UJ9A 2GN0A 3CVXA 1GFSA 1UJBA 1J23A 3THYB 1TCVA 3IQZA 4WVLA 5DOVA 2YWFA 3TNYA 3UJHA 4PQFA 2ID4A 3P45A 2Q1SA 2IYWA 1YKGA 3AVYA 4CKWB 2I2CA 1BEUB 1U2PA 3HN7A 3OZUA 5JAIA 1K68A 5FH9A 4FJ1A 4J0DA 4I46A 2OD2A 2PX4A 9GPBA 1ZAKA 5KYWB 4UBNA 5CLJA 1LA2A 3U4IA 4BFVA 4CKBB 1RKVA 1UJMA 2VSYA 3DDHA 4KAJA 3OQVA 2FVYA 3VSAA 1UFOA 1P72A 2OMEA 5KC9A 3NIDB 5DMHA 3W8EA 4MW6A 1ZMBA 3UMVA 4B75A 3FKJA 4MV3A 4LJRA 4CF7A 3SC2B 3PPXA 4FLFA 1DC5A 1KQNA 1SKBA 4DV7B 5DWVA 3OZBA 4H7DA 4CQLB 2J85A 3LYLA 2VQ6A 4MGKR 3R5TA 1FSPA 1LU9A 1J33A 4EPWA 3L6BA 1II8A 3O84A 4U0KA 4BO3A 5KNCD 3D1VA 1A04A 1N7HA 1YRBA 1Z2EA 2OQ2A 1Z5ZA 3B5EA 1CERA 3QKSA 3CLTC 1QQBA 5HTOA 4KYTA 5F1OA 1JPUA 5FOWA 4P33A 5HG0A 4B3RB 3OPNA 4TV9B 4TWIA 2PL1A 2YJ3A 3RR2A 3TMYA 3THYA 4U5QA 4QT0A 3X2FA 4BO5A 3RRYA 4XLZA 3EFBA 3LC0A 4LV8B 5HTKA 4HLUC 4URUR 4X71A 1QZTA 1C0EA 4FUTA 3AKDA 4LXYA 3LUGA 3WTCA 2GM4A 3UMYA 4GGMX 3MJRA 4GMKA 2QTNA 2WEKA 4RORA 4DUYB 3QLVA 2VJLA 3PRKE 2E2WA 2VVTA 4LMPA 1RJWA 4R2KA 3VJLA 4MVJP 4OREX 1VJRA 1A9TA 1GU0A 3M2PA 2BP7B 1G7RA 4C14A 2OHIA 3MWEA 1G1MA 3DCJA 5KTRA 2M6KA 1C8KA 3ABOB 5EOVA 3ZXIA 3X3HA 4QKQA 1JDUA 1E3LA 5A9TA 2NU6A 4IH1A 4WZZA 3TM4A 3SVLA 4MQEB 3ZK8A 4EDHA 3DTVB 5A7FA 2ACEA 2CYBA 2ECFA 3S2GA 4UM8B 3U40A 3KYCA 3TD9A 2AOUB 2YXPX 1KPIA 3P0HA 3WQHA 2NTNA 4ZCIA 1PRYA 3DEJA 3R20A 4Z8XA 5MN4A 4WGFA 1Z4LA 4XR4A 1YOVB 4ROSA 3SZ3A 4FYKA 4OGLA 1MNAA 1PZHA 3PP8A 2HA6A 3R6TA 4LRXA 1H0KA 3BORA 2GJ4A 3RM3A 3EW9A 5LIRA 3SNKA 1K7EB 2P11A 2PQMA 3LQ2A 2ZROA 1KF0A 4EPVA 2BF4A 3QBTA 3WQQA 4B3DA 3SKVA 3KKOA 4Q7KA 1ILWA 4EUFA 1XXHB 4AKHA 2Z83A 1YJAA 1RJEA 2GA8A 3AERA 1IBRA 2PVCA 3DXFA 3EF0A 5F4ZA 1O97C 4IYJA 1K3FA 1NQ5A 3RYHB 1CJTC 4JR0A 1RWPA 1ONBA 4RELA 2V5AA 3H5RA 1NATA 1R0WA 1Z0JA 2BELA 3NHWA 5GIPE 3NUGA 1E3JA 4IDEA 3ELYA 5DBOA 1J8MF 1U28C 4D42A 3L0IB 4OF4A 3JQRA 3KKLA 2ZR0A 2QORA 2CT8A 1FYFA 3CVOA 3RREA 3OO0A 4WK0B 2BE7A 2F8MA 3LOPA 1S9HA 2R1VA 4JC5A 5DF1A 5AVZA 4QOEA 1D2EA 5JNSA 1GTG1 2Y4NA 1VPVA 2IDKA 3CR7A 3GT0A 4TKVB 4YRLA 5ICMA 2JGLA 4X9XA 1TYBE 1QFYA 2PG3A 4MVJF 2O59A 1U65A 5HFJA 4DF3A 4KK4A 3K8QA 4JI4B 4UEKA 4D1YA 1CD5A 3L49A 1W4ZA 2QPTA 3SQOA 2R3SA 2AKYA 1RPAA 1LC3A 3C14C 3RGWS 1GAXA 2YN2A 4Q1FA 4WZBB 4G4JA 3SIXA 5AVYA 2AFRA 3HJUA 2HV9A 4W99A 2F9MA 4HG2A 5C52B 2R8ZA 2VC2B 1AIPA 1KMQA 3HYTA 3KR2A 3LBFA 3ED5A 3QLUC 1WV0A 4FD3A 4UW9A 4BMZA 2M9MA 3T1QA 3TRHA 1EJBA 3EQ9A 4HTFA 1JP7A 1QV7A 4UD2A 2B94A 2XOKD 3O6VA 3WC4A 4D92A 4MYRA 1JI3A 2BFMA 4JLPA 1Z35A 4GRDA 3T54A 4E5VA 3N2GB 2ZI4A 2R85A 3RVKA 4H0NA 3CW9A 3D64A 3IAEA 1ZM3A 1IZ0A 2XWSA 1MB4A 3PDIA 1JR3D 4Y0AA 5EKUA 2CFIA 3L8EA 2QUKA 4HQKA 2GF9A 4LVUA 5F5NA 1P0CA 3MPUA 4Y2PA 2GPNA 2Q3DA 1MOZA 2JHCA 4J9UE 3T3HA 5MGNA 3OAAD 2Y1WA 3FHOA 3ZTWA 5B7NA 3GGDA 4HDMA 2BAGA 3M4ZA 4MI1A 1K7FB 1C2TA 3K6SB 3F6SA 1JFTA 3ZV4A 4JJ7A 2W6ID 1UOOA 4Y0VA 3VR5H 4J16C 1TMGE 1M8PA 1NSFA 3DL4A 4M21A 1BGXT 3HY6A 5BYBA 3TW0A 4JY7A 4M1KA 1N25A 3KT0A 4RMNA 2JVIA 1XLWA 2VHZA 3FUCA 1GCIA 5TT1A 4BQEA 2VTBA 1AGXA 1JPNA 1SUPA 3TIVA 1O5OA 1E1CB 4O4JB 2H85A 1AD2A 4JFAA 2EC5A 4CEIB 2LZ0A 2JASA 3LQFA 4R4JA 3USCS 1DIAA 3K9GA 3ESQA 4QFCA 1RZVA 4ZI5A 3SWWA 3QVXA 1H4VB 2ZJ3A 4FDMA 821PA 4GKVA 1A9SA 4FOOA 4PNPA 3GLHE 4PSVA 4RJTA 1OHHA 1WXXA 1OSNA 3CUVA 1D0VA 4GLOA 4KL8S 3SFZA 1IWBB 1POXA 1XTBA 4WK6A 3WL5A 4C7KA 1A9XB 2LIPA 3E9YA 3EZGA 4YP9A 5AK5A 3BAZA 2AN4A 2Y9PB 2CF6A 4Q37A 4TZTA 3GJ3A 3DZCA 2ZBGA 3EBPA 4Y6RA 1DFIA 1Q1GA 4Z2AA 3EXFB 3NTUA 3RKRA 4TWJA 1EEHA 3EGOA 3SR0A 1BVRA 2FRDC 3I92A 5TVGA 2VDRB 3EYWA 2FK7A 3PJGA 4L72A 1LVUA 3B2QA 1C3OA 1SVLA 2R11A 2EEZA 3DMFA 1DJLA 1KAQA 1UP7A 3LHIA 3WXBA 1OIXA 1G20E 2GERA 3E58A 4HYTA 5HA5A 4YREA 3VVBA 1R4MA 1NOJA 2QI9F 2WOOA 3NBMA 5FUVA 5JFTA 1BKDR 4OPMA 3C6KA 3CJQA 2Q3JA 2W2LA 3EF1A 2VPZA 2ZUFA 1W5BA 2MYTA 4DMGA 1SQ0A 4Z7OB 4G0ZA 4WBNB 2FPXA 4H3VA 2LXNA 4OLBA 2ECKA 2VATA 4PM4A 3OZVA 1I6KA 1NPTO 3F7OA 4UHKA 4BGVA 4EA8A 3IIJA 2CZGA 2Q6VA 3LBIA 1GLGA 1UM9B 1PHRA 5FPKA 1TKAA 1GL3A 3IDQA 3ITNA 4UUNA 2NPFA 5BSFA 1ZJYA 3WVNA 4CEIA 3CZAA 3AJ8A 2ZVDA 1YJ5A 2WPNA 1B4DA 3FFBA 1MABA 3IDSA 2XE4A 3KZNA 4GHWA 4PLFA 5JU6A 3DV0A 4I36A 3B12A 3UG7A 3SSNA 5LP6F 1PR4A 1MHTA 5JRZA 3IR5A 1ZUHA 1XZLA 3BWMA 2Q4BA 1ZG3A 2J7PA 3KLNA 2V98A 2ZPUA 4P98A 4ZO7A 1C5KA 3AI3A 4PNHA 2HMWA 3AEQA 1FXWF 1TM5E 4YYEA 1T1SA 4JGGA 4R2XA 4KIWA 3UA4A 3FOBA 4R0MA 1X1QA 3EEBA 2YWGA 3OPXA 1ZCAA 3G6WA 3THRA 1CHNA 2A9FA 4BC0A 4P4GA 4MS1A 4H59A 2XZOA 4INAA 4UTZA 5CP8A 2NNLD 3REQB 3GRFA 3K7EA 1OWOA 5FNVB 5JMWA 4BVAA 2FW8A 1CRQA 3NT2A 4HOYA 4OG2A 4OQZA 1W35A 4TSFD 4MV5A 1YJBA 4U39A 5EPUA 1DUSA 5AOBA 4N49A 4YRFA 4AMZA 1EUQA 1EZ4A 5DT9A 1W1IA 1YU9A 2J9GA 1V3TA 4KUGA 2H2WA 4ZYXA 1N92A 1Z2CA 1APBA 4YRDA 1XJCA 1H3FA 3T9AA 4ZICA 4NESA 2P4HX 1E2KA 4EGSA 1IG3A 3KOXA 1L7QA 3GRAA 2I3DA 1XA0A 1CE8A 2PZEA 2ZS8A 1FP7A 3WLRA 1SVWA 1SUCA 3WLTA 2WF5A 1N5LA 3A6GA 2IYQA 4UAVA 1E2GA 2A0WA 4H3KB 1T9AA 3RUFA 3STVA 4DQLA 4HNHA 2BEUA 3WK5A 3S99A 5IFLA 2W2KB 3U3XA 3IIIA 1B8NA 1E8MA 3L18A 4AMYA 2FHSA 3C7DB 1XK6A 2GLXA 5JDCC 4RTJA 4JXKA 3OOJA 3GK3A 2C2WA 4BXOB 3DCIA 1IBKB 2VPTA 3W8FA 2IX9A 3LS2A 4F3NA 3KAKA 4QIHA 4E6EA 3OX1A 4TRNA 3WXMA 4CF3A 2F1KA 3ES9A 3ND9A 1JE1A 3CFYA 1RRFA 2NO0A 2O1XA 3NWBA 3RIYA 4JN6B 3AVVA 4F3TA 2D7JA 1LSOA 1U8FO 2ISQA 2LRHA 4LJ6A 2IEAA 2KMLA 2ORED 3BX1A 5CVVA 1SC3A 5FYQA 2OCPA 3QXHA 3D7SA 4HP8A 3NHZA 3GEHA 5KTPA 4HUTA 3L7YA 5M34A 2ZRPA 4RABA 5LQDA 1N75A 3GJTA 2VAMA 1RXUA 2VNHA 4KBYA 4M9SA 3AXTA 4CGYA 4UTPA 2FE1A 4I19A 1HUQA 4XM0A 1VFNA 3QLTA 4D4JA 4EK9A 2VWPA 4JLAA 3IL2A 1LTHR 1ZHFA 2ZTMA 3BF7A 2XJ9A 1UBLS 2X2PA 2ZUDA 4FI3C 5GM1A 3SIRA 3TTWA 2OWDA 4O4LA 3V8BA 4DFDA 3WR5A 1ISPA 4JKOA 3E27A 5H9WA 3LYAA 4ENRA 3BFVA 4OA8A 4HAZA 2P9YA 3W78A 3KYCB 3ONEA 3ZY3A 3CUWA 3E15A 2HWYA 1E9DA 2JJMA 3QIAA 3TEJA 5CA0B 5M29A 2IPNA 2C9ZA 3MBKA 4JYMA 5D7NA 4AUNA 1P19A 4DJEC 4IIJB 3IGFA 2I0FA 4DXDA 4F56A 4BXOA 1J09A 1E6UA 3INNA 4JIGA 2JIDA 4C3OB 4GZ3A 3K92A 4TZ6A 2ZAIA 1X7DA 2Z2ZA 4MS4B 1DG1G 3WL7A 5FLEX 4UE3S 1XRMA 3TZEA 1T6BY 1NKSA 1XELA 2XA1A 1E59A 4HXGA 2FMKA 5THQA 4E03A 2IU4A 1U02A 3NVDA 3W90A 3NWJA 2A9JA 4RPKA 3OWHA 5FKJA 3HDHA 2BCGY 1YBAA 2QTLA 4HR7A 4C6HA 3BIJA 3NRCA 2QRLA 4Z51A 3HWSA 2PA3A 3GYBA 4HNVA 3TR6A 1IQUA 3UJ6A 3MFYA 4X3OA 1LWNA 5B6PA 3KYDB 1V4BA 4Q82A 5G2OA 3MWJA 3UTDA 1RRKA 5LQAA 4A2CA 4OLHA 2HCJB 2VDNB 2G1AA 2YS6A 1E0SA 4UDOA 4WK2B 2VDPB 2RGBA 4C1NA 4OQLA 5EGSA 1X38A 5F1KA 1J9EA 3AH8A 1T2CA 2NQTA 2CJWB 5CB6A 3DZ8A 1R18A 3AF3A 3U26A 5JS1A 5FOXA 3A10A 1TZJA 1T15A 3S2FA 2NAPA 3PL5A 1FTWA 3RRFA 2HMYB 3GN1A 4JNCA 1FYWA 4FGKA 4E09A 3RIMA 3UGKA 2YFKA 1LW7A 1QORA 1RI2A 2QXUA 5L95A 2BSAA 3B5JA 2UKDA 4BS9A 5HUQA 1DDGA 4YP5A 5KAMA 2C9CA 2WHXA 1VCNA 4LOAA 2BBWA 4ER7A 3IEIA 1O89A 4YAOA 5HMMA 2AN3A 3VZSA 1EWTA 4BNGA 3HGTA 3ZZ1A 1GTRA 3PEYA 1EP9A 2BBSA 3NVMB 3QQPA 4BNUA 1J8DA 3GAFA 2WIAA 3ROMA 1ID8A 1DWOA 1KERA 1IOLA 2HHJA 3IAFA 3TL2A 3INRA 4U3JA 1N33B 4JSYA 4O2BA 4EUSA 4FM9A 3S2UA 2CXRA 5FULA 5HJ5A 1G2IA 1QP7A 1ORIA 1U2SA 4QPZA 4OYLA 5C8VA 1N0HA 4CCYB 5KOHB 4RANA 4DCGA 4HX2A 4QDXA 5E0OA 4Z7NB 5JISA 4X3PA 4ARZA 1LX6A 3EUAA 1C7FA 2F43A 3GJ8A 2VP0A 1F2UA 2N3ZA 2GB4A 2PWPA 3CUKA 1N0WA 2Z2JA 1X77A 2QZSA 2JKZA 4Q48A 4TV8F 2VSNA 2KM1A 3JR7A 3DVAA 4HAXA 4ZC8A 5B2ZA 2GEJA 3LOUA 4BJHB 4IJKA 2MYUA 5EVCA 1P2SA 2PR2A 1SUEA 1WXIA 1KI7A 4IHQA 3FI0A 1JQ3A 1OWPA 1TCBA 2H5JA 3OLWA 3IVGA 3COZA 3GJZA 1Y98A 4UD6A 4BJ1A 2G0TA 2D7DA 4JH0A 1IE3A 3SYNA 1NM5A 1VA4A 5FOTA 4D79A 4N41A 2OL4A 2C0PA 4BB0A 1YF3A 3JAMA 4RIHA 3WHLA 3R9WA 3MSCA 1NR5A 1F17A 2PKYX 4PGFA 2PAAA 1QNLA 1VSVA 1WMSA 1RI1A 3H1EA 2OUIA 3AHFA 3OPYA 3PX2A 3LK6A 2FX3A 2XMBA 1EJ6A 2RH4A 3Q0EA 4JYCA 1FDOA 3L7IA 2X77A 3SM9A 4BZZA 2QMHA 4HQLA 2Z8ZA 4Y30A 2EBHX 4H7PA 1JEQA 1COWA 2X41A 3GRZA 1U63A 4RKEA 3EMVA 4I8DA 1KJ8A 1ZH0A 4PLYA 4XQEA 3SQLA 3WGMA 1I10A 3F5QA 5JSYA 5HJ7A 1LVHA 4B7UA 1KS9A 2O8DB 4DC0A 2J46A 3DE6X 5LYJA 4FFVA 3TOSA 1W48A 4EW6A 1JQEA 1PJTA 3A26A 3PFIA 4RLFA 2QRUA 5BNTA 4JUDX 3KL2A 3UTCA 3IYLW 5F9HA 3GGGA 5JATA 5AHOA 2XMPA 2X7XA 1TIPA 5HF9A 3AMVA 4KQEA 2D5IA 3WS7A 3U61B 1P5JA 3KPYA 3TO5A 1GZ5A 3N70A 2CHUA 2OKGA 4LQ4A 2WB4A 4GMGA 1L5LA 1T9KA 4BLWA 4E5NA 4E31A 2M32A 1KQFA 2QHXA 1HWYA 4YAFA 1BCSA 2X86A 1Z2OX 5JRJA 4TTPA 1EFRD 4H7JA 1K8QA 1K6XA 2Z8XA 3KETA 1K97A 2PLRA 3BD9A 2R7NA 4GF5A 2H7CA 3PDIB 2Z6AA 1CJVC 1SD1A 2IITA 5EJGA 2ISCA 1U0BB 3D7LA 5CFQA 3CBGA 3HDVA 3KFXA 3HZRA 1XAGA 4P83A 4KLAA 4NQZA 5JMTA 5KOYA 4Q9HA 3MHTA 3EYAA 1XL0A 3K2IA 1Z38A 2IS6A 4U2GA 3ZIDA 1GAWA 1SRQA 3TI7A 1ZJZA 1L4FA 3M4YA 5G1OA 2ODEA 1TXGA 2F3SA 4KXQA 2FQWA 5I5EA 1DXOA 1FSFA 2CJWA 3KZOA 2WJGA 4D74A 2Y4OA 1Y7LA 4GNRA 4JT9A 4JVSB 4OB6A 3OAAA 3QY0A 3A4VA 4TKLA 1ND5A 4PLPA 1HXHA 4I8XA 4X8LA 5ALJA 2ZSHA 3DM9B 5TMEA 4M6WB 1MPTA 2B36A 3DDOA 4REOA 3LCVB 2CNOA 1S0UA 4TT8A 1I4EB 1UWCA 2EP7A 4ICIA 4OJTA 5KWJA 1NRJB 3PBKA 3EXHC 2XVAA 4KDRA 4PCUA 4H1TA 1K3TA 4WZAB 2WABA 1M0SA 4AMBA 5HKAA 2WQ7A 3KEQA 8OHMA 2QRHA 2NACA 1MZPA 1J1UA 3HCOA 3LCRA 3EGXB 1N4DA 1M34B 3STYA 5BR8B 5FPQA 4EEXA 4ZTBA 2A33A 2D1YA 3ZDBA 1E1DA 2O48X 2A1UB 3HO8A 2RBGA 5L3SB 1R0SA 1ODFA 1FSZA 2EFGA 1LVGA 4PZDA 5ALDA 5LCXA 3W2IA 3ZK9A 5FFMA 1ZA2A 4HDKA 4JYPA 3ZCPA 1OH6A 4G1VA 4KSYA 3I9MA 2WF6A 5AQ1A 5JNUA 4YCCA 4ZRNA 2WYHA 5TVKA 1XX6A 3ROFA 3N8DA 5A03A 1QLJA 4UMDA 5EZ6B 1IZ8A 4W8HA 4EG1A 5KU7A 4US2R 3WLQA 4N0MA 2JCSA 3VUEA 4EUEA 2CB0A 1SHKA 3CGGA 4YRCA 3UH1A 2JFHA 3LMKA 5TJ9A 4FZ5A 1SIBE 5ALGA 3IBGA 2R25B 3LO5A 4KW7A 3ICOA 4CYMA 3O94A 4EAQA 4FYMA 2HBZA 3LW8A 1IDN1 2WWRA 4S24A 2QU7A 4XTCS 3U1TA 2XLCA 5JAOA 5FTWA 2G04A 3BZBA 3KSRA 2JCYA 3ELUA 1R00A 2AWNA 3NHJA 1UZUA 4S2UA 1TTQB 1OFTA 3NHUA 2IVFA 2H1WA 3MS2A 2IEIA 3WL4A 2C7PA 3FG9A 3FAZA 3RE1A 2G5PA 4R8RA 1CY0A 2MOKA 4FP9A 3DMPA 1C3XA 3WKDA 4EL0A 3H19A 1L5YA 1R8JA 1EE9A 1SBNE 2BD0A 2P4QA 3DVSX 3PNQA 4LMRA 4G1MB 3S7ZA 3W34A 4A6EA 3TLBA 2WA1A 1KHTA 5K0SA 2ACWA 2Y1LA 3ICVA 3MJDA 5EWJB 5A6SA 1JZQA 2VKTA 2GBIA 3BKXA 2XQFA 3BRQA 4U4AA 3LCMA 5EE1A 4LMAA 5J59A 4R6XA 2H1IA 4R9UC 4ESHA 1ZMXA 2QLJA 3QX8A 2NO9A 5FUXA 1SHTX 2PFGA 4HUQA 5GY7A 4KR7A 1JKJB 3HLTA 3DAPA 3PVZA 3T9DA 1JFSA 4TUYB 1T9DA 2B2XA 2WMYA 2ZBEA 3LQRA 1FP4A 1XZFA 2GOYA 1QO0D 2FWBA 2IF2A 4G5FA 4XB1A 2DP4E 3E2MA 1RWOA 3JD3A 1JLSA 4W5JA 1GUYA 3FNEA 5CX4A 3HWWA 3MIIA 5ECGC 4LRUA 4ZOCA 1CS0A 1VJCA 2G9QA 1ML4A 2WAMA 4PLCA 4LWOA 3ZCQA 4M0CA 3ZZUA 2UAGA 4Q18A 3D59A 3RYTC 2QA5A 1FK8A 4DB2A 5HOEA 2C83A 3LA6A 4DV5B 4B0OA 3ADBA 4MVYA 3V42A 3REFA 5HK8A 4ER3A 1GGEA 1MC8A 2H16A 2AUMA 2Y8EA 3FNFA 3LT0A 3JWIA 3M33A 4JJAA 1IPFA 2Q2QA 3CEAA 2BBOA 2VRWA 2J08A 4RMIA 2PUTA 3NCHA 1E64A 4IVPA 5EA2A 2UYCA 3SJ7A 4LHVA 5TJHA 4TLEA 2RJ3A 4I6GA 3D7NA 2BKAA 1Z26A 1V6AA 1M1NB 5EWLA 1E9VA 1G20A 3UUGA 3QJYA 1H1LB 3CSSA 1SR8A 1IXZA 1ISFA 1OV6A 2I8AA 2WWWA 3BSYA 2ZSAA 3W9BA 4CIXA 5U1PA 3WICA 4DCCA 1VIVA 4ROTA 3LRXA 1QM5A 3G0IA 3H4IA 2WU4A 4BQOA 1ODCA 5EKSA 2Q1YA 4C3UA 4JA2A 2O4UX 2UUCB 4O63O 4YK7A 4MI9A 3LF2A 1WWKA 4K05A 5KI6A 1R74A 1GAEO 2I2XB 3C43A 4TTQA 1RI4A 2Z6QA 4PZPA 5AP9A 3V4OA 2J3MA 1NU8A 1QF9A 1G5PA 1KTIA 2OAGA 5KVCA 4QOSA 2C1EA 2GJKA 1M76A 1U0HC 2R7MA 1O94D 3VHLB 4K81B 2WJWA 3KE8A 3A1SA 2JA1A 1QHNA 4DIKA 1TGYA 5BYKA 1J42A 1Z63A 4H2DA 1U4NA 4OQXA 3EEQA 3PFNA 2ZVPX 1YSCA 5DM0A 1QQ6A 4D2IA 4IP0A 4EA6A 4C2BA 4FINA 4HNUA 1PNOA 3UMMA 3KQLA 4MW2A 4WLOA 3RO7A 4KR0A 2Q7DA 3ZGXA 1VKOA 4CCSA 1TECE 1UC4B 1TTPB 2A5YB 2F8LA 5KU1A 2L19A 1M5UA 1IU9A 4IWYA 3CW8X 2W4MA 1BKYA 4RZQA 5JECA 4BFUA 3ED1A 3DOCA 4REQA 5BW6B 3SN6A 2D1QA 1R10A 2JI4A 4JEIA 4OJYA 4MIOA 5H9VA 1Q7GA 2Y71A 3IHKA 2ZTHA 3AQIA 3ZLVA 3EVDA 3LO8A 4BX3A 4BFLA 4GX0A 3KC2A 3L84A 1RXVA 4RZUA 4DOMA 1F2UB 2HMUA 4NMMA 5M3BA 2RHCA 1ZIXA 3Q11A 4IIJA 4U9IS 4MVJM 4DA6A 4EQ6B 1Y5IA 1NLYA 4AKIA 1NR1A 4J7XA 3UFXB 5ITZA 6Q21A 2GZAA 1QFSA 1UKEA 5HILA 2VPIA 2JA2A 3OO1A 4CG3A 1PNVA 4GYWA 4I3GA 1GY8A 4UDXX 2H1CA 3KDSE 3SC2A 5HF6A 5JCJD 3I9V6 2UXCB 3I34X 4MW9A 5LM3A 1IYZA 1X1DA 1ANKA 4UJ5A 3GJXC 4D3DA 2C8JA 1CYEA 3WGYA 1FDUA 2P40A 3F97A 4KO1S 1RWVA 3A6ZA 4DVGA 3KQHA 1L1RA 2FP3A 2OZKA 3C5EA 3S81A 2CV0A 2H6EA 4UTOA 2I54A 3IMKA 4YCAA 2I7TA 4UPEA 3HXOA 4R51A 4XVHA 4B6JA 3L06A 1ZMOA 3CVJA 3OIFA 1SBZA 3OQIA 3K09A 1WXDA 4UFNA 3Q0TA 3JSXA 1EDDA 1T5BA 3EH2A 2A0UA 3GLUA 1X80B 5FUMA 4D5GA 1Q0PA 4W5QA 2PMKA 4MVJE 4DTIA 4V3BA 3Q7QA 3FXAA 1SPXA 2XXBA 1W0CA 1VYTA 1RMYA 2RHLA 3LIPA 4LRQA 1NC3A 4D9GA 4LJAA 1Z6TA 1CHDA 3O7MA 4TZ0A 5E95A 4JR2A 1V3QE 3NYWA 1ND6A 2EVWX 5BMVF 3GCGA 1TZCA 2RAFA 1PEYA 1VL5A 3SIPA 3EXIA 2ZM6B 1EEXB 3GXOA 3LM8A 3RVLA 3GU3A 3EULA 5DIFA 3SLKA 5JYBA 4CL0A 1QGED 2VA9A 4I55F 1QHXA 1CQJA 1Q0SA 1VHDA 1JDNA 4Y6LA 3M6UA 5K3OA 3JD4A 5DCLA 4HEA1 7MDHA 2DTEA 4O1HA 1DQNA 1AA6A 3DPUA 1YASA 4UMFA 4FBMA 3E6AA 2P3LA 3SS8A 4GLLA 3PGVA 4QVIA 1KYVA 4RTRA 2OLEA 4U3JB 3C39A 3IUBA 4AX8A 1SU7A 5K3AA 2PLWA 3EXEB 4MI6A 2IXEA 2VTEA 4J7CA 3UBMA 3CE9A 2X5JO 3IX7A 4CTOA 1O6FA 4EKDA 2V6IA 2QPAA 4J03A 3M8KA 4B4VA 4HSGA 4KVZA 2R5WA 1MEJA 1MO4A 1P73A 1PT5A 1DX9A 1RQ7A 2BFEA 2JAQA 3DCNA 3EZYA 4OHFA 3S4YA 7REQA 5BUZA 2GK4A 3IHWA 3O2NA 3D3WB 4UAUA 1IN7A 3M4NA 2YV2A 4QDTA 3CZPA 3TW6A 4E21A 4KAFA 4ZCRA 3MGGA 3T94A 1JFFA 1HYQA 3AUTA 4XGRA 1IZ9A 2UZIR 3R9KA 5AKZA 3WHIA 4Z7QB 5K3EA 1E79A 2CL5A 2XYGA 5EJ2A 4EJSB 5ES4B 4JI2B 3THOA 1RJGA 4B4OA 3AETB 2JG3A 2PBFA 1VBKA 1A8UA 2ZZKA 1A8SA 4H17A 4QGAA 4XUDA 5DYWA 4ADSG 5IG2A 1EQ2A 3U09A 4DBLC 3VR6H 4URVR 3VZCA 2RCYA 4YAIA 2K7FA 4J91A 3EZ7A 5D6NA 1F8FA 4DQXA 3MD9A 1QRTA 5KQLA 4A36A 1E2PA 1QHEA 3MUEA 4L2IA 4N01A 3MN1A 2YHSA 4C4YA 4JX9A 3EOAI 1B1AA 1MTZA 3B7PA 3A6EA 2Z8YA 3EC2A 4NEQA 3LW7A 2EKQA 2CFRA 3GZ4A 1NVXQ 4MLPA 5DM60 1AB5A 1QH1B 3AINA 4P4TA 1RVV1 3D0KA 4MV7A 5LZ7A 2I6SA 5AM0A 3NTXA 3FVTA 3E4DA 1MLDA 3JQBA 1N9KA 3DQZA 3HB7A 3OP4A 4U2FA 3FJYA 3ESXA 4NWIA 5LXTA 3C6BA 4Z9YA 3ZBTA 2V6BA 4I4TB 2HL6A 3K5PA 1YHYA 1NJSA 4U7WA 4CM9A 1E9AA 3AU8A 1HFWA 3PR2B 5DKFA 2R00C 1KEUA 1Z74A 3PF8A 3ZKAA 4B6OA 1E2FA 1P5RA 3YASA 1LDNA 3GMDA 2WWVD 1RYDA 3H5OA 1KI9A 1W7AA 2JLVA 3ITDA 3ICPA 3WGUA 4NP6A 1NFFA 2O7RA 2IU0A 2ZU6A 1KJQA 4QDKA 4DIMA 1QH8A 2DBYA 3KKMA 3UCFA 1PJAA 5EJ8A 5F1YA 3ANNA 4PVDA 5DHSA 1FNDA 4AZ3B 2GBPA 2GCPA 4E5DA 5JJKA 1G8PA 2B7LA 2ZJ6A 4MUKA 1JBKA 1W4AA 4G56A 3ROKA 2HF9A 3EK2A 1XQYA 4IMIB 4RXMA 2P9FA 4B81A 2IH4A 1H2WA 2DECA 2VDWA 1Y5NA 2IBMA 3PWTA 2Z30A 2ZIXB 2ZR9A 1NLFA 4KE6A 5CUQA 1QZZA 3RT7A 4Y9TA 3LY9A 2YC4C 4BWVA 4MINA 2QW0X 1D2CA 5AI0A 2HF8A 3LKBA 5SY6A 5HVNA 3I62A 3RIHA 1UEJA 1EXMA 1PR1A 5JANA 2ZRFA 1M2KA 2HLHA 3P2KA 1F2TB 1DBRA 3NOVA 1FUYB 2FUEA 3UW1A 2GZRA 2H29A 3L8ZA 4LXXA 4ESEA 3TXAA 2C03A 2H4YA 1E9EA 1H42A 3BQNB 3H17A 4DEVA 4ZIRB 2Q3BA 3OTGA 5CVEA 1T2NA 4ZT3A 3F3KA 5CFLA 3O8QA 1HKHA 3P9CA 3COJA 1MV5A 3WLMA 4JXXA 1QRRA 4V0RA 4IZOA 1J06A 4JEMA 2H5IA 1QP8A 1TK3A 2XQKA 5D5QA 3TINA 1DRUA 5LR6A 1V6CA 2G4CA 2GJSA 1W9HA 2DPMA 2LCQA 1JXOA 4M7RA 5LU9A 2E6KA 3EXG1 3ZD7A 3OBIA 3T1VA 3GDOA 1CXZA 4RGVA 1AN0A 4TTRA 3VYWA 4BLPA 5CYFA 4BNDB 2NUTA 2BRUA 4EBBA 3FCAA 2PT6A 3IPRA 4IS3A 1AXEA 1Z0UA 2COEA 4M0PA 3UJDA 3AC0A 1R4MB 2Z1DA 1YQXA 4CV2A 3CF4G 4BRWA 5KQMA 3GRKA 4WL0A 1UBRS 1OJ7A 1V8DA 3B3JA 2HRBA 5COAA 2P6OA 4MR9A 5BRJA 3T9BA 2Z4TA 4FNAA 3U39A 4G81A 1W4CA 2Z2YA 2JDIA 1T9BA 3KPUA 3SYLA 5LN1A 2AYZA 2IP2A 1O96A 1UC8A 4IDFA 1H05A 1A9OA 2XE6A 3GARA 3IPYA 3RFXA 4M1ZA 3DMHA 3V34A 3OE7D 4BL5A 1D4OA 2JIPA 3MTQA 3V1NA 3UBTA 3Q6MA 3KOWA 2R47A 4JP3A 3QG5A 2M6SA 4F1WA 2K2WA 2MINB 3QKUA 5A3QA 3AVQA 4IUYA 3ZCUA 1FJXA 1X9IA 3AOEC 3VVCA 1DXHA 1UUFA 1RQLA 1L5WA 1F14A 1LBTA 1TK2A 2D54A 5J1TB 1R0RE 1JZTA 4PYLA 2D0OB 5FA5A 3CN9A 3GLVA 5AD1A 2XOEA 4A9AA 2O5CA 5FBLB 2BJWA 6LDHA 3DGFC 5ALYA 4OHYA 3FD8A 1IH8A 4RGBA 2RGXA 2QY9A 1E3SA 3ZPXA 5GJBA 3KT8A 3I9LA 4CR7A 3A2KA 1REQA 2VXBA 1CSEE 3MT8A 1EB9A 4P7JA 1JNXX 4RSHA 4KTTE 1HNZB 1GYQA 2X8LA 2Y0BA 5KWVA 1NV9A 1ZNQO 3W3AD 3HFGA 3L0SA 1G38A 3I6BA 2ARKA 3QWHA 4NULA 1HE4A 4QNNA 5F5XA 1BO6A 4QRHA 2DWUA 3ITKA 4XWWA 4LSGA 4R40A 1N2BA 1JEOA 3CJRA 4L22A 4R8SA 4D9MA 4QDZA 1QJ4A 1OJLA 5L7WA 5TMPA 4ZU1X 1X9HA 3N0VA 2Y1DA 4WACA 2BL4A 2KLHA 2NPOA 3MGCA 3IDFA 4LZAA 1M1XB 3NKLA 3PE6A 5HKBA 1Q1NA 3BQMB 3LECA 4MA4A 3VO9A 4MEAA 2EP8A 2EQAA 3RVQA 1B3RA 1PT6A 3QX9A 4S1TA 3UT5B 2IYRA 3H2ZA 3QE2A 5B6IA 2CV2A 4ZYVA 4DZRA 2NU6B 4JFRA 2GETA 4REMA 3K0KA 2C5FA 3PX3A 3N74A 4E46A 3G02A 3JRXA 2XCSB 1IULA 4JENA 1Z12A 2FSIA 4XDHA 2XUKA 2AG6A 2QV0A 4RXTA 4WTOA 4ZAZA 5LP6B 2ERYA 4PQEA 3FPSA 3ROEA 1JG2A 3W1EA 2OHVA 3OQBA 3CRVA 1MJGM 4MW0A 5U9CA 2I99A 2W6CX 2QLFA 3K35A 3JW8A 1QYRA 2QE7A 2I4LA 4OUDA 3RV3A 4AS2A 2P5SA 3O3MB 4ENVA 3V4VB 3UV6A 2UUOA 5EZYB 3ST7A 5CVTA 2BKLA 4KLRA 1ULTA 2GJAA 4P5EA 3AZOA 5IU6A 1K4YA 4KV9A 4K3VA 3I0NA 5CIWA 1SQ6A 2FPKA 4WOBA 3OF3A 1SGWA 5E4YA 1HLDA 1KEWA 2MSWA 1GTL1 2BBTA 2VRBA 2OOKA 3AL3A 3SZGA 5C8YB 2XKAA 1RPNA 1CQXA 1O95A 2XBUA 3CLRD 1RKUA 1AZLA 3DYBA 3QHQA 4LC0A 1Z5VA 4YUVA 4ZJPA 1Z4OA 3JQPA 1AQUA 1KEEB 1P61B 5JXHA 4ZMRA 1JJBA 5IABA 4L9AA 4BE4A 4GSLA 5KINB 1U81A 3FTCA 4DR1B 4GQAA 5JLAA 3GC6A 4KJZA 2AUNA 2V58A 3Q6NA 2JIBA 5SYNA 2CDRA 2V7PA 5EG5A 4OVKA 5REQB 2F7SA 2R48A 2VZLA 1IOWA 2OGTA 1CZUA 1QHYA 1Q0ZA 1M8KA 1C7IA 3FNHA 1UK8A 4JI5B 1AN9A 2ILVA 3KJNA 2XF8A 4H6WA 121PA 3UXEA 1J1IA 1IUNA 3LAWA 2Q21A 1H4TA 3PDUA 4GLFA 5JAPA 1RRVA 1SIUA 4IXNA 1B8VA 3CURA 1ECJA 4H77A 3JXEA 4PYKA 4Z0PA 2NU8B 3TPZA 3CF4A 1Q6YA 4ACAA 2NUTB 3KEGA 6NULA 1UWKA 1SU8A 3TVTA 3VZBA 4YMSA 2DY0A 4RM3A 4Y1RB 5DRTA 4NDZA 2NSJA 1UODA 1INLA 4FIDA 3T6KA 1E96A 3C98A 4KXNA 1UPXA 1EFRA 1DBIA 1IC6A 4I08A 2ZUVA 4A23A 4C08A 1H2EA 4X97A 3PQ4A 4AJ1A 1JLKA 2O7QA 1JJAA 3IODA 3PQDA 2JLUA 4UHBA 2BY4A 5FD8A 5AXBA 3T5TA 4M0UA 1ZLYA 2E9SA 1A5AB 1XDSA 4DKXA 2VJYA 4W5TA 4KRFA 3JQAB 1G17A 4CLOB 2BM8A 1GKUB 2VSOA 4MVJD 1PGPA 2R2AA 2P75A 2WIGA 4R7ZA 1R9GA 1QKKA 2YNMD 4YRZA 2QRKA 1LBQA 1UBHS 2X8JB 2XZDA 5D01A 4ZT7A 2A3NA 2Z8YM 1CQZA 3URKA 1CUJA 1XA3A 2CY0A 3ROPA 1TGVA 4J94A 4NBKA 4O8ZA 5SZJA 2OTCA 1VL2A 4K26A 1YZFA 3EJWA 4URZR 5JNLA 3ZV7A 1CR4A 2HA2A 5K3SA 3ZWDA 4HWKA 5EXSA 1FRVA 1MJFA 4U7HA 2CNKA 3QTTA 4GZ6A 3WOHA 4OHPA 3II6X 2UV8A 3UK0A 5HGJA 5CLHA 2BEJA 1QE5A 4QU0A 4DPLA 1GT91 3FWNA 4KPYA 1EU1A 2QR5A 2AJLI 5EXTA 1AX9A 1GTZA 1X42A 3PD7A 3EEOA 1OA1A 1QS0A 2XB8A 3FLMA 2P8JA 3NWPA 4MI3A 4Y6OA 2DE0X 4U8HA 1JQ5A 3HBJA 5CBPA 1CQIB 4FFLA 1NXOA 1VMDA 2AEJA 2DBVO 1Q0HA 2QYTA 1P8JA 4PX3A 4E08A 5FO0A 4RTOA 4RCZA 1B0PA 2W5UA 2YV3A 4BP3A 3TRKA 1JA0A 3EQ6A 5JH7A 3C5VA 3SZOA 5KPJA 4N8SA 3UPTA 1HK7A 1BCSB 3H2JA 2XCOA 4NCBA 4JL6A 1J25A 3S1AB 1JHPA 4IQ0A 3R7SA 2XB6A 4CLOA 1G19A 5HIJA 4WESA 5E6UB 3HUFA 4B47A 2ZXUA 3IP5A 1KBQA 2WF7A 3EBOA 3VAAA 1E1QD 3I6QA 3VSEA 1RS0A 3OPYI 1M33A 1P6XA 1QF6A 2ZUTA 3GRPA 3CUSA 3H16A 2QD1A 1II8B 1OWMA 4MDFA 4FT2A 2QBYB 1GPUA 2FSVC 1E3TA 2ZBDA 1YR3A 4RV5A 2EKBA 1G1AA 1RE0A 2Q5HA 2VDWB 4AJJA 3S8YA 3E7XA 3EXEA 4L5IA 3F6CA 3HA2A 4IAOA 1D7AA 4MWBA 3RANA 3ND8A 4UASA 2QX4A 1TYZA 4PBRA 4ZODA 3Q7IA 2WTNA 3HKEA 3JPWA 2A6PA 1PIWA 4NCHA 3OIWA 3Q9NA 5FFFA 1X7HA 4UPDA 4A6DA 2OYRA 1KFCB 1RHUA 3TSCA 5NLLA 1Q22A 1TZKA 2DYKA 4KC0A 4M4SA 4P3YA 4YDHB 2Z6VA 1PFGA 4UBLA 5G53C 4TYPA 2PVSA 1P7CA 1RZUA 3D3WA 4PQGA 5AKEA 4KP7A 1QFXA 2KBFA 2WV9A 1QU2A 2JIZD 1G16A 2AEMA 4AZSA 3U80A 2ZSDA 3UJ8A 1EWVA 4PPFA 1H93A 2YVAA 4HGRA 3AJEA 4IM7A 4P22A 4QUIA 4ZYLA 1YE3A 4UHJA 1YJQA 4DV0B 1NJ1A 2WMNB 3CPJB 1K9SA 3GFQA 2APJA 2CNWD 2ODAA 1PFUA 2QRPA 5FYDA 1IBMB 2SICE 4KQCA 1VMKA 5H7XA 1DBWA 3E5NA 1I7PA 2X76A 1CCWA 2JPDA 4QEKA 2Y3IA 3KB6A 3NXKA 1G9TA 4UTXA 5K7SA 3I01A 3OCVA 3KJXA 3QFCA 3VKVA 1TJPB 1AXRA 4GFDA 3OJWA 4LJSA 4ODIA 4MRMB 5TLSA 2ZZMA 5FWAA 2Z98A 4LZZA 1Q1EA 2ZJZA 3NIBA 3O0DA 3I6MA 3PFHA 4ON9A 2VNAA 3IAS6 2V0NA 3IDOA 4GOKA 3IPCA 3TFWA 1WOYA 1C80A 1FSGA 3NUZA 5SV2A 1YS6A 5L45A 1HT1E 2IFTA 2DJIA 4O1IA 3NNDA 3ZJUA 1DLIA 2GCNA 2P3QA 3H2IA 3F7TA 1TEHA 1AUPA 1CZRA 3TLGA 2XCTB 3QVGA 2PZGA 5EXPA 2AFIB 2XEXA 3NEAA 1V11B 2J59A 2PD6A 4X6XA 1AMOA 4IQFA 3H9EO 1E2BA 1PL6A 3R0QA 4D8TA 4JXZA 4BLVA 1ULBA 4Q3AA 4AL4A 4AY6A 1YUBA 1TEVA 1V1MB 2P69A 1D4AA 4RMGA 5AJZA 5GGXA 4TS3A 4RSGA 5DSTA 4K0RA 2I29A 1EE2A 4ZRMA 1PLJA 3A4IA 3H8VA 1XPJA 4M9ZA 2BWJA 5B7PA 1FNNA 2JAWA 2DWOA 2A7QA 2E37A 4CL8A 1Y4SA 3HP1A 5AJHA 3AP3A 2LDBA 3UA3A 2HNBA 5L4LA 1URPA 2PRKA 4PCVA 4OHXA 1BG6A 2D3TA 2ZSUA 5KYYA 1P4HA 3V8EA 2G83A 3FX2A 3W6UA 5HP4A 3SBOA 4GECA 4LIPD 4DSOA 4IXWA 2EERA 3K94A 3Q15C 1UBTS 4S1OA 1T0JB 2D59A 1GTVA 3LVRE 2XWQA 1Y63A 2C5BA 3OPQA 4NC9A 3VI4B 1N3IA 4GR4A 5A6VA 4B44A 2AQKA 1WKVA 2EW1A 1K66A 4AU1A 5HM8A 1TVKB 4G8DA 1Z18A 1D2HA 2VSQA 1JLLA 4HPWA 4J29A 4RUKA 2LBPA 4BCBA 4RY2A 5TPWA 2NVUB 3AY6A 3SYRA 3EQ7A 1QLHA 1I3OA 4G0UA 3HNRA 2BRUC 2WZBA 5ELXA 2OV3A 3E3OA 3WGTA 3GLIB 4QJ3A 1DIOB 5DYYA 1SWWA 1SO8A 5KIAA 3BIWA 3TSZA 1RAHA 5IUNC 1GCAA 5K0CA 1NUHA 1H6DA 5TS3A 2O2GA 2VHXA 4OEHA 3T3NA 3GJSA 2WG2A 4X7PA 1P0IA 3AB3A 4F6RB 3RVOA 1DT3A 3HB4X 5CK4A 1Y1QA 3GNTA 2O2IA 3W8NA 4RKQA 3N05A 3R3UA 1EP1B 2NW6A 4LHEA 4Y2UA 3GI1A 3JVIA 3L0DA 4JBYA 4RD1A 4AROA 1EUYA 2MHCA 2NX2A 4D4IA 1OFUA 4PHHA 2ZKLA 4S1VA 1CDOA 2X2OA 3GRYA 1G9XA 3C3PA 1J39A 1DAPA 1S8NA 3P9SA 4DDMA 4F9TA 2GKSA 1BA3A 1O58A 2A88A 3PPWA 2FUCA 2X4LA 4BFZA 2K7ZA 4FC7A 3L4BA 2VTBB 4B3TB 2RJOA 1ECCA 1RP7A 1XLTA 1TQHA 3WBKA 2J87A 3A1FA 1P7WA 3GFVA 2CVPA 4JBIA 1W34A 2CDNA 1U4SA 2A9OA 2WBLC 5FLXA 2VP9A 3OPYB 4NTZA 3I64A 4Q6BA 3TZHA 3WNVA 3INTA 1IN4A 2I71A 2AHOA 2ERXA 4NZZA 1CZNA 1U6KA 3Q12A 2A0YA 3IKJA 4TQAA 4Q9JA 1DC7A 1KMNA 1WPGA 2P9EA 4OLAA 3PQFA 1MDBA 4JKIA 4QOJA 1PS0A 1W2WB 3KSUA 4N1AA 4JI6B 3PIIA 4MB0A 4DMFA 1UJ2A 3ME5A 2G77B 4E5UA 1LUAA 2CWWA 4WN9B 1YUMA 4WKBA 3DKKA 5MHTA 1M2NA 2B98A 2WU3A 4PO1A 1K9VF 3S1SA 2YDYA 1PR6A 4UHFA 2NU8A 3I9KA 3C8HA 2XA9A 3EIHA 5DW0A 4FYVA 2QVBA 4YAWA 1WLSA 1ZGBA 3EVBA 4IV8A 3HG7A 5K8CA 3F1LA 4FEGA 4I9FA 1H6AA 1I7LA 3GLGE 4OFWA 4OHBA 2ZAGA 2R5FA 3KOMA 3LXXA 4M0KA 2H5EA 4GXTA 2XYPA 1A8IA 2O8FA 1CY7A 4B6SA 2D7CA 4MPDA 4RXUA 5KX5B 1KTVA 3UGQA 3TJMA 1E77A 4NL4H 3BVPA 5KYKA 2JEOA 5HFAA 3VHRA 1Z68A 1VG8A 2IOQA 5A4KA 2YV5A 5CDUA 5IHPA 1F8GA 3GLGA 2W11A 5K8UA 4MWCA 4HPXB 4PHFA 3PNKA 4RFSB 4TLDA 1AZTA 2WRZA 2B4YA 2HPVA 3T7JA 4DDUA 1YVPA 4AO8A 1GDTA 4R1PA 3L7LA 1QIFA 3AF4A 3OQHA 1VLHA 3CEPB 4WXPA 4LYAA 5I9TA 5DHRA 4WBSA 2OEPA 1AGPA 1PFKA 2UZAA 3TW4A 4PQRA 1IEVA 1RM5A 3GJ0A 5AW8A 2FB9A 2L0XA 1WLYA 4DJFC 3Q3HA 4EGFA 3KFVA 3O3OB 4J3FA 2HHHB 4NZPA 3O2JA 1U9IC 3BDAA 1UFKA 3OZSA 4XLTA 1I01A 1T0HB 2CGEA 4AM8A 4I9HA 5JJLA 4GXNA 2GF0A 4LYDA 1KETA 1MJNA 1HYBA 4TOIA 3UJ3X 5CDYA 4YRGA 3OQMA 1FNMA 1QZUA 2ZOSA 3LNTA 1YRYE 3D4NA 3KUKA 5B53A 5ER9A 1P17A 2BFFB 1U0JA 3ZD9A 1T1JA 2QVLA 2ZRAA 3K16A 1VL8A 3MAAC 5P21A 3ZHCA 4AWAA 1MFZA 4NS4A 4YMIA 2OXFA 3FZQA 3QJGA 1KSGA 3I30X 3LA8A 4JJ8A 4S2EA 3JRNA 5D3ZA 3TBKA 3VDRA 1FP1D 1HDOA 2AZ4A 4WJLA 1N2GA 2D1TA 2W2MA 4D81A 1T8PA 4B4UA 4GRAA 4EW2A 4LQDA 3TAHA 1B74A 4OAPA 1T5OA 2AGVA 2HIMA 3TE6A 1T4CB 2OG1A 5BT8A 1PGQA 4IVRA 1YH3A 1EJ2A 3A6JA 4NY1A 3RHTA 2A78A 3HFRA 1Z0DA 3JWHA 1L5QA 4MUNA 4HMOA 3QBDA 1N5JA 1XLVA 1V5WA 4I5EA 2M6LA 5KTSA 3PHIA 4KH1A 3GNLA 1BWPA 1UMKA 4KVGA 3WGZA 2J0EA 1IN6A 4WFKA 3PVCA 5DOZA 5F35A 3GH3A 4DA8A 4DNXA 1WIWA 2DSNA 4JJIA 1I4DD 5J2TA 2PGAA 1ZK2A 3U19A 4NV1A 3VR3D 4FONA 5IARA 1GUBA 4J3NA 1RIIA 2B7BA 2OZEA 4N0QA 3TB6A 3U5TA 5CX1A 2LIVA 1HZZC 4ZGBA 1AG9A 5GZ1A 1YRWA 1O87A 4J4HA 4YCLA 2HQ1A 5CDFE 5KNDH 5EHIA 2JJ8A 2O5RA 4DYHA 1XDUA 2JJQA 4BEJA 3THWA 4TV8B 3AM3A 1P2TA 3HM9A 3ZBPA 5J58A 4HXEB 4XCQA 2TMYA 1SHZA 3H0EA 5IJWA 2FSGA 4O29A 3V8PA 4EQZA 4OGGA 3ZV6A 1Z73A 4YCMA 2PGLA 5IHXA 4Z4FA 1CDEA 3GW8A 1O4VA 2E48A 2PCLA 3WNZA 1Q7BA 3I9V1 4O4LB 3P2YA 1IUPA 2JKVA 4OX9B 1FFWA 1XEXA 4PHTA 2QK4A 4JSTA 4NOKA 4KFRA 4HDCA 3HV2A 4UULA 3L4SO 3V46A 4EB6A 1HQYE 1OFHA 1W1UA 5BVHA 5K0GA 3MVEA 4UVDA 3ZUGA 2KI5A 4QU5A 3VZQA 1TUBB 4FS8A 3EA5A 5FWYB 1XCMA 1I24A 1SOAA 4XWTA 1LPSA 1QS0B 2FVXA 2HF7A 3IXQA 3ANYB 4MS3A 3UQYS 2GN1A 1ILEA 3O4FA 4R3WA 3MJTA 1H94A 1T2DA 1FDRA 2F3QA 4M8NE 3URMA 3VAYA 4TV9F 1QIDA 4EG6A 4EMSA 3EFHA 3E84A 3IKVA 5IKPA 2AXNA 1NN0A 3ANTA 5JVDB 4IGKA 5DWQA 3DEFA 3RQSA 1PJ2A 4W63A 1KI3A 3BB1A 3O4VA 5HR5A 3W9UA 3WLJA 1M7HA 3P2JA 4MMYB 4ZFNA 1T1RA 4X95A 4JV5B 2VP4A 4KGZA 3ZS9A 1USKA 4JBLA 5BR4A 1DOAA 4G23A 1ICEA 2VTDA 1G0OA 5AJVB 4G3XA 5DGHA 5FHRA 1K27A 5AW2A 1KAGA 5FL7A 5LKRA 4DAOA 5L3RA 4PR3A 3SJCA 1SVMA 1C2YA 3KB2A 1WD7A 4M76B 2HXGA 3PA6A 4OH1A 4NCKA 5H8WA 4CNBA 1KJNA 4E14A 3Q7TA 3KSAC 3S27A 4C5CA 2JK1A 4PC3A 1NE2A 1U2ZA 2FG7C 3D8TA 4IZ6A 5ERYA 1NBME 1UKCA 4X20B 2DETA 4X8HA 1D1PA 1RNLA 1BC5A 2BMDA 2HI0A 3DEZA 4O2RA 4URWR 3WLIA 2VEDA 3L6OO 1YJCA 1OXUA 4AULA 1UFVA 4R1NA 4IEIA 4H3SA 1EX7A 1KO5A 2XHZA 3GDHA 2HC9A 3R5XA 4MLCA 3UNXA 2O2JA 1XKXA 1Y1PA 3FMVA 3B1WA 1NUTA 5AVTA 1GG5A 4AX4A 4BN0A 1GNVA 1XTPA 2G9VA 3ZLJA 1BYUA 2DHDA 2ZJ0A 3VVMA 4F9EA 1D5WA 2Q9AA 5D51S 4RTPA 3D5QA 2ES4A 4MWGA 4FD2A 3SHVA 4ENTA 4ZQIA 3I01M 5AUPB 1IOVA 4IDAA 3RUDA 1DAFA 1PT7A 5CA0F 2XMDA 4BNXA 4YRMA 3R7NA 3IE2A 3PICA 4MUEA 3MMPA 1KY3A 5CDFA 3UH0A 4V24A 1LPNA 3WMEA 4I4IA 1SJ9A 1C9KA 2FPPB 2LKDA 3DLIA 3NV7A 4X54A 3PQ5A 3VJRA 1DARA 4LTNA 3K32A 4OY3A 2NP6A 2YW2A 2NU7B 4PG4A 2Q6KA 1BXGA 2VDKB 4F3RA 4LPSA 4RK5A 5HDQA 3D3EA 3F4BA 1ZJJA 5DNWA 1B8PA 1M66A 3IAM6 1OXVA 2VIIA 5EP1A 3W06A 1H8HA 1IZ7A 4B3GA 4JD5A 2X5OA 2PPLA 3HFSA 2ZRNA 5BUQA 4BYMA 3NIFB 3WJAA 5BOSB 1DGQA 3VTFA 4R2IA 3ONDA 2FPGA 2FLWA 3O92A 4F4CA 4A6XA 2YZ2A 1CY8A 3L8FA 3CN7A 2OC9A 3DAGA 3C3XA 2PQ2A 3QMMA 3T9CA 1II9A 4UOQA 1NQWA 1R9MA 1CULC 2E4VA 3WRVA 4N7MA 4AF8A 5FOQA 1N6LA 2GMWA 2BFAA 4N65A 1SVKA 1CZKA 3SC6A 5KOJA 3FE2A 1AQLA 1TCCA 4RLSA 5AVWA 2AFVA 1T2UA 2O6LA 4LOIA 3AHDA 2E4WA 4ZK6A 3OZWA 1ES9A 4QYIA 2GPWA 2IZ6A 4Q01A 3V48A 3OZRA 3DH0A 5AVVA 4KMOA 1LSUA 5G0UA 3DBIA 1YB4A 4F4UA 4PQYA 3VR1A 3PE3A 3O90A 2P9GA 2DTXA 4EFLA 3WI7A 4EG4A 4IHJA 3JALB 1VI2A 4GQBA 4WN9A 4FMCB 5JALA 4J9VA 3QBVA 3IIMA 1ENOA 3FNRA 4Q7LA 4JHXA 4XGQA 1ZZEA 1NVKA 3O9MA 4EGJA 3CVYA 2BMWA 3BWEA 2O0JA 4RV9A 5I4IA 3OEEA 4RKFA 4QVKA 4XYBA 1H0SA 1N0IA 3IOEA 3QPDA 1E0JA 2W2TA 3BXPA 3LT5A 3HJTA 3SX2A 3WYAA 4NOJA 2UYOA 5K8JB 4X92A 1UJ5A 4N5LA 3GT4A 3ZHYA 3GCXA 4ITVA 2AA3A 3B89A 1BS2A 2PMCA 3DNPA 3OCYA 2WAOA 1GQFA 1XU4A 5LU8A 3GY0A 3QPAA 1P8AA 3K9NA 1NBIA 3RBAA 3QKSB 3IIEA 4O02B 3L6DA 3O4IA 4PTLA 5JROA 4PZYA 3QSYA 2IPLA 3BGOS 4YDRA 2XODA 2Q7OE 3KYIB 1Y81A 3TLKA 2P9ZA 2A5LA 1EFHA 1O94A 3HGMA 4XWAA 2H07A 2VJKA 1U3DA 5JHGB 2ZUWA 3T1OA 3DA8A 1VE3A 3F7MA 3IHTA 3FPEA 2AT1A 5DGTA 5G4KB 3TX6A 3UMSA 4PG8A 1WCYA 4W7HA 1AXGA 1WNTA 4CI0B 5BV7A 5K99A 3L7CA 2QQ0A 4LE2A 1SB9A 1U8XX 3L0CA 5J23A 1IN5A 3IEKA 3CNOA 1UADA 3PPYA 1LPBB 2QMZA 3DLAA 1DX6A 3QPWA 3QRWA 4X7RA 2JC3A 4Q1EA 3SJAA 1X8KA 1YCFA 4WCVA 2CNNA 5DX0A 4AMVA 4RA6B 2RHBA 3KJZA 3BBLA 5UKDA 2VKQA 3R6LA 1CUSA 4KQ2A 3B51X 1BN6A 1QTIA 2HUNA 2I78A 1YL6A 2FX2A 4QU8A 3BJIC 3TQTA 4RMJA 5HS6A 1DUIA 2D4HA 4WBNF 1KMIY 5LC1A 4EH1A 2GGSA 1DCMA 2D06A 5KQSA 4FYIA 1EWKA 2X13A 3MTEA 5INTA 2BEWA 2GN6A 1VRCA 4B79A 1I4LD 2AVNA 2WJZB 4YP1A 1Z88A 4O0LA 4RPGA 3E3AA 3ESAA 2AJBA 4OKIA 4W8OA 1QGZA 1SU4A 1R5NA 2VHCA 3T7SA 4UZEA 1D04A 1ECBA 2H4WA 1RJFA 5H59A 1BMDA 1RHQA 2GO1A 1TL7C 2DY1A 4FVTA 2WIDA 3PUVA 1KS2A 4OM7A 4XVQA 4BRUA 4EECA 1E2IA 2X3UA 2VLBA 3QG1A 4TT3D 3TCXB 1X1BA 4H7FA 4KQIA 2ZUEA 3LWDA 2JHGA 4EZBA 3EMDA 4OHUA 5A5GA 1B0UA 3AHIA 5LWHA 2WJIA 1CW2B 1XD8A 5DBEX 2JBAA 5ALOA 2HDWA 2Q5QA 4V0LA 4NBUA 5CH5A 1LRKA 2J5XA 1VLVA 2HFJA 4X00A 2G1KA 3OU7A 3W1VA 5HM6A 4LQLA 1GADO 3D8NA 7GPBA 2EBFX 5FTMA 2IHKA 3THWB 1I94B 1T1IA 5J2UA 1RXYA 2X1HA 3G1TA 1MCZA 1NTOA 1XYGA 3MMNA 1N2CB 2D2VA 2O0LA 2A9QA 3LX4A 2CLMB 1E60A 4F85A 3MWDA 1LTKA 1XZMA 4JLWA 1L5HA 5L53A 3IUSA 3A9TA 3KR0A 1JLRA 1P2BA 5C7OO 4FYJA 4B33A 2W22A 3F5SA 4B8ZA 3LDUA 1QO0A 3ZE0B 2EWWA 3K2EA 1ZKDA 2AYXA 7REQB 1OIVA 5A62A 1BHO1 1GL7A 4RJKA 3WDKA 4IEFB 1F8XA 1I7NA 3A2LA 1OMOA 3L8DA 4IHJF 3UFXA 3WMXA 4DBLE 1OYYA 1GA1A 2VHUA 1L4HA 5CK5A 2KSQA 4WQMA 2C4UA 3U44B 1A95A 3N2GA 2GLUA 4HUJA 3G9UA 2Q2NA 2PAFA 2D5BA 1KOJA 5B1YA 4D3ZA 3H8JA 2ILTA 2O2DA 2E49A 1E7QA 4ZOLF 1NVVQ 1LV8A 4A8JB 1GKKA 1SXPA 4HWRA 2CXTA 4ZEMA 3ZWWA 3N0TA 1T29A 3RH0A 1NC1A 3NHYA 3NVAA 2P6NA 1DJNA 1C1DB 3CPEA 1AZSC 4G65A 3SXPA 2ZE6A 4EW1A 2DWCA 3MW8A 4YFYA 5I7RA 2P3OA 3NPAA 3FFWA 4AS1A 1P3JA 5F21A 1BMTA 2O4CA 4QYTA 2EFDB 3DOFA 4M7OA 1QF7A 4BP8A 2XEDA 4L76A 3VR3A 5JSUA 4S05A 1QG6A 2QVZX 4OQDA 3AUSA 2IS1A 1Y8ZA 2HJHA 2CBXA 3B6EA 4UNSA 5AOVA 4E13A 2H8KA 2ODWA 2PT7A 3BXFA 4NI5A 4YCDA 1DWUA 3K4HA 2B0JA 2EG5A 1HORA 2L17A 3E5RA 5EWMA 5B1DA 2IYAA 4L51A 1VXRA 1E5XA 4D7AA 5KTOA 2WT4A 2PKQO 3E22A 3VOTA 4LE0A 1XEAA 3DT6A 1UPBA 4AMUA 3H3JA 2I6FA 3ZY2A 3G0DA 3CR3C 4GBJA 2CLDX 4FB5A 3GUCA 1Y4AE 1QIMA 1Z47A 2D2FA 2IUFA 3LWZA 4RHTA 3R76A 2ZTLA 3U4DA 3ZHRA 5BQXA 1J21A 5BWBA 3LUAA 1E79D 4K9QA 4TN1A 1Z7YA 2YMMA 3DZIA 4RYDA 5IBPA 4EHJA 2OBFA 4YUYA 3UJNA 3ZWYA 3C3CA 3GGPA 4ZD6A 4AF7A 1NW9B 1G8AA 1U99A 3CZRA 4OGFA 3G2IA 2YOGA 1YS4A 1Z6QA 2RCNA 3SCZA 3WADA 3QP9A 3TECE 1N2CE 3DBLA 3H3FA 3HJAA 1U2QA 1D7OA 1XALA 1WXGA 2JZCA 1L8LA 2B5OA 3MJEA 4GOXA 4IDBA 5FAXA 4F0JA 3N1UA 3RFUA 2CL7X 1S4QA 2C0QA 5HGXA 4E30A 1DO2A 4BO2A 1KQPA 4QGBA 3OSZA 3Q1KA 4ONEA 3UG6A 4UNRA 3TEFA 5JV5A 5DNYB 2VQFB 1KDRA 1H9CA 3SEZA 4YT2A 1ZGGA 4W7IA 3RSOA 5J4VA 2HIHA 2ZRKA 2YIMA 4YASA 1FP6A 1VLQA 2YVLA 4B3BA 3LY5A 1Z4JA 1LJ8A 4NAVA 2FUG6 3CKMA 1OH7A 2CFTA 3CUUA 1SOUA 3ETEA 1Y9ZA 3TOVA 1YS9A 2IYVA 3HKDB 1KI6B 1GYRA 3WYCA 6ABPA 4NSNA 1OH5A 2P2YA 2RH9B 1J2EA 4UARA 1YDFA 4MR8A 3TLGB 1UMCB 1SPBS 1AS0A 2ECPA 5K0JA 3MUFA 1QZXA 4TV9A 4FSDA 4KWEA 3IJPA 2FP4A 3L04A 4PIPA 1TTTA 4IIHA 1UWLA 2W8ZA 3LLMA 3QXSA 3HEMA 2P0YA 3KOOA 2W71A 3IBSA 3ZXSA 3FRJA 4GP9A 3GP8A 1VJ0A 2GK7A 4ARVA 4PGHA 5FCDA 1CP2A 4C04A 1OXBB 1E3WB 2WSMA 3FDZB 2VHWA 3N76A 1A4XA 4BMPB 4CM1A 3ZZNA 2JIQA 1WBJB 4CMGA 1F1BA 1AMUA 4OYRA 4EI7A 4X7MA 2MJLA 3FETA 1G8HA 4II2A 4CMEC 4JROA 2FHPA 2VXYA 4P34A 5HIKA 5M7EA 1BU5A 2B9VA 2OD9A 3PXXA 3QEKA 1ORHA 3DEIA 3OLZA 3PXBA 4LOKA 4Y98A 4BV9A 2H06A 3CX4A 3K9BA 2CLHB 1YQGA 2P27A 3P0RA 3PB3A 1SUAA 5JS8A 5IM4F 2AL7A 4JBGA 2WYOA 1Y4DE 3P4XA 4V3CA 2VEOA 1NQTA 1RYMA 1VSQA 3I1YA 1HURA 4KIUA 1BMQA 1SK8A 2BGIA 2VP2A 1VE1A 4QRDA 3OCWA 4TL6A 4W6QA 5AI8A 1QAMA 1J2RA 3AOEA 1IHPA 2NV2B 1CUEA 2DFVA 1W0JD 3EVGA 4UDNA 5F98A 3GP3A 3MB5A 4EP1A 1C3OB 2F1RA 1PI3A 3D31A 3DUFB 3I2JA 3OEED 4I1PA 4NYIQ 1JYFA 4DYVA 4KIFA 2H2AA 2Q62A 5CNJA 1V8OA 4LVNA 3OC6A 5EIBD 1XA4A 1V8ZA 3TPFA 3D8RA 4I2VA 5KJFA 4MA0A 2VQ3A 2H4HA 3BL6A 4PZLA 2HMAA 4UTVA 4CMBA 1C8VB 1L4EA 1YFKA 2HK6A 4PGGA 4DXHA 2CXQA 2Z4RA 3EHEA 4M9UA 1P77A 2EJVA 3AR3A 1LX7A 1QZ3A 4DLTA 1S2LA 1MJ5A 2OBXA 2X14A 3HWRA 3UHAA 2P1DA 1V4VA 4IUDS 3WDSA 4KXMA 1I13A 4CF5A 2Z6UA 1LBIA 2B3TA 2XDWA 3NPMA 3TNDA 4BPRA 4RHEA 1PWHA 4TMYA 2YC2C 2JFZA 5CNKA 4LI0A 4C4PA 3ZI7A 2GXSA 1OI4A 1XTKA 5COQA 3VU8A 1I30A 4JAVC 1PZFA 2HRCA 1ODJA 5DLQC 1XT6A 2VSXA 3GRUA 4JEHA 1LBHA 4C4XA 5F2EA 3JD1A 3ZCXA 1LLUA 1I7SB 3PGA1 4KK3A 5JG7A 5FBWB 4HS4A 3IAXA 3WGJA 5LYJF 3QM1A 1C4WA 4L8LA 3I5AA 4EGAA 2CCJA</