2AOTB

Histamine methyltransferase complexed with the antihistamine drug diphenhydramine
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
288
structure length
286
Chain Sequence
MRSLFSDHGKYVESFRRFLNHSTEHQCMQEFMDKKLPGIIGRIGDTKSEIKILSIGGGAGEIDLQILSKVQAQYPGVINNEVVEPSAEQIAKYKELVAKTSNLENVKFAWHKETSSEYQSRMLEKKELQKWDFIHMIQMLYYVKDIPATLKFFHSLLGTNAKMLIIVVSGSSGWDKLWKKYGSRFPQDDLCQYITSDDLTQMLDNLGLKYECYDLLSTMDISDCFIDGNENGDLLWDFLTETNFNATAPPDLRAELGKDLQEPEFSAKKEGKVLFNNTLSFIVIEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histamine N-methyltransferase
publication title Structural basis for inhibition of histamine N-methyltransferase by diverse drugs
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 105
structure length 286
sequence length 288
ec nomenclature ec 2.1.1.8: Histamine N-methyltransferase.
pdb deposition date 2005-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13489 Methyltransf_23 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2aotB00
3DTNA 3GNLA 3QOXA 5EEGA 2ADMA 3B7PA 1ZHFA 3F4KA 1R00A 3DLIA 5FA5A 4YV0A 3BGDA 1SUSA 4FSDA 1RJEA 4GUAA 4HGYA 3MTIA 2IFTA 3ELUA 3GJYA 4KDCA 1ZKDA 2OB1A 4C07A 5E2BA 5KQSA 4RTPA 2IH5A 1VL5A 3C3PA 3LKDA 4P7FA 4QVGA 4QVKA 4FT4A 2B9EA 1EAMA 5JUWA 4E31A 2ZZNA 3FUVA 3C6KA 3M6XA 2ESRA 3UA3A 3X0DA 4DQ0A 2IH2A 2JH8A 3G5LA 3OZRA 4BLVA 1M0EA 1QAOA 2O0LA 5C1IA 3HCEA 3NW9A 1JR4A 3TKYA 3E8SA 1P1CA 1JG1A 2NXEA 4YUYA 2O06A 4R6WA 3DULA 3LL7A 1F3LA 3K6RA 4BLUA 4PYKA 5KVAA 2HNKA 1MHTA 1EJ6A 5G02A 3ANXA 4P58A 2GAFA 2EJUA 2NXNA 2AOVA 5MHTA 4GOOD 3TM5A 2O07A 3EVGA 4C04A 4NECA 4IV8A 1DUSA 2VZ9A 3R9XB 2P3OA 4QPPA 4KWCA 4LWOA 5EC8A 3LHDA 4Y30A 4DA4A 3OU2A 1VPTA 3DMGA 5EOVA 1PJZA 4C08A 1VE3A 3NDIA 3GRRA 5HIKA 4PYLA 5HOQA 4BY9E 4RYLA 1L9KA 2WA1A 2ZIEA 2FYTA 4DCGA 5FADA 5EMKA 3EMDA 3KPWA 3OU6A 5E1DA 1YZ3A 2XYVA 3UFBA 4GC9A 3I58A 3MB5A 2G70A 4C05A 3GRYA 3TFWA 4OQEA 5DX1A 4FP9A 4C06A 2P3QA 4E70A 4YUVA 3HCCA 3A25A 4E30A 4GBED 5U4XA 3HVJA 5K8VA 5E9QA 2IGTA 1FJXA 5B1SA 2JJQA 5FQNA 4KIFA 3SM3A 3FPEA 3PS9A 1O54A 3SMQA 5F2OA 4KIGA 1QZZA 3UJBA 2UZ4A 3D2LA 5C9ZA 2DULA 3G2QA 3GGDA 3O4FA 5DSTA 4ER0A 4RV9A 1M6YA 4BLWA 2ZZMA 1INLA 3S68A 2ZZKA 4OQDA 1I9GA 2AN3A 2H1RA 1P91A 3R6TA 4V0RA 2ZSUA 2ZIGA 3HCFA 3FYDA 4QDJA 3MAGA 3E7PA 2IBTA 2ZCJA 2CMGA 2NYUA 2AZTA 3H2BA 4XUDA 3FRIA 1YFLA 1NBIA 1RJDA 2PX5A 3GRUA 3SGLA 3TR6A 4RTRA 1X1BA 5DM1A 3LBYA 1NW5A 2YX1A 3O7WA 1JTEA 2F8LA 7MHTA 5EGSA 2UYHA 2I6GA 1RJGA 2OKCA 5BW5A 3LDFA 3ORHA 3MERA 1IY9A 2VDWA 4FS8A 1QAMA 4PCAA 1D2HA 2PWPA 5JR3A 2OPBA 3KPYA 2AOUA 1EIZA 3P2EA 4DCMA 4QQKA 2CWWA 3EVZA 3LSTA 1L3BA 4CTJA 4PYQA 2PKWA 1IXKA 4KRGA 4R8RA 2JHCA 2PVCA 3DXZA 1HMYA 2XYQA 3R24A 3FTEA 3TPZA 2PX8A 3B3FA 2I62A 2C7OA 1D2GA 3BWYA 4FGZA 5EG5A 1FPQA 3M4XA 5CVUA 4RTLA 5BW4A 2ZBQA 3A26A 5DTRA 5FHRA 4EMSA 4KVZA 2P40A 3KQMA 4U7TB 3EGEA 3U81A 10MHA 4OBXA 2G72A 2JH9A 4R05A 4XUEA 2WA2A 5EZQA 3CC8A 3FUXA 4CWAA 5LSAA 3AXTA 1X1DA 4YMHA 5K0GA 2Z6UA 1NE2A 4RTSA 5LQJA 3I53A 3TOSA 3FRHA 2G1PA 2O57A 3MGGA 5EHGA 3LCVB 4QTTB 2UYOA 3CBGA 1R74A 4FZVA 5K0LA 3MTEA 3Q87B 1G60A 2AOTB 3DXYA 4GOLD 4QDKA 5CVEA 1WXXA 2VDUE 3HVHA 5CM2Z 3DLCA 4JXJA 4X41A 4CKEA 2XYRA 1MJFA 5BP7A 3KR2A 5E9JA 1NW3A 1AF7A 4PIPA 1EJ0A 1EG2A 1H1DA 2R6ZA 4DM3A 1NKVA 2XVAA 4FT2A 2PGXA 2R3SA 3TMAA 1JG3A 2P8JA 1ORIA 3LCUA 4L7VA 3REOA 5LQUA 3GRVA 3ER9A 1KYWA 3HVIA 3UJAA 3PT9A 1AQJA 3BKWA 2H00A 2ORED 3P9KA 5DTQA 4PYIA 3GDHA 1RI3A 1Y8CA 3L8DA 4UOEA 1KPIA 4RTNA 3DH0A 5T6BA 5CCBA 4EKIA 1YB2A 3FPJA 5EMLA 5DM4A 2HR1A 1L1EA 3KPJA 3KQSA 5ICEA 4HTFA 3UJ7A 4A6DA 3Q7EA 3VC2A 1WS6A 3C6MA 3RIEA 1FP1D 3MHTA 4Y2HA 2P3LA 2OXTA 2JHPA 5D1NA 3OFKA 4WXHA 2ZW9A 3UWPA 2JG3A 2PLWA 3P2KA 1V39A 5GOZA 5DTMA 3NDJA 3FTDA 2GA9A 3K0BA 1TW2A 4GQBA 5HIIA 3EVAA 3UJ8A 2Q41A 3BXOA 1PRYA 3BGIA 3EVBA 5GM2A 3HCAA 1DCTA 2WK1A 3BT7A 2OYRA 4FR0A 1F38A 3I5UA 5DX0A 1XDUA 3KR9A 2AOTA 1WG8A 2IP2A 1SKMA 5CD1A 3NVMB 4RVHA 3PFGA 5EHIA 3HTXA 4AZVA 1NW7A 3DMHA 2QY6A 2P35A 4E2YA 1EQAA 3C0KA 4CTKA 3FTFA 2B3TA 5FTWA 1XXLA 2C7QA 3KQWA 5LR6A 4GOMD 2ZBPA 1NW6A 1KXZA 2B78A 3KQPA 1NT2A 3ELDA 5H02A 3LDGA 5GIOE 3KPVA 2FPOA 4RX1A 5K01A 4H0NA 5K0EA 2YXLA 1UIRA 5E8RA 4PYJA 4MHTA 2IBSA 1XCLA 4M7RA 3IV6A 5DRYA 3BKXA 5E9WA 2C7RA 3OPNA 1I4WA 3EVCA 1M6EX 3LBFA 5HFJA 3QOWA 2HMYB 1SUIA 9MHTA 4G56A 2HTEA 4AUKA 4YUXA 1R18A 1JG4A 3A7EA 1R8YA 4GF5A 3NTVA 3P9NA 5GINE 2PXAA 4RVGA 1FBNA 1JSXA 5EIWA 5DX8A 2PSSA 3AJDA 1X1AA 3EGIA 4QPNA 2FK7A 3TQSA 3LDUA 1RI2A 4B17A 2ZBRA 3CJTA 2ZULA 2BR3A 1N7IA 4DMGA 1VP3A 1XDZA 3P9CA 5HZMA 2EJTA 1OR8A 3AXSA 4RVFA 5K0NA 2AS0A 2GLUA 3HP7A 4X1OA 4X63A 3G2MA 5FQOA 2ONYA 5FWDA 5C0OE 2PX4A 5DT2A 5K0CA 2BR4A 1BKYA 1RI5A 2B25A 2I7CA 3A7DA 3GCZA 1NV8A 3PVCA 4AZSA 3DOUA 2NXCA 2PXXA 1HNNA 3FYCA 3R3HA 4FSXA 4OA5A 5E1BA 5KYGA 2PX2A 5KQRA 2QRVB 3C3YA 3JWIA 3BWCA 3GWZA 3CVOA 2PY6A 3OZSA 2OBFA 2GB4A 4HC4A 3KKZA 2PWYA 4V0QA 4LECA 1JQ3A 5LQAA 4YUWA 5EKXA 5D1HA 1WZNA 5FWAA 2IDKA 5DM0A 1KP9A 1N2XA 1RI1A 1VBFA 4RVDA 5EMMA 4MIKA 3IEIA 3HA5A 5KS2A 3M6WA 3FPFA 2XBMA 1IM8A 4CKCA 1G6Q1 4ISCA 4E2ZA 5EKUA 3UJ6A 1JSZA 3SXJA 3PX3A 3SSOA 3I64A 2P7HA 3EMBA 3ID6C 5ICGA 3CJQA 4M38A 2YUIA 3G2OA 3GO4A 1NBHA 3I9FA 3OE4A 4P7KA 4E32A 3EVFA 2IDJA 3FPGA 3P71T 2NP7A 4F86A 5CIYA 2Z6QA 5GP1A 3FUWA 2NP6A 2A14A 5E8JA 4ER3A 4POOA 1JTFA 2N47A 3P8ZA 3M6VA 1UFKA 5EZSA 5DPMA 3TRKA 4DF3A 2Z6AA 2ERCA 2BZGA 3M6UA 5GIPE 3DR5A 4C4AA 1DL5A 5K0FA 1G8SA 5CVVA 1G8AA 2I9KA 2JHAA 2XVMA 2QE6A 4PWYA 3IHTA 3O31A 4LWPA 5CVDA 1XVAA 5FA8A 4OX9Y 5LQNA 3HEMA 4HH4A 4KW7A 3FUTA 3FTCA 3HCDA 4IV0A 3PB3A 5ERGB 4BP3A 4GOND 1KYZA 1G38A 4RWZA 3UA4A 3VSEA 3CKKA 3PTAA 2P1DA 3PLAE 3UJDA 2AOWA 1BC5A 4XCXA 5DXAA 3EEOA 3ELYA 5CCXA 5K05A 4PYMA 1NW8A 5DLYA 2FHPA 4ER5A 2ZWVA 4OA8A 5F2KA 2V7EA 1JQDA 2Y1WA 3CCFA 4Z2YA 4MWZA 5DXJA 4C03A 1QANA 1WXWA 4HSGA 4P7GA 3NWBA 1VLMA 4PCLA 1Q0SA 3JWHA 2AVNA 2P41A 3DUWA 5CUQA 4DKJA 4EVIA 5F2NA 2PXCA 3EPPA 4IWNA 2UYQA 3B5IA 1SQFA 2GS9A 3JWGA 5FHQA 1XCJA 1KHHA 2YXDA 4E2WA 2PV0A 2YVLA 5HIJA 5GM1A 4DZRA 4P7JA 1QYRA 3HCBA 1XJ5A 5IH3A 2OO3A 2PJDA 3LECA 2NNWB 1YF3A 3NWEA 2AOXA 3LGAA 5E2AA 3T0IA 4AX8A 2BH2A 2CL5A 4X60A 2FK8A 4MTLA 4QQNA 5DSXA 1ZGJA 3OFJA 3OU7A 3TKAA 3V97A 3HA7A 1ZGAA 2BM9A 1B42A 2QYOA 5E1MA 4ATNA 1AQIA 2VDVE 3THRA 1AV6A 4A6EA 3FUUA 3G8AA 4EQZA 3M33A 2EFJA 2Y1XA 3EEYA 4K6MA 4PGHA 3UJCA 1BOOA 2FCAA 5EPEA 5LQCA 2ZTHA 5CVJA 4PGGA 3GXOA 3B3GA 5HIMA 4OBWA 2UYCA 3G5TA 3MCZA 1XTPA 1RJFA 4RTJA 5K09A 3NMUF 3NVKI 3GIWA 3SVZA 4HGZA 1G55A 2OY0A 1JG2A 4HG2A 4PONA 3FPHA 5DM2A 3SR4A 4RTMA 3A4TA 3V8VA 1R8XA 3G7UA 4MQ4A 4F85A 4YMGA 2PBFA 3IYLW 1BHJA 1L3CA 3DXXA 4LG1A 3LPMA 1KIAA 1N7JA 2O05A 1KPHA 2VP3A 4HRAA 3JWJA 2AOUB 3HNRA 1TW3A 2ZWAA 2GPYA 4KDRA 5FULA 3VYWA 4EKGA 5ICCA 1D2CA 5EIFA 2CKDA 2EG5A 4PINA 2ZVJA 2PT9A 3BZBA 3ELWA 3UJ9A 1ORHA 3G88A 1X1CA 3HM2A 3MQ2A 3B3JA 3G8BA 5DWQA 1R6AA 3DP7A 4O29A 3KHKA 2HV9A 2VS1A 2AN5A 3E05A 3VC1A 4ER7A 1ZG3A 2YQZA 5K03A 1KR5A 1SVUA 3SX0A 3UBTA 1FP2A 1YZHA 2BM8A 2G71A 2NXJA 3LCCA 4QTUB 4ZTBA 4AZWA 2B2CA 4F84A 4YUZA 3KQYA 3G89A 3P9IA 4PYOA 3CGGA 5FCDA 1RI4A 2H11A 2ONZA 4PNEA 3EVEA 4WVLA 5K0JA 1Z3CA 5P8WA 2E5WA 3AY0A 2OB2A 1I1NA 1JQEA 3HVKA 2AVDA 3GRZA 3BWMA 1SG9A 2IIPA 3BWBA 3AWIA 3KQVA 3KR0A 3P97A 3A27A 3QV2A 4XUCA 3UZUA 3DMFA 4CKBA 5LQKA 1VP9A 1P39A 3KQTA 1TPYA 1ZQ9A 5EVJA 2V74B 4R8SA 2LD4A 2OZVA 4IKPA 4RTQA 1NV9A 4RTKA 1O9GA 4E33A 3ME5A 3HA3A 3THSA 4AZTA 1UWVA 3KQOA 3PX2A 4X61A 3WSTA 4CXMA 2KW5A 4M36A 1U2ZA 4RSRA 3CJRA 3FZGA 3GU3A 3E23A 3LX6A 2ZFUA 3PFHA 3EVDA 4U7PB 5T64A 4BP1A 4GC5A 3BUSA 2YXEA 2G8NA 2P7IA 2ZIFA 2CMHA 2QM3A 3LKZA 3KPUA 3KU1A 5EMJA 3T7SA 2DPMA 2IH4A 3KR1A 3OZTA 4PYNA 3TLJA 2AR0A 3M70A 5BXYA 1VQ1A 5M5BA 3ERCA 2BR5A 4RTOA 3OCJA 3T7RA 1KPGA 4GEKA 3BGVA 3KQQA 4E2XA 1T43A 4PIMA 3RW9A 2EX4A 3OE5A 3P2IA 5EQJB 4YV1A 1Q0TA 1QAQA 3MCTA 5FUBA 5LQRA 3ER8A 3T7TA 4HTFB 5DRTA 5T67A 4ER6A 5HEKA 2ZLBA 1SQGA 5ICFA 4R6XA 2QRVA 2HWKA 2YTZA 2C7PA 3G2PA 3EGVA 1YFJA 3NJRA 5K0BA 2PT6A 3SSNA 4YV2A 2AN4A 1WY7A 1XDSA 1VIDA 4EK9A 5E1OA 2FRXA 3SSMA 2GH1A 1P1BA 4M37A 5IKMA 8MHTA 5EEHA 2K4MA 3R0QA 5GWXA 5HILA 3RODA 3TM4A 1X19A 2YR0A 1O9HA 1YUBA 2IPXA 1L3IA 3B89A
chains in the Genus database with same CATH superfamily
3RFCA 3GNLA 1I2CA 2PD6A 3BIFA 1MR3F 4C3ZA 3F4KA 4LYAA 1FQKA 4DDKA 2ZJAA 4NE2A 4Q34A 1G21E 1XN4A 1FXSA 4BKMA 3GEHA 1YIAA 2A9QA 3UV6A 4LXXA 3CLVA 4HZGA 2WF7A 4V38A 3ROMA 1KMHA 1YXMA 1QV9A 4UVEA 1T1IA 1VL5A 1ZW6A 3MJSA 4YCJA 5BN4B 4EFMA 3C5CA 3S2YA 2XCRB 4TQGA 4D3DA 1PTJC 2AJTA 4KX5A 4URYR 1U7XA 5IEBA 1Y3FE 3LBAA 3C6KA 1NQUA 4GMFA 3T41A 3SHFA 4YRAA 2RHBA 5G2OA 5JS7A 1BXRB 3VU8A 1M5TA 2ZQ5A 2VJCA 4XR9A 1JR4A 2EP7A 3FSJX 3SLRA 5HM8A 1FFYA 1G5HA 3IDSA 3GAZA 2FWPA 3R40A 4Y7CA 5BMVA 721PA 1X70A 2ZE7A 2RBGA 4MVJD 1KYYA 1SELA 2PR2A 4XIIA 4PYKA 4WZAB 5BWMA 3DMTA 5DGIA 3CPHA 4WEOA 4QFMA 4IHJB 4NH0A 1T29A 2WYHA 3EZLA 4TS9A 4U9IS 3Q7QA 5MHTA 3EAQA 4Z54A 4KXLA 2F48A 3JPYA 5ELLA 1P18A 3PFNA 4DEVA 3DMGA 1KO8A 3K0CC 1E3SA 5EOVA 2C4KA 4UUMA 3RASA 2C8KA 4CZ2A 3NOXA 1W8IA 3L8GA 3RS3A 1CEEA 3D4NA 5JS2A 4S1VA 5KMGA 2YYAA 4RYLA 1KWKA 5EHNA 4AKGA 5I5EA 1K9VF 2A0WA 1C3OA 1P44A 1U5BB 2IEGA 2VYFA 3DEZA 3FW1A 3L0BA 2C94A 2Y1DA 4GWLA 5DI9A 2O19A 5A6SA 3IBTA 5DHSA 3AKCA 2FEWB 2WJVA 1PUJA 5EE0A 2JI7A 5TQ0B 5D5HA 1P73A 3SJCA 3U7HB 3HXOA 2P3QA 1QQ7A 5C5IA 1UOEA 2DWUA 1OX4B 3O6VA 2REBA 3TIIA 4R9VA 2FOIA 1P4AA 4GBED 1FS5A 4M9ZA 4E30A 4YCSA 1WUHS 4GPEA 2PCLA 2E0IA 3F9IA 3LY8A 3SMQA 4I1RA 2VSYA 1IBRA 1WVMA 1WW2A 4XFKA 1GAEO 5HCNA 5KJCA 4RMGA 1ONSA 3LRPA 5JSKA 2F90A 4CMGA 2ZZMA 2OGZA 3K6KA 5JCPA 4IXMA 1CUAA 2XMZA 5HJ5A 2G36A 4EFKA 2GZDA 2YFQA 3FIUA 4QSMA 4JP1A 5AYVA 1J00A 4IJ6A 3RSQA 1U3FA 1Y80A 1JDUA 2CVZA 1MCZA 2JI8A 1C0EA 3LUFA 3E7PA 4GI1A 4LCJA 3WWCA 1HH4A 3PHLA 2H4WA 3WB0A 1IULA 4N7RA 1A71A 4L78A 4HGPA 3ICCA 5I8ZA 4D8YA 2GVZC 1J39A 3HNOA 1KYQA 5DM1A 5JAUA 2W11A 3HN7A 3A31A 2NTVA 4YDHB 1EESA 2W5UA 1KQGA 4Y1FA 4CFSA 1CJSA 1SIUA 1U7ZA 3D7MA 4FS8A 3RUHA 4DVJA 1Y81A 2CF6A 4FNGA 2OYCA 1D2HA 2FPPB 4BDSA 2HI0A 3OZGA 3W4JA 3WZLA 1Q5PA 3P2EA 1UBLS 3DHVA 4P54A 5JAIA 1RWWA 3DKIA 1SOVA 3ODGA 2REQB 1FYFA 2PKWA 2J5XA 4EZIA 4KO4S 2ODAA 3E70C 2FW9A 5TR9A 4QGGA 1HTWA 1U9ZA 5J5AA 1O4WA 2JHCA 1VE5A 4YRMA 2XYQA 1D5WA 4BFSA 1P9NA 2HW8A 5CVUA 4GRAA 1ND5A 1QUEA 3INYA 2HQBA 5MGBA 1Y5NA 1LTKA 4KBFA 5T4FA 1U9YA 2EU8A 5LD2C 1F4LA 1WMEA 1Q21A 2RG1A 2UYYA 2GEVA 5EXEA 5HDQA 3U81A 1DKNA 4TLCA 1NA5A 4F96A 3FXAA 5FPQA 2ZIAA 1NVMB 3KC2A 1G8FA 2WA2A 4MIEA 4NICA 1K5DA 1J8VA 4PAQA 5EZQA 5IWAB 3AHGA 3BH6A 5DHQA 4EF6A 3P0HA 3EFOB 2LW7A 4UMFA 3AXTA 3EZYA 4OQNA 4TXLA 1V3QE 5IJAA 2ZAGA 4EW2A 1ZIDA 2BMWA 1OGIA 1RW4A 4HEA1 1GILA 5CB0A 4J16C 3FCSB 5DBIA 4TVBA 1E2KA 3LCMA 1AIPA 3D8TA 1EDZA 5EWJB 3ILXA 4Y9RA 4CCSA 1YB7A 5F21A 3ZEIA 3DLHA 1BE6A 4KO1S 3ITNA 1PR5A 3TR0A 1RXSA 2C2HA 1FDVA 2RGUA 2ZYTX 2H4YA 5AICA 4DM3A 4WOBA 1OXKB 1NKVA 2KBFA 4DR2B 1J2UA 2VDQB 3ESZA 4HDCA 5CB4F 4XGQA 2ONCA 1ZD2P 4HFJA 3ZCRA 2GJ8A 1TTPB 2II6A 4HAUA 1K6JA 1GSOA 1HQYE 1QX4A 2Z0MA 3REOA 4EG5A 1T10A 4F60A 2CB9A 2WTEA 5CW1A 4TT8A 4JDUA 1UK9A 3SAJA 4DA7A 2HYIC 2GPJA 3BFXA 4OQQA 4X1KA 5DOVA 1XZFA 3MG9A 3W4IA 3MWEA 1YB2A 4L8GA 2Q07A 5KYYA 2HR1A 3KQSA 2WUDA 2C5EA 2X7XA 3EB9A 5AKLA 1HTBA 4MV9A 2P5TB 3RIGA 1FLAA 4Q7KA 3MHTA 3OKCA 4E08A 4EABA 1XAJA 2BEUA 2PZLA 2OXTA 4F06A 3P32A 2FQWA 1EWYA 3H2KA 2IZOA 3MGKA 3H5NA 2W70A 3A36A 2PL3A 3N8HA 3GELA 3F96A 3ZU5A 4CEHB 3IOMA 4BVLA 5IX8A 4OM8A 2Q49A 2DR0A 4D0GA 1ZKMA 2J5RA 2FQYA 1X7XB 4CGZA 2VJMA 2VLBA 3DDNA 4A0RA 3DB1A 3CRVA 5TPWA 1OJLA 3QJGA 4M1OA 2Q4EA 4CJXA 5BWNA 5KWEA 3TX6A 4Q9JA 3HO1A 2W6MA 1SA0B 4PSUA 5EUQB 4UCWA 3UK0A 2FMTA 2CMDA 4Z99A 4YP9A 4C5AA 1T3LA 2EVWX 3LFUA 4EY6A 4PZUA 4AFNA 1F5SA 1KK1A 3UCFA 2ODEA 4F7DA 1SEVA 2FU5C 1KQNA 3GWGA 3LWDA 4P5DA 3R7NA 1L5FA 3AI3A 4C4PA 4NI5A 1JTVA 3WWEA 5K0EA 2OAQ1 1M34B 2PD3A 2V45A 1VXRA 1I4WA 4DA6A 3IQDB 3WO1A 1HDXA 2CYCA 1NN0A 2ZANA 2WWIA 3H5VA 4EEKA 1Q0PA 4UKDA 5EUBA 4ZCTA 2D2IA 3QLUA 3JALA 5J2UA 1BIFA 3WP0A 4E6PA 3D43A 4W7SA 1N32B 1TADA 1Q16A 1S0UA 5LZ4A 3NASA 3TQSA 1OI2A 2PIAA 1I2MA 4UFOA 3M6MD 4IIGA 2Z2IA 3KYCA 1U1FA 1E59A 4MDYA 1DAFA 4E7PA 1Q0ZA 4JB8A 4KITB 4ZIRA 3AUUA 4DHEA 2AH5A 1GM5A 2PWZA 3MWDB 4EFLA 4FDAA 1NUHA 2TMYA 4C89A 1H2FA 1RQGA 2WJPA 3V1KA 2CLMB 4DV5B 3U6KA 2WU1A 4AZSA 13PKA 4BUCA 3G2JA 3HPQA 1UZMA 4INOA 5IDVA 3UK1A 1NVUQ 4IXTA 3WLKX 1VKRA 4XKJA 3OPYB 4K6FA 1ZOSA 4URVR 3CVOA 3HRKA 5A4DA 1KEVA 2HT6A 3O38A 4HWSA 3ABSB 3ZBTA 3R3JA 2I3GA 4PPYA 1EM8B 3IIJA 5J4LA 1JQ3A 2RGYA 4BO9A 2JL1A 4XWTA 5EPOA 1K3FA 3EEBA 3K9CA 3PGXA 3QZUA 4J0FA 2O54A 3QVKA 5EMMA 2Z5FA 2EBHX 3HA5A 4MIOA 1IQUA 4TTJA 1AK2A 2P79A 3S1SA 1G6KA 4R41A 3Q7RA 3DWGA 4KNYA 2I8CA 1QNFA 4IP0A 4LMBA 2E49A 4N6NA 2GK4A 4OEHA 4B46A 4D4HA 5AW4A 2KB0A 2WHPA 3L7DA 3S70A 1OZ0A 1IJFA 2C9YA 4C4RA 4ARZA 2QIPA 1E0KA 4J90A 3C97A 5TQJA 3RVSA 3JQRA 5JMOA 4F2GA 4MRMB 1LPSA 1O4VA 1RC0A 2IDJA 3OPVA 4PR0A 2I2CA 3ZHXA 3AUSA 5TPZA 1OBVA 4WN9B 2GKSA 1KKMA 2POCA 2WOJA 3O1LA 1H9CA 4C5BA 1IDN1 5M3BA 3BHIA 3D7SA 4K9MA 4QLAA 1Q14A 2BFEA 1U7DA 3DR5A 2XJ9A 2UXBB 2D5IA 2QRZA 5CTAA 2I71A 2JHAA 1ECBA 3FKSD 3HU1A 3GNSA 4E5YA 4BB5A 1Z2NX 1UKCA 3C3WA 2QMYA 2ZRBA 2RGCA 4HH4A 1K63A 4RL4A 1PR4A 1IZYA 1NP7A 2W2QA 3NRBA 5AVJA 5GJVC 4KXUA 2V3WA 1W2HA 1ZUNA 2A1UA 3SZLA 3GW8A 2Q5LA 3CKKA 2P1DA 1QKJA 4K8RB 2AOWA 4MYDA 1DFGA 5JJIA 5BV1A 2K2QB 3WHLA 1FOEB 2XCLA 3LBNA 1I3OA 4FXPA 2CJXA 4QICA 4LXYA 1NWHA 2ZIVB 3FSGA 3MJTA 1ZIXA 4YJ3F 2WWTA 4HGOA 4HNGA 1PF7E 4JX9A 4N18A 5IARA 1CXZA 3DAPA 1E77A 2ZRAA 2Y66A 2O5VA 3EA0A 3M5WA 1CKEA 4WBNF 1JU4A 1QANA 4DSZA 1QVRA 4DB4A 1UADA 5GJWC 3UMMA 4X66B 4XWWA 2EZ9A 1P1KA 4GWKA 4NBWA 4ED9A 2D6FA 3HO8A 3LGSA 3KKMA 2PXCA 3EPPA 4YP7A 1YS2X 1GR0A 4FJ0A 1M2FA 4W9NC 1XCJA 3OQPA 4Q7EA 4HNVA 5E9AA 1EP3B 3ORYA 2H08A 4I0WB 4M60A 5DCWA 4N76A 5G3ZA 1V5IA 3CN9A 4NEQA 3GEDA 1IDOA 3NWEA 1FSZA 2E6UX 4LYDA 2DFNA 3U4HA 3B48A 3V7NA 1P62B 1AQUA 4D3ZA 2UZ0A 3TQRA 3BICA 3W4KA 3ISTA 3LBHA 4RTLA 1B42A 2ZSIA 4R3NA 1MO3A 5FI5A 4YP0A 3ZIAD 3FCAA 2HWWA 1QJ4A 3QVOA 4EQZA 3WAKA 4EKNB 4IOJA 4RY2A 2Q5IA 1RWXA 4QHTA 2L19A 3EGDB 3D0QA 3Q2OA 4MXDA 4NU8X 2ONJA 2WWGA 2Q3MA 2IVZA 4PG5A 5AJTA 1GFSA 4NULA 4MRRA 1Z63A 1JSCA 2PU7A 4ZK6A 2OY0A 1JG2A 2J30A 3A6HA 3FPHA 4M1MA 4LQDA 4RTMA 1U4OA 2E4VA 2F1HA 1E2DA 4EJMA 3TGPA 4G01B 4D3FA 3QIVA 4FFBA 4M9UA 1MLDA 2RHMA 2H16A 3D1JA 3DGEC 4ISBA 5CHEA 1TAQA 1VE1A 3FZYA 4TL9A 3LLUA 3TNDA 2C1EA 5SYNA 3NWJA 2PT9A 2O6LA 2J9XB 2J5BA 1QHYA 1TJ3A 1E1YA 4IIUA 4XM1A 4EHAA 5FP0A 5DKFA 3LAWA 1U7OA 1EFRD 1R37A 1YMQA 3CONA 3OX2A 4S12A 4TTRA 2B4AA 1RQPA 4E5KA 3GPCA 3RFTA 5KKCA 1E3EA 1UODA 2ZAIA 1UMCB 1YRBA 2BM8A 1DT3A 1EVKA 4DZZA 4ZTBA 2FB9A 3C6YA 1NLMA 3AIKA 4PNHA 3USES 3GT4A 2GJSA 1LC0A 1SY7A 3AF5A 2ODTX 4L9AA 4Q3CA 2AB0A 2YWDA 3FH0A 1FNCA 3KAKA 2R44A 3KEGA 3QNMA 2C78A 4D3XA 1ZYUA 4PQRA 4ARBA 2V7GA 2IIPA 3BWBA 3H5AA 4YJDA 5IDYA 4CF6A 1U2SA 3UZUA 4R3WA 3MTJA 3NIGB 2VT6A 5A4MS 4NL4H 4GQIA 1X38A 5EVJA 4IKPA 2XKKA 4RTKA 4OYYA 4IKOA 3VNUA 1UWVA 5FR1A 2YY7A 3SU8A 4LZLA 3P9SA 3DZIA 1EINA 5DGTA 1Z4IA 4C7XA 2H31A 4G4GA 4F4DA 2GKOA 2JAWA 3ICPA 3KKPA 3KTAA 1KDOA 1CUCA 3AR9A 3PEFA 4MQLA 1UPUA 4X6YA 5DW3A 1QFJA 4JLJA 3A4YA 4CLRA 1N6OA 3BD9A 1RJWA 1MC4A 2ZSFA 4EHLA 4WCVA 2CV0A 4BWVA 2FEXA 2HU5A 4JCOA 4W6QA 4RNCA 3M70A 2FPWA 2O2JA 2C42A 3VKFA 5GTDA 2W6PA 2OV3A 3OCJA 5G4KB 3L7KA 3E84A 4FB4A 2HQRA 3MT0A 4D9BA 4MVJH 1Z56C 2Q1WA 3B1YA 3MRTA 2XT9A 2VHXA 4LOJA 3T3IA 3CVWA 4FN5A 4XEHA 1QU2A 1WMAA 4U7GA 5IUKC 5LDDC 4I4TA 5JEEA 2ZJZA 3JQFA 4X6UA 4YRJA 3VO2A 1SIOA 4TVOA 5CBPA 1E3QA 2AG0A 8OHMA 2C7PA 4I3FA 1U81A 5SZKB 1TJPB 2BFBB 1JHOA 1NU6A 3RT9A 2D3WA 4L6CA 2GERA 3D8UA 1P2FA 2QYHA 4D9MA 4K0KB 3MRVA 1Q7GA 4WTOA 3W2FA 2AFIE 1KJQA 4EX7A 1MT3A 4Q3OA 2GHTA 4I1OA 3E7FA 4GBGA 4TV9F 1CIPA 2QD3A 2YR0A 3CVXA 2LCFA 1FP4A 3JPWA 2FWIA 5CW2A 1IONA 3K94A 1R00A 3BJZA 1MA3A 2XNDD 1LRJA 3FOFC 3ETJA 2P6NA 1R0RE 3MTIA 3BCHA 4A0QA 3T1NA 4OQPA 2QZJA 2OB1A 2QPOA 5T4HA 3HPRA 2VBFA 4CMAA 3E82A 3M3HA 1EWVA 2HADA 3C3PA 4N12A 1DDOA 1EBFA 3M89A 3O91A 2NVUA 1AUPA 3H5OA 4WNCA 1UBHS 4ZGBA 2V4UA 4M88A 3NWOA 4QXMA 2ZZNA 2ZTSA 1XU7A 2G1JA 3KT8A 3OCWA 3UH1A 5LNK1 1EWRA 1FK8A 3G8CA 1B7GO 3X0DA 2L2QA 4Y6OA 2IOYA 3L0PA 3KXKA 1TJYA 1CR6A 4N54A 4TRMA 3E18A 1JG1A 1OILA 2RGNA 5BYJA 3LTNC 2GEDA 3QLEA 4E46A 3BG5A 4B74A 5JYDA 1BCSA 1KEEA 1VBNA 4TL7A 5BSGA 4G07A 4AO6A 2TRSB 1WDLA 3DQPA 1MHTA 5G02A 3PQ3A 5E6RB 4BBAA 2MSKA 2AOVA 3UANA 5D84A 5CNIA 2AE2A 2R6JA 3T06B 2J3DA 5CXSA 2PUBA 5DIZA 4QPPA 2DT5A 1DINA 1T1EA 4TTQA 1AKNA 4OKIA 5I6DA 1VJ0A 1JB9A 2G04A 4KR3A 2PGOA 3G7NA 2H5IA 3TXYA 2OGWA 1LK7A 4JGIA 1W0JA 4OIFA 1W5TA 3SNHA 5F9MA 3IQGX 2LIPA 4WPGA 3HLYA 1L9KA 1KVRA 2V7BA 3KK0A 3WL7A 2YXNA 4YXFA 5ENZA 3EMDA 2QGNA 1YZ3A 3TZEA 1YASA 1LWNA 2VF5X 2Q62A 3CE9A 3SJZA 4CDGA 1Y98A 2DQSA 3HU5A 1VDMA 1W4LA 4BE4A 3GRYA 2AYYA 5DX1A 4IDBA 5FOWA 4IIJF 4BNTA 2DLDA 2NU6A 2NSYA 4EVQA 1NUSA 4YCCA 5C8DA 1NXOA 5DBHX 4YDRA 4ZC1A 4D45A 5K8VA 2GM4A 2Q5OA 2PGDA 3W2GA 2C2KA 3BIJA 2Y1EA 3R23A 5ALUA 3TE6A 4C0AC 3HKCA 2DHRA 1G2PA 5A7GA 3HSKA 5IBCA 3DBRB 2CJFA 3VU9B 1PS8A 2QTGA 2F4VB 4ZT4A 3S99A 1D7OA 3ZNPA 3H9CA 1USVA 2XJ4A 3OMXA 1CV2A 4X6XA 1PL8A 4BNIA 3VO9A 3DZDA 3T4PA 1T6ZA 1ZGBA 2ZIGA 1Z7GA 3ETCA 3KHSA 2P4QA 2VZ8A 5DASA 2O2GA 4LNHA 4RA9B 3F6BX 2ZGVA 2CMGA 2VBCA 3GROA 4IF4A 4PAGA 3GCGA 3FRIA 3GMIA 1SNYA 1MT0A 2SCUA 3DYVA 2X15A 1JJVA 3F71A 3HU3A 4RLHA 2H3EA 1MEOA 3ADOA 1JMVA 3RRFA 2G17A 3ZZNA 4MYTA 5A9SB 4QOSA 2OKCA 4BFVA 1KZ9A 2BKAA 1C1HA 4Y2PA 4BMYA 4F92B 2P91A 1LEHA 3HKBA 1B73A 2PMFA 4D0SA 4LC0A 1SUPA 4S1NA 2PWPA 2GBPA 3OTIA 4MQFB 1AU9A 4NCKA 5DT9A 1JE0A 5AO9A 3TLZA 1PS9A 3P0IA 3LSTA 4QBHA 4FFNA 4QULA 3LT2A 3TOXA 2V5AA 4CTJA 1OROA 1KIMA 4ZO8A 4G0QA 4MROA 3UKDA 1NJ6A 4Q3BA 4C4OA 4KR9A 2VDRB 3QKRA 1R4NB 2DQYA 4W5JA 4Z9YA 3IAHA 4Q21A 3ZYCA 1Z62A 4ZO6A 2O14A 1NHWA 2Y67A 3N8NA 2NPOA 1G21B 1UKYA 4I4CA 2EZ8A 1XC7A 1AKMA 2YRFA 5L4NA 1E5VA 3WXBA 5K6TA 5AW2A 1X8KA 3CMMA 1DUVG 1HX7A 3PPVA 1RWVA 1NJ1A 4H16A 4P83A 3RVDA 4ZI7A 3NBXX 4P36A 3WLFA 4EA6A 2O23A 3WBFA 3C14C 3I23A 4J75A 3LOUA 2LZ0A 5K0GA 2FJUA 1PJLA 2I0FA 4P0PB 3TOVA 1Z73A 3AUTA 2X3YA 3PFIA 2GJ9A 2WJZB 4EZEA 3CZAA 1RPAA 3KXDA 3CZMA 1UPTA 1R74A 1GPWB 3LX4A 2CJPA 3F3KA 2ORIA 2J4FA 3PZBA 3VNQA 1SH7A 2EDAA 2BMVA 3WGTA 5IAOA 1ABBA 1S2IA 2C5AA 1MFZA 2PMWB 4BVBA 4E07A 1LB1B 1AXEA 1PGQA 4Q3DA 1UFVA 4DCVA 1P2GA 4KREA 2J3KA 1RKVA 4BNNA 1NUAA 2ZI7A 4DCUA 1RXEA 2JAQA 1JG3A 4YJGA 5FF9A 3TMAA 2GRJA 3ASUA 1UWLA 4JT9A 2O59A 1QG0A 4BQRA 3UW3A 4X7BA 3OECA 2J9ZB 4BCCA 1NBOA 4QYWA 1IN7A 2FN3A 4QD3A 3GOQA 3GY0A 1U0LA 3C8UA 4HTFA 4O4JA 4EX6A 1P81A 4GE3A 1L7AA 3RI3A 4Y2HA 1K2WA 2DHDA 2EWMA 4MMYB 1XG5A 3NBQA 1GGEA 4DA0A 3HEAA 3RAEC 4U1RA 2I2XB 2VF8A 5DTMA 1ATIA 4MKFA 4Q1FA 4PZEA 1WLYA 4H59A 4K28A 4TMKA 4LGYA 2UZ1B 5D3MA 3SQMA 2A1TR 2O7QA 4E4RA 5B4TA 1NBME 3BGIA 3E7XA 4R8MA 3EXHB 2WK1A 5A7FA 1LJ8A 3GPIA 2HF7A 1G8JA 5SYMA 5INTA 1XDUA 2HA0A 1JPJA 2X41A 3VPFA 4N5IX 3I12A 5EHIA 2J0SA 1KJJA 3UGQA 3GEGA 4HDRA 4CGYA 3ZZ1A 4E2YA 2X8BA 5FJIA 3GBPA 2W0MA 1WEHA 4ZK2A 2B3TA 2P67A 3L1IA 3N3AC 4KYIB 2BHTA 5LBUA 5H3CA 4XLZA 4DCTA 2I2AA 2VK1A 3VC7A 4Z4FA 3IEKA 3NXSA 4I55A 1UXJA 2NO1A 3W6ZA 4KQ9A 3U09A 1M2WA 5I47A 1UKAA 4UTNA 4B3RB 4Y0AA 5MGNA 2DQZA 4LF7B 1PW7A 1L5HA 4QBKA 1UIRA 2MSCB 1Z6AA 5B58T 3ROPA 3BSSA 3L4BC 5CLLA 3OG9A 5EE3A 3AX6A 3LBFA 1JDSA 3MSXA 2EG9A 1JLKA 4MVJF 4AT1A 2BM0A 1I2AA 1BA2A 5EJ8A 1VCOA 2FGKA 1EXNA 4P4SA 3ZLBA 1LK0A 4ZVRA 3VR0A 5IFKA 4CYMA 2ENWA 4WZ6A 5EIWA 4Q15A 4HAXA 4WY2A 3EGIA 1N4AA 2QZSA 1PU2A 4JR2A 5DMXA 5TVKA 1ZW1A 2BR3A 3LE8A 4J03A 4E5PA 4U7WA 3T7AA 4HWPA 2HHJA 2GYYA 3W8NA 4NOLA 4KQ6A 3ED1A 5HZMA 3HJNA 4KODA 1H42A 2AJBA 2RK4A 3S4YA 2FLVA 9ABPA 3TNJA 5GVSA 5CGQB 3R5KA 5B3AA 1U0HC 4MV3A 3TIXB 4BVHA 1QOQB 3ESCA 1QGZA 5DT2A 1IBMB 5CJJA 1DKUA 1RI5A 2B25A 2Y6UA 3OTWA 3RK1A 4DLXA 3W7BA 3DZFA 5ULLA 1T1GA 5JEDA 2WFZA 2JLVA 3GRFA 2P1RA 2VAMA 2W37A 3IMKA 4HB0A 4I50F 3X1JA 1YI8A 4JT8A 3MGBA 1D6NA 3MVEA 3WLAA 1NXSA 5I48A 2EX0A 1THZA 3HJHA 3OUZA 4I9UA 4PFQA 1S89A 1P5JA 3PFKA 5E7IA 4ES6A 2CSUA 3PQCA 4AMBA 4IQGA 1P7ZA 5EKXA 2QZ9A 2IRWA 3MRXA 4UHCA 2FEOA 4KQHA 4A8TA 4W7HA 1QVAA 3W79A 2XBMA 3M6WA 2Y4NA 2PUFA 5EJ9A 3LG2A 4E2ZA 2PRZA 4GKAA 5AKZA 5L3QA 5LL6P 1Z4KA 2RIRA 1AGPA 3M2PA 3NAZA 2OBYA 3H6KA 5T5QA 3WYCA 2EZTA 1YMVA 2P7HA 4BNUA 2XB2A 3CJQA 5AMXA 1LBTA 3QPDA 2G4LA 2BEJA 2XAUA 1ZGZA 2CFOA 5C3MA 3OF5A 1TZBA 4KE7A 3KOUA 2I4IA 4I9GA 1JP7A 2ATXA 1I33A 5E8JA 4A8JC 1DCKA 2X9VA 1I7QB 2N47A 3N6XA 4N1AA 4YBZA 2BEWB 3M6VA 1K8XB 3BXGA 1QP7A 1JHXA 2WU4A 1H3NA 1I0ZA 3C1TA 4I3HA 4R2HA 1AKVA 2O8FB 2FAXA 3SZMA 1Q0QA 3R9KA 3DPUA 5F5NA 4C4AA 1OF1A 3PLRA 3WB1A 1GUBA 1G8AA 2R2AA 1FFEA 4KLRA 4BEJA 2JJ2A 1UQTA 4WK4B 3GUZA 5CVDA 1P33A 1XCGB 2BGJA 1FFSA 2LVBA 2CFRA 3M34A 4GYKA 5SZIA 4A0HA 2MT9A 4R54A 3WYAA 3H11B 3BJMA 4ZPJA 1JRLA 5IZ4A 2Y4OA 3GXBA 1D0VA 1U7HA 4EGAA 2O2ZA 4DV7B 4NNOA 5KTNA 3Q3VA 4CG0A 1TTTA 5J40A 1CS0B 3OE7A 3RJ5A 3VTZA 5DXAA 4REQB 3REGA 1V7PC 5CCXA 4BVEA 4N4AA 3O4JA 2VTBB 1T4MA 2AEMA 4GNKA 5F23A 2Q0XA 4S2UA 3ZWXA 4A6PA 1ZVVA 3WMEA 2M6KA 2P9CA 3FNGA 1E64A 3PRHA 4ENUA 3N3BC 1VLMA 3V55A 1Q0SA 1TKBA 1J99A 5D8DA 1HI9A 2AVNA 2O2HA 2I66A 4UE3S 5CCEA 1A9XB 2YWJA 1OWOA 1P5HA 1XPRA 3NC4A 5K3FA 4DG9A 2DBRA 2Z9BA 1X1SA 1BMFD 3KU4A 1WV0A 5CA1A 1EX9A 4I36A 1PQWA 3R3XA 3SK0A 1DKQA 3ANMA 3C3XA 2FVXA 1PK9A 4MAMA 2B5VA 1NF2A 1NL3A 3QHPA 4QZVA 3ECSA 3NT4A 1CFZA 2Z5GA 4I08A 4QPCA 1QMPA 5E6UA 1D2RA 5F7JA 5CFNA 1DG9A 4QXRA 1UBKS 1BKSB 3EZ7A 1OQAA 3OFJA 3WNVA 1R0LA 5A03A 5B4VA 2BM9A 1J09A 4H3SA 3VR6D 4X91A 3CVJA 3JZAA 2BKLA 4IPTA 2GVNA 1HG0A 1NVAA 2QQFA 3ADBA 2YICA 4TPKA 3EH1A 3M33A 3ZH9B 1AGRA 1LDBA 4BX3A 1JJ7A 4R01A 3K16A 1X7ZB 3G59A 4RL6A 2CKMA 2V4MA 5TMEA 1CDOA 1WUYA 2GBIA 2WIDA 3E58A 3L8YA 1PR0A 3R20A 4FONA 4BJ5A 5JH7B 1OLUB 1RPTA 5C53B 1NI5A 4PONA 4J0KA 5JJLA 5EVCA 1JS1X 5EQTA 1R8XA 4Y2RA 4CV0A 3PFFA 1ORTA 2YMQA 1VPLA 3IYLW 4HWTA 4OTZA 2IHJA 1PJTA 1L3CA 4ND5A 4RM3A 3TGWA 2WM8A 1Z5GA 3HR8A 4GXTA 3B9PA 1C8BA 4FCVA 3I6ZA 1ECLA 1Z6ZA 2WD7A 2XB8A 1D9XA 2ZWAA 4JLMA 4LZZA 1T2VA 3SKVA 5ICCA 2Q3BA 3BIXA 1VG0B 1ESDA 2QNIA 4L3WA 3WGKA 2F1IA 2JLXA 2HD4A 2DUMA 4POAA 4Q48A 4V0SA 2EKZA 4O5AA 4D44A 4RD1A 1ZH2A 2ZRLA 3AEXA 3K5WA 4Q00A 1G5IA 2Z04A 5D6NA 1YHNA 2AF4C 1K8YB 3UB2A 3LDHA 3ENQA 5IZCA 1KR5A 4RSGA 4J1TC 4EF4A 5JMWA 1AKEA 4ROTA 1JXAA 1NKSA 3R0VA 1TZMA 3SQNA 5L51A 3U7JA 4ND8A 2KHZA 3H86A 1Z0SA 4D4LA 4L3VA 1QR2A 4RF5A 5CK5A 5LOVB 2Q6TA 1U0RA 3IR7A 4G85A 1TX4B 5AI9A 1N1DA 3VR2D 3ETNA 3KQVA 2PR7A 2YIMA 2ZXFA 1KI8A 1KDVA 3ORQA 1QF7A 2OZVA 2OGSA 4KN5A 3ABRB 5L3ZA 2VQFB 1Q12A 3IRUA 2D0IA 1DP4A 4PG7A 3WSTA 1C7QA 1TLTA 4OQXA 4L51A 2IZ6A 2QX7A 3RM3A 4AVYA 2IHNA 2NADA 2VEDA 4BP1A 1KARA 2Y0DA 5A4AA 3BUSA 3FVRA 1Q1GA 3Q3IA 3N2YA 3RSOA 3AP2A 2MSDB 5K8IA 4W9MC 2DPLA 2BUAA 1O9BA 1IE3A 3D4LA 1G3RA 4DILA 1OAAA 4PGFA 1VYUA 5M5BA 3DDWA 1JQKA 4X8OA 4UTZA 2XXAA 1EBUA 2FZCA 1LRKA 4BVAA 4XDGA 1YJQA 3DVAA 4S05A 2Y77A 1BQEA 2D7DA 1T43A 2PMEA 3GAFA 4KXFB 3ZTTA 5BV0A 3OLXA 2YZ7A 1HDIA 2HMAA 5AM2A 1O2DA 2Q6LA 4C3OB 2HUNA 2EBFX 2CHFA 1GL3A 1XKLA 5ICFA 4OJMX 2QRVA 4DANA 1G41A 2AW5A 3P2MA 4OHVA 1G5TA 4OB7A 3TN7A 2IYRA 5HTKA 1OUMA 4XVCA 1HK7A 2Q5FA 5GONB 1VZ3A 2G8LA 2BF4A 1DDIA 3AESB 2OHIA 2HPHA 4ZDIA 4NMLA 2GEBA 3G8DA 3ZVNA 1OB2A 1O0BA 3MJHA 4KGDA 1ZWKA 1VHWA 2LR0A 3DOFA 4RYDA 2XZOA 3OHMA 2F8SA 2X5XA 2IE0A 3CNHA 3A3YA 5E7MA 1C8KA 2JLSA 4HX2A 3TM4A 1JQLB 1A8QA 2SKDA 4TMXA 3ACDA 3B5JA 1ADFA 1OKKD 5D3QA 5L95A 5JSHA 3IQIX 3V5NA 1ZK0A 1K92A 1G8HA 4PS0A 4RBNA 5BSHA 4NARA 4O3MA 2YWXA 1XZQA 1NOKA 4WH0A 2DVMA 3Q7SA 1JHZA 2B36A 3LUDA 1I1OA 4KCGA 3U7QB 2V7PA 3R6GA 4IVRA 3LKDA 3WMXA 4QVKA 4EGFA 1TYBE 1EAMA 2QUHA 1MXHA 3QUTA 3A1SA 3WWOA 6REQA 1GIAA 5HSGA 3ZGVA 5FBVB 4ZZIA 2P2NA 4HHEA 1NOIA 4CQMD 1G0NA 2VWGA 2GVDC 2P8SA 3GEBA 3JS5A 4K3UA 5FLEX 2H7CA 4CF7A 3E8SA 1WLSA 2X14A 2NO9A 1C1XA 4DLSA 4RJKA 2FFJA 3TPCA 5HKLA 5LP6C 2JZOA 3LXUX 1L2TA 1AKTA 3UHFA 1FZTA 1ODLA 2ID8A 2CNNA 3RBAA 1B16A 4QYXA 3ITDA 1SVIA 2RH9B 4IDAA 2HXGA 4W4TA 2GAFA 4RK0A 3TZHA 2GQ0A 2I7VA 3EVGA 3BJIC 2D3TA 3KJNA 1VE6A 1LZLA 1EUDB 5T4EA 4QM6A 4KWCA 3TTTA 4E3WA 1F4PA 1WOYA 2X1LA 4HNSA 4ZRDA 3ST7A 2WWWA 3WZ2A 1GGKA 2VK8A 4JSRA 2Y71A 1HE2A 1PO7A 1J49A 2HMTA 2O2SA 2PUTA 4JHXA 3WDLA 3SEFA 1PK8A 1T0PA 3FGPA 3HBLA 2FKAA 1ID8A 1JW9B 2FF5A 3D02A 1VKHA 4PG4A 5FEUA 4ABYA 2ZJFA 2HLDD 2ZR0A 4KR2A 1VL8A 4OMUA 2WNHA 3TZQA 3B1VA 4EL5A 5HJ7A 4O4IA 2XCSB 2QW0X 3V46A 4OBEA 4ITRC 3CNEA 2AZMA 1X6VA 3L6DA 4B40A 2VPXA 3TLEA 4AKHA 3EYWA 4FHZA 4IL5A 1J0AA 2FX5A 4L5CA 5DP1A 4YECA 5FNVA 3TZBA 3BSYA 4EI9A 1XZCA 5FQNA 3CNQS 3VKUA 4IEIA 4ASUD 4FWTA 1GUDA 4I9HA 1M2VB 3RRNA 2DULA 5LMNB 2BDEA 1U3CA 2X9GA 4KZKA 3GZNB 4DL9A 2VP5A 2DBQA 4B8ZA 1P4GA 2N1BA 3AI2A 4ENSA 2JAHA 4IS3A 3O8QA 4M8NE 2REOA 4ZDWA 3S2ZA 3GP3A 2GN4A 3PYLA 5EA2A 1B6RA 1OTYA 1Y33E 1Z82A 2F9FA 3ZD8A 2JLWA 3U3OA 1EVQA 2WIGA 1TAUA 2IYAA 4HDQB 4QQRA 4DMRA 2F1RA 1M1YB 2CLFB 4N65A 3KV1A 4P9NA 3NALA 1J0EA 3E48A 3R9XA 5JS8A 4KUGA 4YNBA 2BIFA 3KQLA 3LBYA 3G82C 1ZK4A 1US8B 2EC5A 2PZMA 5CEJA 3WB2A 3DO8A 2PS1A 1U3UA 4MWDA 3MERA 1N8SA 3E8MA 3AUJB 1JR3A 1MG5A 3N2IA 4IZHA 1CULC 3AR7A 4XVHA 3JQQA 3PC4A 1IUKA 3FLAA 1XP5A 1EFUA 3TAXA 1T91A 5DN6D 5BW6B 2AFIB 5EWLA 3UWKA 3RT1A 2NVWA 4ARIA 4AP9A 1TKCA 5TC4A 4KQ2A 2AKAB 4JK3A 1JDNA 3AFMA 4N5MA 3OFVA 2I7TA 1TUEA 4LXTA 1IL0A 3NM5A 2IA5A 4BOYA 2JBAB 3IOBA 4DBLC 1SB9A 2B21A 2OCPA 3LRTA 5DTRA 1IBKB 3A10A 4FDLA 3TOCA 1PWYE 1KVQA 4AICA 1WVIA 4DV3B 2VOJA 3D7NA 1WPGA 4RJTA 1P3DA 2G72A 3KALA 2IXAA 2WSSD 4XX0A 4HMQA 1UC5B 3U4QA 1GLNA 1NYLA 1Z2PX 4XD7D 2CJWA 3AQ4A 1IHOA 4PLTA 4G8DA 2F3SA 3O1IC 1DQSA 1XZLA 3B20A 4TYMA 3S0JA 1EX7A 2GN6A 3SLKA 1ENOA 3NHYA 1L4YA 1AB6A 3ICEA 2QZZA 4FFLA 2B98A 3H8WA 2SNIE 3V2IA 1G4UR 3FMPB 2QTLA 1A27A 4RIIA 1QNLA 5L9AA 3QVGA 4MVWA 3TMYA 1RABA 3OAAD 2GT1A 4WLOA 1O57A 2BCJQ 5F3DA 3RUPA 4OLBA 1O94D 2YHBA 1YTUA 3GFBA 4QGFA 1P3Y1 3C6ZA 4ARAA 5KUTA 1LPNA 1E5TA 2AFRA 2NPIA 3Q98A 5CYFA 1QGOA 1KHTA 4BMSA 5LQUA 3RIMA 5DO9A 4JLPA 2EWVA 2ZTLA 3CV3A 3DF7A 3DCJA 4L22A 4IQ4A 1DJNA 1EK6A 2C5LA 2MMGA 2OQIA 3FDIA 3K6SB 4PHHA 2C2OA 1H2BA 4B3JA 3F6CA 2FFHA 2ILVA 4J2OA 4CNBA 4ABTA 4JFAA 4FEEA 3CLTC 2IKSA 5ICEA 1FSGA 2OQ2A 3DOOA 4MRPA 1OYVA 5BVHA 3PQ2A 4FBMA 4ZVLA 1JAHA 2BE7A 2O9JA 1H2RS 1XF9A 1OHHA 2KJQA 3HB9A 4XGKA 3LUHA 3RC1A 1H3EA 3DKPA 3NDJA 4NCNA 3NNNA 4UHJA 3EVAA 2YVAA 4C4ZA 4EL0A 2H8KA 2XUAA 3WTBA 2OO7A 5DVZA 2P75A 4UTVA 4TL6A 2EFCB 3KLPX 3DTYA 4J7XA 1NXTA 4R0NA 3F6PA 1NMYA 3CWQA 4B3XA 2PAAA 3AU8A 5IBPA 3RVBA 2O7VA 4JQCA 1CUZA 5HXAA 2Y68A 3F6EX 4YAKA 3WAJA 1FYXA 1G20B 2GCPA 2XQKA 3IPCA 2P35A 4N03A 4RPGA 1JKXA 3RU7A 4G25A 1XTUA 4DTCA 1YA6A 1KDTA 1E9BA 4TLEA 4ZVKA 3BMQB 2A5LA 4O2BA 1RCTE 4CHGA 1E9DA 4N0DA 3KQWA 5CNKA 5HZKA 1VE7A 3S1AB 2JCVA 2Z6VA 2ZBPA 1NGSA 4RHCA 2ZB3A 1P7PA 3A05A 1VIAA 2SICE 3GJQA 3PPWA 3HWWA 2L42A 4M8KA 4R9NA 4UVIA 4ZQHA 3MIIA 3NCHA 1L4HA 3EH2A 1YK1A 4BGEA 3ZU4A 5G4LA 3FFBA 4REMA 1WO8A 4S35A 3OT4A 2Y0EA 3IV6A 1L7DA 3ZGNA 2IBSA 1GXSB 1SXIA 2HMYB 1TI7A 3H17A 3F98A 3PNQA 3SOZA 2WOOA 1QB8A 3DGFC 3AEKB 1JSXA 1KSFX 3UPDA 3AUKA 3HDHA 4G9GA 4C7JA 2BEVA 1TE2A 2BFFB 4B17A 1APBA 1M8FA 3V00A 3HMQA 2PUVA 2J3IA 1H5QA 1VMEA 3HYLA 4HDMA 5EJMA 1VP3A 4KJXA 2CXTA 5HWSA 4V1CB 1Y9DA 1NMXA 3BAFA 4X93A 1Z5NA 3MJRA 4X1OA 3B36A 1GFWA 1KI6A 3TSYA 3UC9A 4AMVA 4D4MA 1T4CB 4EELA 3FNQA 3G2MA 3Q6NA 4BHTA 2HZBA 4ZKEA 3AHJA 5EGNA 4Y2SA 2C9ZA 4JWKA 2XWQA 1NJ8A 1P1RA 3GNTA 1BAPA 3NPMA 4MR7B 4P6VF 4QE3A 3R3HA 3DMYA 2IZ7A 2WSBA 1S2MA 3BB3A 3HP4A 1NSYA 4EJSC 5K6RA 2PX2A 3OFND 4FXOA 1JYSA 3BWCA 1KEKA 2JVIA 2ZBEA 2HCJB 4TTAA 4B3TB 4R0MA 4X0EA 1HYQA 2IY9A 2RH4A 2VT7A 4E12A 4EPWA 1EQUA 1S8NA 1N6HA 2BELA 3ESDA 4LPSA 4KK3A 4OP3A 5K4AA 4DV2B 5JSUA 4O5OA 1G9TA 5DM0A 5CITA 3S8YA 3IJRA 3LZCA 3KOOA 3N0WA 3FGNA 5C8YF 1I4LD 1IM8A 3DEHA 3IQXA 4G0XA 3RCBA 3AF0A 3MUEA 2XDQB 5EZYF 1DXHA 3H18A 4WWHA 3TQCA 4M38A 3D8NA 3PIDA 3G2OA 4MLDA 2WB2A 4O2LA 3KOZA 3FYTA 4B4VA 3ZCTA 3P71T 4B0PA 3GUYA 1R7RA 1RLOA 2QP9X 3SPXA 1QVWA 2FPRA 3C2QA 3LT0A 3PDIB 2CLLB 1OLOA 2H4ZA 3F78A 3ZWVA 4BO5A 2J9YB 1WP4A 2Z8XA 4Q4AA 2NU9A 1MJNA 5HUHA 3QA3E 3G1UA 4NONA 2JDID 4HZUB 1HT1E 3CLRD 1VCHA 4LE1A 3L1KA 1JWAB 4Z0PA 3L0ZA 2XVMA 3K3PA 3DT6A 5C4IA 3OQOA 3AERB 5MFZA 4AJ9A 2WKPA 3RTCA 4TYQA 1PZXA 4R5MA 4ER3A 4X84A 3H9JA 1QTRA 1NR5A 1L4EA 4O4LB 2RB4A 2QM8A 5KZMB 4W1QA 5EP1A 2R6DA 1SUBA 5IULC 2ZYGA 2X3UA 4BP9A 2XUIA 5TQ2A 3U31A 2PGNA 5ALSA 5LUAA 1YZTA 1W49A 4M87A 4Q4HA 3Q41A 1YFZA 4ER5A 2A7QA 5A2GA 2NIPA 2Z43A 1PLLA 1R0CA 5KTRA 3QXGA 4CHTA 1Y4SA 2YV4A 4L1KA 5HMMA 3BDVA 4WCDA 3QV1A 3HJCA 4AP6A 3GJSA 3NWBA 4PCLA 4P4TA 3A1FA 5FYQA 2OMEA 5IMBA 3GPBA 3DUWA 4WAUA 2CJYA 1E66A 3DNMA 4S1WA 2QNRA 5TE9A 3BFVA 2G0AA 5B55A 2F4NA 3JWGA 5ADUS 1W46A 1CX9B 1TK9A 5IDQA 5IT9A 1Y9JA 3PICA 2KS6A 2W6IA 4YRSA 2JCXA 5HIJA 3WLRA 1YZQA 1OU4A 3DP9A 3DPSA 4GBJA 4W1PA 3STVA 3HCBA 4DZRA 4CEIB 5AKXA 2JFZA 5EJGA 3I1IA 1XEFA 2JRLA 1W6UA 4BX2A 1Z6TA 3FRJA 3RUAA 1KFJB 4L75A 5JBQA 1BMQA 1RPJA 4ID3A 4MB6A 2DM6A 2GI4A 4OI4A 5EP2A 4NBKA 3RS8A 1GRNA 5KSOA 4E5UA 5A71A 4BNDB 4E1AA 4PGHA 3GJZA 5BQ5A 4CMJA 1YE8A 4DMKA 3UK7A 3DJYA 4FBGA 3I01M 4UFNA 2JGDA 3D81A 1DEXA 2FQXA 1XZJA 3O9ZA 4MGZR 2IYSA 3OQHA 4HH3C 1KSGA 2DY0A 2ZT7A 4PRZA 4U6SA 5FIUA 1T36A 4ZVVA 2N1MA 3LVQE 1M0WA 2ZE6A 3BK2A 1IB6A 4HG2A 4IMPA 4CLXA 3Q3CA 4NPAA 4Z7JA 1QUFA 2AD1A 3EGWA 4KPUA 5IJ9A 2PBFA 2I7DA 2J9GA 1Q6YA 1TYCA 2Y0CA 3EARA 5HJEA 4L7QA 6YASA 1SGWA 3Q9SA 3T34A 4AF6A 1UEIA 5K0ZA 4KIUA 1GAXA 4MK4A 1DV1A 2C0CA 1UP7A 2NTNA 3OD5A 1QU3A 1F0KA 1KVTA 2CKDA 3CEAA 1JNXX 2JLAA 2R9VA 3C3AA 4QNNA 3O9VA 3ROEA 2IYTA 3OEHD 5KIAA 5GJBA 4EHKA 3SYRA 4IW3B 2I87A 1X3LA 3E5MA 2DPHA 1SJ9A 1YT5A 3ZHSA 1ULZA 2FP4B 3DLTA 1ZG3A 3I3OA 2RGBA 1A8UA 5DCUA 4EG4A 5CG2A 2PKXA 1W19A 2H2AA 4XLTA 1QF6A 3KOMA 4YLYA 3IVCA 3C7TA 2F8MA 4Y98A 3KQYA 2QAGB 2QVCA 4N6GA 5FFNA 1XQ9A 2G06A 4BQPA 5K3CA 5K0JA 4BMOB 1FDSA 4Q7LA 5JQGF 5AM5A 1TEHA 3EC7A 1AXRA 1I1NA 5HNKA 1GPUA 1W5SA 5BR4A 2CF5A 2XMQA 3B3QA 2GN1A 4XH9B 3QV2A 3SM9A 1C8LA 2AZDA 2WYVA 3OPXA 3V1LA 4CKBA 5C1DA 1SXPA 1P39A 1YC2A 2LGJA 2QA5A 5CX1A 2X4IA 3W8DA 3FD8A 2GKGA 2XTJA 2VUSA 3QNUA 3H4IA 4YR7A 1B8VA 1K0FA 4DLBA 1MQAA 1L4FA 2VF7A 1U2ZA 3VHXB 3UKOA 4H3KB 4ZICA 1U2GC 2R68A 5T64A 1QCZA 4GC5A 4AJNA 5MDHA 1U0GA 3R09A 3VVCA 4ND2A 2XTNA 1M1NA 3EIOA 1W85A 3T7SA 2QUAA 3W8FA 1F0YA 4A8JA 1UJCA 3HRHA 4ZJYA 4JBHA 4JVNA 4MWEA 3ORSA 3TQQA 4LEIA 2GESA 1ZM9A 2G77B 4QECA 5IKOA 3R6LA 1J07A 3A6LA 1HORA 2HU2A 2J3QA 3I6BA 3RS2A 1ZR4A 2QEQA 1FLVA 1OU0A 1WPQA 3PYMA 5F1PA 2IU6A 3KB8A 1VYVA 3P2IA 4UFPA 2VP6A 3HWX1 3SC3A 4B4OA 1KMCA 4TSRA 1VSBA 3OQBA 1IMJA 1X86B 1YGPA 1N6IA 4GX2A 3C41J 2HMWA 4IOLA 3NBAA 4JODA 3UGKA 3QXCA 3WWZA 3ZVRA 2WTMA 5IAGA 4ZOQI 4EGQA 3UMYA 1QE3A 2H1CA 4YV2A 4JUBA 4FDVA 4CMIB 1A9SA 1ADYA 3L6BA 4JC0A 2IC5A 3WVNA 3SOPA 4Y67A 4EK9A 3I1JA 1V45E 4PYRA 3VTAA 3IT1A 3VV3A 2UVPA 2I34A 1K5PA 1XU9A 2N46A 5CLGA 4BLOA 3CUWA 2PYZA 3O8DA 5GWXA 3KZCA 3ZKWB 2LUOA 4Q4LA 2PIDA 1L3IA 2BBSA 3LUJA 3PHGA 3T5TA 1CEXA 5HQTA 5FUMA 3MT9A 2JD0A 3DQZA 2FR8C 4UHKA 3NHRA 4FSDA 4IINA 4GYYA 4M1EA 4M1KA 2EKBA 4FFOA 3GLIA 4Z4IA 2B2XA 1C3OB 2K2WA 4DUYB 5HBRA 3EUWA 1QH8A 1M2EA 1N8KA 1C4XA 1HLDA 5A6SB 5KQSA 1RBQA 1JI3A 3CX7A 5JAHA 3J81k 4DREA 2XE8A 1GYQA 1TLFA 4CF4A 4EUKA 2QL9A 2CUNA 3L3BA 4EYEA 4FE7A 3RSGA 1E8NA 1PG2A 1J9GA 3ZXUB 1T5DX 1C4KA 3DW1X 4CCAA 2IX3A 2V0GA 1O6GA 1YR2A 1Z4NA 1PQ4A 1RWMA 1UC9A 4Q37A 6AT1A 3EPLA 2UVDA 3ZHVA 3G17A 2O7RA 4IIYA 2Z98A 4JYCA 2KE5A 4R6WA 2Q2WA 4HFRA 5KNCA 3ZV4A 3I05A 3IP3A 4HVCA 4C43A 4EG0A 4BBPA 4OLJA 1GT6A 1UXGA 2G80A 3G5MA 1GD1O 5ESDA 2Q3HA 1UMBA 3IOCA 4P33A 2ZRFA 1R3DA 1XKQA 4ZREA 3ROZA 2VTDA 3K4HA 4GMGA 1UPXA 2C4TA 3IRVA 1PJZA 1XUOA 4L08A 1E3LA 3EWSA 4RQTA 3S2GA 4J91A 5JXJA 3GRRA 3CF2A 3AVOA 4WBSA 4L4ZA 5HIKA 1YS4A 1XRNA 5BNIA 2XNSA 3PT5A 1KYVA 1NVXQ 2ZE5A 3IAUA 4TGLA 5DK4A 1NKTA 2B1GA 1G3IA 3SC2B 5F2EA 4EKYA 4OXKA 2D7CA 2AUTA 2G83A 2YNMD 3UFBA 5JI2E 4GC9A 1RU3A 5DE3A 4FR2A 3IPRA 1JIIA 3MLAA 4W7IA 1KK0A 3KAPA 5CVTA 3QE0A 5JU6A 1FX0A 1K3UB 5AKKA 3IEPA 3PUXA 1CY4A 4EECA 2YASA 4J1TA 5E9QA 2C96A 3H0CA 3ORFA 4IWXA 3H8JA 2EKQA 3SKYA 3HXQA 3KP1A 4DS3A 5BNZA 1ONNA 3G2QA 3O4FA 4INPA 4ZO7A 1KFEB 2AR7A 2RAFA 2PH5A 1Q91A 5BRNA 3VPCA 3G6KA 4BX8A 2J5QA 2Q3DA 4WKGA 3GFRA 3SHOA 3ILVA 4OXXA 4JP3A 1II8A 2ZRCA 5C8YA 1VSTA 4FC7A 1I6LA 3IVXA 3AEUB 4B6PA 3S7TA 2A6PA 2HSDA 2VJBA 5LU8A 1WA5A 1NBAA 4PN3A 2YIJA 4RTRA 2QTCA 3EXFA 2EW2A 5LB2A 4NABA 2PZ8A 4LI3X 2I6GA 2ISQA 4L0QA 4Q9AA 1XMXA 4YJHB 7AT1A 4OHPA 1ZA2A 4DBLE 4KR6A 2G5PA 3IALA 4ZU6X 1QAMA 2YBEA 4K05A 1XPUA 2GN9A 2ZSHA 3SDBA 5JR3A 3NHSA 1EIZA 4KGVA 3PD7A 3JWEA 1GPMA 2P3SA 5CR9A 3SFZA 3T5PA 1XWFA 1YVEI 3FHLA 5C1OA 2TS1A 4NF2A 4BX9A 3OJLA 1YU6A 2X4GA 2Y9MB 5IKEA 4Q9NA 1KE1A 1YB5A 2L82A 2CE7A 4RQUA 5G3YA 5BSMA 1T24A 3MJVA 1AM4D 1TPZA 4F2WA 5KYYB 1E9VA 1GTRA 2GD2A 4R7ZA 2CMFA 3KELA 5A02A 1XLVA 3ZN2A 4OBXA 2BEUB 1H2YA 2JFPA 3BA6A 3MCWA 1TCUA 5A5EA 3E0QA 2UZIR 3HZOA 4K0RA 4JCCA 4RK1A 3FUXA 2OR3A 2XT6A 3W1EA 4YIHA 1I7PA 5DYWA 3HM9A 4ZCRA 3D6MA 3L05A 1EXWA 5LQJA 3DFUA 3WE7A 621PA 4EB8A 1H5UA 4JBLA 3I28A 1LDMA 4XRRA 3ECAA 4U2EA 2VKQA 3CH7A 3ZLJA 3WLJA 1P9WA 1P9OA 2VDUE 2VJMB 4L9RA 3FCXA 4YQEA 1I7SB 3O2QB 5TPWB 2FEMA 3QKSB 1F2DA 1SD1A 4HWGA 4AS2A 1TEVA 1EJ0A 2XOXA 5ILQA 1ZQ1A 3PNYA 3Q10A 3ZE9A 1JEYB 2WVAA 4BIIA 1S7GA 4KV7A 4AUEA 1FFDA 1O08A 4KQ1A 2CZGA 2DETA 4OHZA 3FYSA 3YASA 2ACVA 4MA0A 4BNYA 3Q7PA 1RKUA 1JB1A 2IPNA 1FP6A 1HT0A 3FNEA 1Y6RA 3K4PA 4KAFA 4PTYA 5FUQA 4MR9A 3EXG2 2WIJA 1LDGA 1D4ZA 4RTNA 4AN4A 4AO8A 1GKKA 3AOEC 4KH0A 2MSWA 5A3VA 2CCKA 1E2PA 1GA1A 1XDBA 1ZJJA 3L84A 4IHAA 3RVMA 2VHTA 2JFFA 4H31A 3W6NA 5LP6A 3HJFA 1ZRNA 3AVXA 5CDTA 3IE1A 4LDRA 3IJPA 4TL8A 4UMVA 3TW6A 3ENVA 2PS9A 2WZDA 4D80A 1NDQA 2FMHA 5BV8A 1W36B 5J2UB 5DGHA 2ORVA 1X92A 2QTAA 3WLIA 5A04A 1W1IA 4BGUA 2PCJA 5HIIA 1PNQA 5F4ZA 4EY8A 2YHIB 5CT6A 4HH0A 1KOGA 2UAGA 1IIBA 2PGLA 3CM0A 3BT7A 5DX0A 2QD2A 4HADA 2AN1A 3K8ZA 1XNHA 4HT3B 2R1ZA 3NJ4A 3OHPA 3L1JA 4GSLA 4A2QA 4ZIRB 1NSTA 3KWFA 1IATA 4HGNA 3TI7A 1C8VB 3IH5A 4RVHA 4YMIA 2JJYA 2C7GA 4D57A 1TVMA 2KM1A 3L9WA 3KWMA 2NW6A 3RTAA 1T6BY 2BGLA 2F3TA 2OQRA 2QROA 2A5YB 1P29A 2RFLA 4WN3A 5FTWA 3OJCA 2C7QA 3UQYS 3SEAA 3AIOA 4PC1A 2DLNA 1A2OA 3E9YA 4ECEA 3PDWA 1B74A 3RUDA 1CRPA 1J33A 1NURA 3MGCA 1LBEA 2I65A 2PL9A 2IXDA 1FJGB 2HA2A 4ZOLB 3PC2A 2YXLA 2JKVA 1I6KA 2QS9A 2CSXA 3OTHA 3P94A 1Z16A 4W6ZA 2C4VA 3OPNA 1OFUX 1K4YA 1Z4LA 4PPQA 4UNSA 5AXAA 4BN4A 4YT2A 1N3IA 1WXHA 3L1HA 2HXYA 3D9QX 4J43A 1I7LA 1Q83A 3W05A 4DMFA 1NIJA 2XD4A 3H1PA 4LHEA 1JN0A 2D0DA 2OQVA 2IW1A 2NUTA 3WHIA 3EBPA 4BECA 1ZD9A 3OLVA 3RANA 4J8PA 4CKXA 1QGUB 4FMDB 3VSDA 3A4LA 4K7JA 2XUHA 3L43A 1ZMXA 2WKWA 4I14A 4ARZB 3IDQA 5F7OA 3PEUA 2FUG6 4IRMA 2JEZA 2VF2A 1SVMA 3W3AD 1WB4A 2ZBDA 2WJAA 2X9NA 1V1MA 3C16C 3OO1A 1RADA 2RHDA 4N8SA 1OYOA 4F5DA 1LD3A 3L0SA 1IN6A 2ES4A 2WYOA 3LA8A 5AIBA 3PGVA 3UHOA 1YQ9A 2NUBA 2P4UA 5FTJA 3ZS8A 3HR4A 4H7PA 3R5FA 1R6XA 4JC4A 4G36A 1GZ7A 1MBZA 1I30A 4F45A 4YJFB 2YHSA 3ZX4A 5KAPA 1UDCA 3QIAA 5KC8A 4LK2A 2ZITA 2GB4A 1XV5A 3VGPA 1GT91 2GXUA 1U8CB 9GPBA 5IDWA 3P4YA 1ZUNB 2EF1A 3LS2A 3VR5A 4LYEA 8ADHA 3OJFA 1MN6A 5JG7A 1U2EA 2IYQA 2RGXA 1W88A 2XQVA 4L16A 3IEIA 3OESA 3RV4A 3UK6A 1CQPA 4CNQA 4JENA 4F4IA 2AGVA 2ZYUX 3OCYA 1AV7A 4NRDA 1HTTA 5C8ZA 1XMOB 4JLBA 2C58A 1VLZA 1QYVA 3JQGB 4Q3KA 5CIWA 3ID6C 5CT8A 3KCQA 1GTMA 1YONA 1BXZA 2OBBA 3H2HA 3DM9B 4YVFA 3ZHUA 5CFRA 2ODQA 4ARSA 3ETGA 1BGXT 4ARVA 3IKJA 5FL7A 5K3BA 1TM4E 3FUWA 1RNLA 3I4FA 4BFXA 1ZCZA 3GLRA 3BORA 3DT9A 3PNKA 3ZC3A 4RENA 4OD0A 3JD1A 2JATA 2WJ4A 4LOHA 4MX8A 5DCLA 1IM5A 1CF9A 1YULA 3EOAI 3HL4A 4HRYA 4Y6SA 3IHKA 4EG7A 5EWMA 3JATA 4FKMA 4P2GA 2QE6A 1KYXA 1OXVA 4LWPA 3M6FA 4EUHA 5CFLA 3KRTA 4IG4A 3EOZA 3NYIA 1KAMA 2WM9B 3HXPA 5AVQA 3T5MA 2EAUA 4GPIB 2M9MA 3HEBA 5IF3A 2ZI9A 5FYDA 3S28A 1O7JA 2FSUA 1VIMA 1XCPA 2Z9CA 2C2ZA 4FLMA 4ND4A 2WT8A 1N0VC 3O92A 4Q16A 3PLAE 2FETA 5AHOA 1BCRA 1EWQA 3FHTA 4F04A 4AUNA 1TD1A 1PDWA 1ETUA 1NVVR 5DLYA 4QNMA 4EATA 1P1IA 4UVDA 4U2BA 3TEMA 1POWA 1RKXA 1NXPA 2MWMA 2IK8A 4P4LA 2MYTA 2DHCA 2WHRA 4GP7A 3WFJA 1PR1A 3PFBA 2OCIA 4FFBB 4QYIB 3U37A 4BU1A 3ZWYA 1EXVA 2BBOA 2G25A 1F6WA 5B64A 3DAGA 5L7TA 4DKJA 3KBBA 4HZIA 4G5OA 1XCMA 2PSHA 1P1FA 2Z2ZA 3MFYA 4LMAA 4TN5A 3X2EA 1X7YA 4KWEA 4CEJB 3A8TA 5ESWA 5TXGA 2AUNA 1BEEA 1GTL1 2P2LA 1VL6A 4G3XA 1XJ5A 1VE9A 4KQIA 3A0UA 2WAMA 3IEMA 1I7DA 1OXUA 3EZ9A 3ZXYA 1AS3A 1GPNA 1MAAA 1WU8A 2Q4TA 1PR2A 2FK8A 3V97A 3QK7A 2GCGA 3OEED 4NZMA 3TKAA 1CSEE 1EFKA 1YCFA 3W04A 1CNFA 4X90A 1T9BA 3WHPA 4CM9D 1NNEA 3ROQA 2R96A 4DR5B 1UWKA 3KVVA 3SC4A 2X8JA 3TCKA 2VKTA 1VJDA 2KMLA 3A2MA 1IWOA 1SBTA 1U3GA 2GCOA 3FCYA 3RO7A 4ZHQA 5BN3A 5LQCA 3U60B 1FE8A 4CKCB 3ZU6A 4OBWA 3RYTC 3PQFA 5K09A 4OOEA 1G55A 5FH9A 3WP1B 1AGYA 1SU7A 2GBCA 2B61A 5DWVA 5HE8A 1CRQA 3CCCA 4CIBA 1QQAA 1T8RA 2V8BA 4YRTA 2IYWA 3KTAB 1HE1C 4HNHA 3K1AA 4URHA 5CYOA 5KHAA 5I4IA 1E69A 4Q05A 1PSWA 3H04A 5CIQA 5ED4A 5THQA 3C24A 1VJ5A 4EKGA 1D2CA 2W22A 4LDJA 4Z5XA 1TT5A 2HWUA 2ZJ2A 3OQIA 3G88A 3QFHA 4CF5A 1DAKA 2OVBA 2PX6A 3W8RA 4EENA 5HVNA 3GLTA 1W4RA 3E27A 5CB4B 4CM3A 3ZCSA 1BNCA 3M4ZA 3O2SB 4D82A 4B3MB 1E7MA 4EJSA 4UDNA 2A35A 4G97A 4BJ6A 2E4UA 1SN7A 1BROA 5F12A 1KKLA 5BWLA 3EVTA 3VNSA 3IXLA 2WT4A 4GPAA 5P8WA 1RMYA 3TSCA 2HLPA 3T5GA 3WIUA 1CS4C 1FC0A 1NVKA 3T7EA 3WICA 1X7WB 4KE6A 4Z4HA 1JR3E 3A1DA 1E7WA 3KR0A 4JBWA 4YI5A 3HYCA 2J1LA 1UL1X 4AF8A 5KOJB 3V1NA 4JUAA 2C1XA 1RE0A 2ZUTA 2WQ6A 3E3LA 1IAQA 4CT0A 2VJLA 3BFKA 1JLLA 2ZYRA 3F7TA 3UXHA 4EUFA 2FG5A 3BRQA 3GUVA 3GDOA 1WB6A 4R9UC 3SEZA 3QYJA 2I91A 1MB4A 4DJEC 1KXJA 3GU3A 2WAYA 3PHJA 3E23A 2GK3A 5TJHA 4BEBA 2NYVA 1FP4B 1K7CA 1ADJA 2E37A 3RQSA 3V4ZA 4U0KA 4NK4A 3JQAD 3Q7IA 1NC3A 4UHEA 2QM3A 4X71A 2XV1A 2QVXX 3DWEX 4HB3A 3EAFA 3QKIA 3HV2A 5CH3A 3X1WA 5LN1A 5J3JA 4YUAA 4DE5A 2IYYA 4RABA 3BTSA 2ATEA 4XAQA 4YFVA 4NCJA 3H1GA 1UOPA 2XKBA 4NDZA 5IBQA 5ERYA 1U28C 4GEKA 5HTOA 2JJ1A 2P6MA 1ZXBA 2PO5A 2AC7A 4EJFA 1U2DC 3R41A 9LDBA 5KX5A 1CK4A 2EX4A 3CEHA 3W5UA 2B0CA 2BFPA 1ABFA 1PQUA 5KSYA 3ESAA 1FSPA 1HDEA 5KBYA 4O25A 4R6XA 3GGPA 1I6MA 1RBMA 3EGVA 3GLSA 2P6UA 3NZEA 1O6BA 2ZRQA 1TYEB 2ZIXB 4G5XA 5HF8A 1BCSB 1KEEB 4F71A 2AN4A 3AW8A 3RBVA 4W5WA 2ZSDA 1A7JA 1AMUA 3ZVKA 2Y0PA 4YQFA 4GKKB 3I5XA 5AESA 1F7UA 4L9WA 3W9SA 2PLRA 3UHPA 1WDWB 2EEZA 4X1YA 1SKYE 3WKCA 3DTNA 3QOXA 4BASA 2H1LA 2ADMA 1SZDA 1ZI8A 3GCDA 1BHSA 1RRFA 2TSYB 2OV8A 2J3HA 2P9BA 4YEDA 1MJGA 2X40A 4KDCA 5D5QA 5JZMA 2O52A 1YUMA 3E03A 2FMIA 2RONA 3GFSA 4K6KA 1EHYA 4RTPA 4AZ0A 4U7FA 4PBTA 5JFOA 1J5PA 1OLSA 3RG2A 5JCOC 1MPXA 5CP8A 3EK2A 4HEQA 3WDSA 3IUMA 1O77A 2AJLI 2B9EA 4BZQA 4XDZA 4D9JA 2NU6B 3BEOA 2WZCA 4DQ0A 3P0FA 2Y1FA 4KX3A 2IUFA 2AMJA 2ERYA 1V6CA 2FPUA 2JAOA 4JP8A 5BSEA 3TKYA 3UOWA 2V7VA 3HKCB 2VHWA 4KQEA 5D51S 1J1IA 1PDOA 1Y34E 5AW8A 1FDWA 2IY7A 4ALIA 3DULA 3SBXA 1NTRA 4YLGA 1OW3B 3CG0A 4Z0TA 2GMWA 2CLOB 3BXXA 1DC8A 1VLJA 4NCIA 4X45A 2H5LA 1MDFA 3NAMA 3DL7A 3PEEA 5LXTF 3TM5A 1BKDR 2NTYC 1X94A 2ATIA 2H3HA 3UTCA 5C3UA 3IVMA 1CZKA 3N8KA 5IASA 2QN2A 4RKEA 1E2NA 1LQ2A 1V9CA 2AXPA 3BMOA 4Z4CA 1ZIOA 3NGLA 4PCVA 2XEXA 4DGQA 4PTZA 3T4UA 1MJ5A 2V58A 4IMRA 4DT1A 2IU4A 5HOQA 3IEVA 4C7KA 3HKBB 4AN1A 1XQXA 4F1JA 4BVJA 1OBFO 3T1VA 4RS4A 3F49S 2Y0BA 4OK5A 3H2YA 3N5KA 1KWGA 3CLUD 1VJRA 4RPHA 5D86A 3VPDA 4TTVA 1OD6A 2G1UA 2QRNA 4GRDA 4UMDA 3ZVLA 4ENWA 3V4VB 4F9EA 5FJJA 2WICA 4YYZA 2V7WA 3L0IB 4YACA 4DDVA 2X22A 4TTPA 1QK3A 5AVXA 1Z4MA 1V2HE 1ESNA 4R83A 3KXLA 1MVNA 4ITVA 4LOKA 1ODSA 4ESVA 5B1SA 4KLNA 4KIFA 2OYSA 3H5WA 3UJBA 2ARKA 2H1VA 1GEGA 4DW8A 4DRZA 1FYDA 4B6SA 1NQAO 5G1PA 1ZJYA 2PUGA 1LLQA 2R7AA 2H1RA 1CRLA 2RHOA 3FVVA 4CN9A 3R6TA 2NUPA 1R9NA 5BSUA 3KVNA 2PZGA 1Z06A 3DDUA 4KDFA 1Q0HA 4Z53A 2ZR9A 1AD2A 5I7EA 4V0KA 2NYUA 4G89A 3ZQUA 2RMKA 2NV0A 4WBNB 3VUFA 1DOHA 1SBIA 5KI6A 1KI7A 2Z2XA 3A4NA 1U2GA 1YL6A 1ZK3A 4PZAA 5JD3A 4X62B 2H54A 3C7CB 4N41A 3LC7O 1HKHA 2OP1A 3DC2A 4R98A 4X94A 1RM3A 2Q7XA 2YWRA 1T3HA 3QRWA 4JZYA 4OGFA 3VJLA 1KRWA 1GPDG 4FI3C 4UUBA 2WIKA 5C4GB 3H05A 1DEKA 4QWWA 1BEZA 1IJBA 3G68A 2AOUA 2ZR8A 3HB0A 3UK2A 3ONNA 4L27A 2NXWA 5C5CA 2RGGA 4XDHA 4YCBA 1EB9A 4XM2A 4AJ2A 2W2PA 1DKOA 2DCMA 4RGVA 4IVNA 3D6AA 4Y6QA 2OPHA 5IF9A 3G9UA 1G9XA 1XD2B 1QLWA 3B3FA 1JJFA 3VVLA 2C7OA 3FTQA 4YA6A 4ZAFA 1PZGA 1D2AA 2QTWB 3PG5A 1K27A 1YQTA 3L46A 1EUCA 1OOEA 3SHTA 4RGQA 2R8EA 2RGEA 3ZDFA 5K6AC 2H4XA 3KDSE 4HQ0A 4YXWA 3GVXA 5BNTA 5A2QA 1ZCBA 4LHXA 2ADFA 2BZSA 4O4JB 2GEUA 3IB6A 2VATA 4FHDA 5DJ5A 5EE1A 3H5RA 4D7AA 1OB5A 4FD3A 3SIPA 3R7AA 5JRJA 3OOYA 3FDJA 4M0MA 2CVHA 1PR3A 4S3MA 3J7AC 2PM8A 4PAMA 1E5XA 3ENWA 1K5GA 5D3MB 1ODTC 4BQSA 3BWDD 3TTWA 5CG1A 5AOVA 5B1HA 3D6JA 2G1PA 1GGVA 2VPIA 1W1UA 2PUEA 3TF5A 3LGXA 1WWKA 1YTLA 4XYBA 5CVEA 3DXYA 2I6QA 1SHTX 1WXXA 1C2YA 3NTUA 2Q2VA 1U90A 2JBWA 3OBIA 3KR2A 4FU0A 4R31A 4IV5A 3DNPA 4L0MA 1XEAA 4M0EA 4NAUA 1AF7A 3DE0X 4HDRB 4DDMA 1H1DA 2ABWA 4NWIA 3TB4A 2RKWA 3D2CA 3VR4A 4ZCMA 2R3SA 2BGIA 4EPTA 4XWAA 4IQFA 1WKVA 2P8JA 4UEJA 1ZEMA 1ZC3A 1D09A 2I4NA 1K8ZB 2H5JA 1ULTA 3GRVA 4BVKA 3AUAA 2FN9A 3EXG1 3UJAA 5AW6A 4ZOEA 5KU7A 5DTQA 1T2CA 2XI4A 2H1IA 1LCIA 1KO5A 1RVDA 2W2VA 2YIDA 3KKOA 4MH0R 1JFTA 1QYCA 5GVRA 4AULA 1URPA 4B4KA 1GTG1 3KPJA 2HSWA 3DZKA 2PH1A 2F1OA 3CUKA 1VPWA 4NYIQ 1HEIA 4RIFA 1DFIA 3FFAA 4HAOA 4YRNA 1TFRA 1XRMA 5D1NA 2QKYA 4FGKA 5LA6F 3HK2A 3KEMA 2Z08A 3G2IA 3KKKA 2ZKIA 3TL3A