2AOTB

Histamine methyltransferase complexed with the antihistamine drug diphenhydramine
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
288
structure length
286
Chain Sequence
MRSLFSDHGKYVESFRRFLNHSTEHQCMQEFMDKKLPGIIGRIGDTKSEIKILSIGGGAGEIDLQILSKVQAQYPGVINNEVVEPSAEQIAKYKELVAKTSNLENVKFAWHKETSSEYQSRMLEKKELQKWDFIHMIQMLYYVKDIPATLKFFHSLLGTNAKMLIIVVSGSSGWDKLWKKYGSRFPQDDLCQYITSDDLTQMLDNLGLKYECYDLLSTMDISDCFIDGNENGDLLWDFLTETNFNATAPPDLRAELGKDLQEPEFSAKKEGKVLFNNTLSFIVIEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histamine N-methyltransferase
publication title Structural basis for inhibition of histamine N-methyltransferase by diverse drugs
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 105
structure length 286
sequence length 288
ec nomenclature ec 2.1.1.8: Histamine N-methyltransferase.
pdb deposition date 2005-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13489 Methyltransf_23 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2aotB00
3UJBA 5G02A 1WY7A 5DTRA 4BLUA 1G8SA 4QDKA 1DUSA 4F85A 2AN5A 3H2BA 3LDFA 2Z6QA 3R6TA 4RWZA 5H02A 5D1HA 3FYCA 1ZKDA 4KVZA 3S68A 3M33A 2OYRA 2ZSUA 3HCCA 1X1BA 3BGIA 5EEGA 3D2LA 4EVIA 5EKXA 4YUVA 5JR3A 2VDWA 1JTFA 4GOND 3KR0A 1AV6A 2CKDA 3MGGA 3OZTA 4MWZA 3M4XA 4EQZA 3E8SA 3SGLA 5FWAA 4RVHA 5FA5A 3EMDA 3DMHA 2YXEA 4E30A 2IGTA 2GAFA 2F8LA 4RTLA 4E2WA 1SG9A 5GP1A 4ER7A 4RVGA 5HZMA 1DCTA 4LWOA 3JWGA 3OU6A 3DH0A 2OO3A 3LDUA 3UJ9A 3ELUA 4EMSA 3LCCA 5F2KA 1Q0SA 5KYGA 2UZ4A 3Q87B 4RX1A 4BY9E 3B89A 5EMMA 1VP9A 1YB2A 4HG2A 4E32A 3NMUF 4YUXA 4E31A 4OQEA 2NYUA 3K6RA 5CVVA 4AX8A 2QYOA 4YV1A 1SKMA 3GU3A 1X1AA 3RIEA 3DLCA 1MJFA 2OXTA 4MIKA 1VL5A 1JQDA 2PX5A 4PYLA 5E1OA 2AOWA 3KR1A 3OU7A 4PCAA 3B5IA 1KR5A 1L3IA 1R6AA 2V74B 3DOUA 1JR4A 4XCXA 3KPUA 3DP7A 3BXOA 5FTWA 1PRYA 4DF3A 2G8NA 4R05A 2AOXA 1TW3A 3LGAA 3SSMA 1N7JA 5EQJB 3G2PA 4ZTBA 5T6BA 2PT9A 3A7EA 5EVJA 1ZGAA 2YVLA 5FA8A 3UJDA 4WXHA 4OQDA 3BT7A 4Z2YA 3FPHA 5DSXA 2PJDA 3C0KA 3X0DA 3R3HA 3P71T 3LHDA 4C05A 4Y2HA 2EG5A 3G2OA 5M5BA 2E5WA 2QM3A 3HP7A 2NXEA 4QPNA 4C07A 5E9QA 5KVAA 4PYJA 5LQRA 4E2ZA 1SQGA 4BLVA 2Z6UA 4RTPA 4ER6A 1KHHA 2BZGA 3LSTA 5DWQA 3BKXA 2R3SA 1SUIA 4DCMA 3TLJA 1L9KA 2V7EA 3R9XB 1EG2A 2AN3A 4OA5A 4PIPA 3CVOA 1X1DA 5FWDA 4E2YA 3CJQA 3DULA 4GOMD 4QQNA 2NXNA 4R6XA 1R8YA 3UJAA 3A26A 1JSZA 5ICFA 3G89A 2GB4A 4M38A 1YFLA 1O54A 3B3GA 4PWYA 5EEHA 2FPOA 4FR0A 5GIPE 5IKMA 5E9WA 1JTEA 3CBGA 3GIWA 3HA5A 3P9IA 3LL7A 2XYQA 1NW5A 3OCJA 2QRVA 5CUQA 3BWYA 2O0LA 1SQFA 3BUSA 5DM0A 3MCZA 5K0JA 2G71A 4V0QA 3EVZA 5GOZA 3DXZA 5DRTA 1KP9A 4DM3A 4L7VA 4PONA 5EPEA 4AZWA 4DCGA 2IPXA 5F2NA 3KQPA 2A14A 3LCVB 5DLYA 3DTNA 2ERCA 5DRYA 3FTEA 4QPPA 2BR5A 4E33A 2Z6AA 4BP1A 5DTMA 5K0LA 2FHPA 4YUZA 1G6Q1 1TPYA 2ZIFA 3DUWA 5DSTA 2P1DA 1U2ZA 3WSTA 4GC5A 3E23A 3MB5A 3T7SA 5LQAA 3HCEA 5DX1A 1JSXA 3GWZA 1RJDA 4RVDA 2ZTHA 3P9KA 1VIDA 3AXSA 1WG8A 2BR3A 1YFJA 5FUBA 1FBNA 3HCAA 5EOVA 2GPYA 2P7HA 1XCJA 5EMJA 5K03A 2OZVA 2C7PA 2NNWB 3LCUA 1NV8A 3NTVA 4P58A 3SVZA 2ESRA 4MTLA 3A4TA 3EVGA 3QOWA 1G8AA 2HMYB 2QE6A 3FTCA 4FSDA 4RSRA 4PNEA 4DZRA 4XUEA 2OY0A 5HOQA 1TW2A 1XDUA 2PVCA 4RV9A 2YQZA 3FUUA 2UYOA 1NE2A 2YTZA 3M6XA 5IH3A 5C1IA 5C9ZA 4GUAA 3MHTA 3M6WA 3V8VA 2O07A 5K09A 1F3LA 5CD1A 3AWIA 1Z3CA 4PYKA 2XYVA 1FP2A 1KPGA 1WXXA 2ZLBA 3KPWA 5HEKA 3G7UA 4CKEA 5CCXA 3KQTA 2C7OA 4OBWA 4R6WA 3TOSA 3UA4A 2VDUE 4H0NA 2BM9A 3E05A 3ID6C 3P9NA 4LG1A 2QRVB 5CM2Z 4HSGA 1QZZA 2ZVJA 3UJ8A 3GRVA 3AXTA 2IH2A 4FSXA 2UYHA 3KQVA 4YMHA 4X41A 3HCDA 2XYRA 3IYLW 3P2EA 1QANA 3JWIA 3TQSA 3TKAA 5F2OA 2ZZNA 4GQBA 1RJFA 1EQAA 3I64A 4A6DA 3HCBA 1BOOA 1RJGA 2BM8A 1AQIA 3CCFA 5CVJA 3PX3A 1ZQ9A 4HC4A 3JWHA 4PCLA 3UJCA 5HIIA 2P3LA 3EVEA 1ORHA 1D2HA 5EZSA 1XCLA 1P91A 5E8JA 5GM2A 1UIRA 2AN4A 3OE5A 5CVUA 3IHTA 4C4AA 3P9CA 1JG3A 2LD4A 3FTFA 2IDJA 1M6YA 4DQ0A 3MQ2A 2PX4A 5K0EA 4CKBA 5CIYA 3SSOA 3BGDA 2FYTA 5DM4A 4M36A 2JHAA 4X1OA 3LBYA 3OZSA 5BW5A 3MAGA 5EHIA 5BXYA 4RTJA 2R6ZA 1YZ3A 2EJTA 3THRA 1P1CA 1QAOA 2P35A 4CWAA 3C6KA 4GC9A 4BP3A 3IV6A 3QV2A 5EZQA 1BKYA 4P7FA 2FK7A 2QY6A 2CMHA 3IEIA 5FADA 5E2BA 1G55A 1RI4A 3FPEA 4M37A 1O9HA 2O06A 3SX0A 3RW9A 4B17A 1R74A 3OFKA 2PX8A 2ZW9A 3EVAA 3LX6A 4U7PB 3RODA 5K0GA 5LQKA 1KXZA 4CXMA 4PGGA 2OB1A 3FPJA 3B3FA 3DMGA 3TM5A 1FPQA 2BH2A 1F38A 3HCFA 3ELWA 2FK8A 1KYZA 3NWEA 3PT9A 3G8AA 4M7RA 3V97A 5K8VA 2FRXA 4RTSA 1YUBA 3KPYA 4OX9Y 1HNNA 1O9GA 1QAQA 4PYOA 3HA7A 4HGZA 3EVDA 4MHTA 4QVKA 3EMBA 3C3PA 7MHTA 3M6UA 5K0CA 4QTTB 1XDSA 1UFKA 3UBTA 2EFJA 3BGVA 2XVMA 4EKGA 4RTOA 2AOUA 1WZNA 1M0EA 3EPPA 4RTQA 1Q0TA 2ZULA 5DM2A 5DPMA 5BP7A 2JHCA 2NXJA 2WA1A 4PGHA 3PX2A 4AUKA 5EC8A 4XUCA 3NVMB 3Q7EA 3TKYA 2ZBPA 5HFJA 4KIGA 4PYIA 1NW7A 3G5TA 3TMAA 4XUDA 3KQYA 5B1SA 1KPHA 5EMKA 3TR6A 3P8ZA 4RTNA 2YXLA 4X63A 4YUYA 4KDRA 4RTMA 4QVGA 4HGYA 3K0BA 2B2CA 2ZIEA 4FZVA 3HVHA 1AF7A 3CC8A 5DTQA 1JG2A 3AY0A 3TPZA 2JHPA 2JG3A 2B9EA 2PBFA 3O7WA 1ZG3A 2B3TA 2JH9A 5K01A 2WA2A 1VLMA 1VP3A 2YUIA 3NDJA 4K6MA 2PX2A 4MQ4A 1I9GA 3EVCA 3SM3A 3GDHA 2NXCA 5MHTA 5DXAA 3DLIA 2Y1WA 4CTJA 1VQ1A 2FCAA 3PTAA 1KIAA 1R18A 5FULA 1NW6A 2YXDA 3OFJA 4FT2A 3KQOA 3ELDA 2AVDA 4PINA 5DX8A 5EGSA 1VE3A 9MHTA 1H1DA 3FUWA 4JXJA 4F84A 1QAMA 3KPJA 5GM1A 3JWJA 4DKJA 1JQEA 1XVAA 4C08A 5LQNA 4LWPA 1SVUA 4GBED 3REOA 1RI2A 3TM4A 2ZZKA 2PWPA 2I6GA 3A7DA 3BWBA 2N47A 4CTKA 4FT4A 3CGGA 2EJUA 4RTRA 5E2AA 2NP6A 4ER5A 2AVNA 2AOUB 3EGVA 4RVFA 5EIWA 5EKUA 1T43A 2PXXA 2I62A 4FGZA 4ISCA 1XTPA 5ICGA 2OPBA 1G38A 3ER9A 3QOXA 4PYNA 3O31A 2PKWA 3C6MA 3KQWA 5FHQA 3BKWA 3BWCA 2H1RA 2KW5A 3I58A 2JJQA 2PGXA 3LBFA 5E9JA 1YZHA 4U7TB 1D2GA 1EJ0A 1L1EA 2BR4A 3GXOA 3VC2A 4AZTA 2Y1XA 2AZTA 3SMQA 2DPMA 1NBIA 2H11A 2K4MA 4ATNA 2VP3A 2PXCA 4LECA 4E70A 2ZCJA 1INLA 4NECA 1IXKA 2ZIGA 1M6EX 4AZSA 2I7CA 2C7RA 2NP7A 1MHTA 2B78A 3GRZA 4RYLA 2ONZA 3NW9A 2XVAA 5T67A 3CJTA 5LQCA 3LKDA 1RI1A 5GWXA 5K0FA 3HNRA 4OA8A 4ER3A 3M70A 4KRGA 1EJ6A 2PT6A 5FQOA 3MTEA 1XXLA 2P40A 5KQSA 2PY6A 5LQUA 3GRYA 4O29A 3FPGA 3F4KA 2CL5A 3OE4A 4WVLA 2ONYA 4GF5A 5ICEA 3FRIA 4IV8A 5D1NA 2OKCA 1IY9A 1KYWA 2VZ9A 3G5LA 3PVCA 4P7JA 3KHKA 3GCZA 4C03A 4IKPA 3HTXA 1NT2A 2VDVE 5DXJA 3FRHA 2IDKA 2UYQA 5E1BA 4EK9A 3P2IA 2H00A 5DX0A 2P8JA 3VC1A 5LQJA 3GRUA 10MHA 3FYDA 2IP2A 3FTDA 1P1BA 2ZBQA 5LSAA 3KKZA 1BHJA 2PSSA 4FP9A 2ZZMA 8MHTA 2O05A 1FP1D 3HVKA 4C06A 1ZGJA 4F86A 2CMGA 2HNKA 2XBMA 1HMYA 1N7IA 3MERA 5FCDA 5K0NA 4X60A 2P41A 3EGEA 2PWYA 3PS9A 5E8RA 1B42A 4FS8A 1VBFA 5K05A 4OBXA 4YMGA 2PV0A 5ICCA 3A25A 2ZWAA 3ORHA 3R24A 3TFWA 4AZVA 2AOVA 3FZGA 3KPVA 1QYRA 3L8DA 4IWNA 4QDJA 5ERGB 2DULA 3FUTA 4KW7A 3SSNA 2IH5A 1NBHA 3G8BA 1P39A 2YX1A 3PFHA 3UFBA 4P7KA 4A6EA 4CKCA 1I1NA 2OBFA 3B3JA 5CCBA 3B7PA 4KDCA 3G2MA 4E2XA 4GOOD 2ZWVA 5HIJA 3EEOA 2EX4A 2PXAA 4V0RA 1X1CA 1RJEA 3PFGA 4HTFA 3KR2A 5KQRA 1OR8A 3FUVA 3EVFA 1XJ5A 3MCTA 5CVDA 2AOTA 3VSEA 4GEKA 5HIKA 3UWPA 3P97A 3GJYA 4PYQA 2AR0A 3DMFA 1WS6A 2AS0A 5E1DA 4YV0A 3UA3A 2O57A 4Y30A 5C0OE 2GS9A 3ANXA 3EGIA 3HA3A 3ME5A 1ORIA 1I4WA 4QTUB 4R8SA 4UOEA 1RI3A 1V39A 1WXWA 5FQNA 4YV2A 5U4XA 3I5UA 3KQMA 1NKVA 1R00A 2P7IA 3P2KA 3KQQA 1NW8A 1YF3A 3VYWA 3I9FA 2P3OA 3OPNA 4HRAA 5E1MA 3CKKA 3KU1A 4POOA 1PJZA 4PIMA 2ORED 3ER8A 3T7TA 1DL5A 3ERCA 2JH8A 1R8XA 3GO4A 3DR5A 3DXYA 2ZBRA 2G72A 1IM8A 3OZRA 3NJRA 5T64A 3G88A 4ER0A 1NV9A 3T7RA 3U81A 3HM2A 1BC5A 3KR9A 4R8RA 1EIZA 5P8WA 2UYCA 3NVKI 3G2QA 5BW4A 5EHGA 3EEYA 2I9KA 3AJDA 1JG4A 3UJ7A 2HV9A 1UWVA 4GOLD 4YUWA 3HVJA 4KWCA 1RI5A 1N2XA 3T0IA 2G1PA 3HEMA 5K0BA 2IBSA 2GLUA 3PLAE 2HWKA 3GRRA 5HIMA 2OB2A 2HR1A 2IBTA 3HVIA 5EG5A 4P7GA 1JG1A 2ZFUA 1NW3A 5GIOE 3MTIA 3KQSA 4G56A 2YR0A 4KIFA 5KS2A 2GA9A 4C04A 4RTKA 4HH4A 4HTFB 5EMLA 5GINE 2Q41A 3LKZA 2IFTA 2ADMA 1ZHFA 2CWWA 1D2CA 1JQ3A 1L3BA 2AOTB 3FUXA 3I53A 5DM1A 3UJ6A 3UZUA 1VPTA 2G70A 1AQJA 4X61A 4DA4A 2IH4A 1G60A 1EAMA 3GGDA 3THSA 3LDGA 2PLWA 3LPMA 2WK1A 3GNLA 4PYMA 5CVEA 5HILA 3CJRA 3EVBA 3O4FA 2VS1A 1Y8CA 3E7PA 2GH1A 3OU2A 2IIPA 3C3YA 3NWBA 5EIFA 4BLWA 1SUSA 3BWMA 3SXJA 1FJXA 3R0QA 3DXXA 4IV0A 5DT2A 3LECA 3TRKA 3FPFA 1L3CA 1XDZA 5FHRA 1X19A 2HTEA 3PB3A 3NDIA 4QQKA 5JUWA 2B25A 3SR4A 4DMGA 5LR6A 2C7QA 3ELYA 3A27A 3M6VA 1KPIA 4EKIA 3BZBA 2P3QA
chains in the Genus database with same CATH superfamily
1DKLA 4G4IA 5BWCA 3RYCA 1SD2A 4FC6A 1U8AA 5KINB 1OLUB 1FMFA 3ISJA 3ET4A 2WDPA 3BOSA 5EXPA 1K08A 3QNWA 5CAEB 2V6BA 1MTZA 1SVKA 2CGEA 3C3XA 4Q9HA 4CLHA 4ZDJA 3S68A 2YOGA 2C2ZA 2WWXA 3QVWA 3GFQA 4B75A 5KTSA 4M60A 5H81A 5EEGA 1OE0A 3LPCA 3AL3A 1J0CA 4F4HA 2OCGA 3P0FA 1M2VA 1V5WA 1V96A 4R2WA 5FNVF 4DCPA 2ZXUA 3A4NA 2IOQA 3NKLA 5GJVC 3BGWA 1T8PA 4FWBA 3VVLA 4CL2A 4TS4A 3T3NA 2D1FA 3A6HA 4V3BA 3G0DA 2GN9A 4XDZA 4AC9A 4P82A 2IGTA 4LC9A 3LY5A 4XM1A 4S1NA 2O48X 4KE9A 1HEIA 3EDOA 2POCA 1B73A 3E8XA 4FYPA 3IB3A 2NZVG 4G0NA 4CNBA 3MINA 3RWBA 2FPIA 3AUAA 3DLTA 3DONA 4B0OA 3EDMA 1CHDA 1XZCA 2JNWA 2Q5FA 4RFSB 5AVZA 4HZUB 3A11A 5JC1A 4YV1A 4Y6RA 3KSBC 1RRCA 3PSHA 1DIRA 4KQ9A 4RJKA 1Z2EA 3L49A 2G0TA 4OK6A 4NFYA 2YC2C 2OZEA 1FXUA 1N1GA 1U7TA 4PHCA 5A4AA 2ZYGA 1WZEA 3FYSA 4PYLA 1EJBA 1JFFB 3PYMA 1O94C 2E55A 4JX9A 1RHRA 3FYUB 5HE8A 2PBZA 3VPBA 3HVUA 3IUJA 4XQCA 1LGYA 3DP7A 2WIBA 4L22A 2RI6A 2CL7X 2ECQA 2O14A 3NJ8A 4MKIA 3T54A 1JR2A 3LGAA 3MFYA 3OZFA 2B7LA 1U0TA 1W4LA 3S2UA 4IIGA 1C0PA 4B3IA 4YIKA 1J9EA 4P38A 3V4SA 2VPZA 4IHJB 3AX6A 3IMFA 4LVOA 2J9XB 4Z2YA 3L1UA 2ZSKA 1LDNA 3QWAA 1N0HA 4TS1A 2GX6A 1GIAA 1T24A 2CNWA 2YZMA 3EA4A 4OMFG 3TO5A 4D9MA 1E4EB 1PJ4A 2F6RA 2NXEA 4JK3A 1OU4A 2F2TA 4MVWA 2NQ2C 3U6KA 4ZVRA 4PV7A 1W88B 2QSZA 2X1MA 4YQZA 1G98A 4PZ9A 4FHEA 4MIYA 4ZU3A 4C4YA 1IN6A 4EEZA 3CRW1 1ONBA 1MB2A 2COKA 4R81A 4R1LA 2AN3A 2NSHA 4L4ZA 4RVUA 1MMFB 3WGKA 4Y2RA 1L2TA 3NETA 2QN6A 4R6XA 5LLTA 4F3TA 2NTEA 2DFDA 1IBLB 5ICFA 1NI5A 3E2PA 3TAUA 4ZARA 3PSAA 1V35A 1M2HA 4QFMA 3TAHA 3RU2A 2BFDA 2DWPA 4HAYA 1EE9A 1SQ0A 3D5QA 3FWPA 3UMCA 1NUHA 3C7AA 4PAQA 1EK6A 5JPDA 3W9SA 2EARA 3VVCA 4JYMA 3RS8A 4HMQA 3UJ6A 3DFZA 3O4HA 1GZ7A 3RG8A 2A0WA 3WLEA 1JFLA 4O8CA 2N3ZA 1Q77A 3OLVA 5EZYA 5K3CA 4W5WA 4LX0A 4IKOA 2G71A 2BT4A 4V0QA 1KE2A 1G2QA 3O9VA 4JMPA 2GZSA 1Z39A 2A67A 3IPLA 4JZYA 4PONA 4WLVA 5F2NA 2IHBA 3C6BA 4GRDA 2FH5B 2I0FA 4RYDA 2OMEA 3ORQA 4UCXA 3IEVA 3DA8A 3FTPA 1KEUA 3W8NA 4YP7A 3KB8A 2WIFA 1E4OA 1CVLA 4DM7A 2E5FA 3C48A 5ICSA 3H2IA 1DXOA 4NCAA 1W0JD 1T5LA 4C0SA 2VJLA 2QDXA 2Q6TA 2ZB2A 2C1EA 2Y92A 1NLUA 2YJ6A 1QIDA 3Q0IA 5THKA 3VOSA 1ZKMA 2ZT6A 2O3RA 4RIHA 4R51A 1E9FA 2BDUA 2GCEA 5KHAA 1QFYA 5FOUA 4P58A 4UJ5A 1A2QA 3LUKA 1B4DA 4F11A 3A4TA 1YS2X 1MEJA 3C6XA 1EFAA 4A03A 4E5SA 3QA3E 4M1EA 5GONF 4LVUA 3D8NA 2BL4A 3KSRA 4WZBE 4ZREA 5B6IA 1J22A 1NNUA 3CZ5A 3N2GB 4OKIA 1U9IA 1JI0A 2J6IA 3B8HA 5C1IA 4IH9A 2GN6A 4UU1A 4N3GA 4PQGA 5FNZA 4BFCA 1IHDA 5FWNA 1N3BA 1PBTA 2H48A 2VUHB 1YBMA 2I80A 1YMUA 1JDUA 1Z36A 2XE6A 3HXKA 2WU3A 3KOYA 4S35A 2ZVQX 3ZZUA 1LZKA 4LHZA 5BUSA 5KYYB 3UT6A 2ZEJA 4LHEA 1NMSA 1E79A 4LG1A 2Y93A 4LMBA 2QRVB 2XCOA 3RFTA 3UJ8A 3LD9A 5EJMA 4EFDA 1Y9AA 4X41A 1EFUA 1FMTA 1SVWA 4HLUA 2RGRA 3HO6A 1RJFA 3HKCB 5I8PA 1ZI6A 2BP7A 1B14A 1P77A 3ZV6A 1MENA 4DOMA 3IKLA 2ZETA 3QHPA 4HMOA 1UBFA 4M6WA 2JA2A 2PGNA 3GP5A 5DYYA 3EGXB 3VBEA 3ZBTA 4RA6B 5AOAA 1XCLA 1XU9A 1JEAA 2H17A 2AG1A 3QPCA 3O4GA 3BQNB 4TUYB 5JIBA 1FK8A 2JK0A 1S96A 2HIGA 5IBPA 1FNSA 5KMGA 4DQ0A 2OO7A 5F12A 1HTBA 4Y9DA 5DM4A 4M36A 3PEWA 3W2IA 1CUSA 1A88A 2FX3A 1ZGBA 1AK2A 3AY3A 2W2MA 2Z4RA 4QEKA 5HUJA 2H0AA 3E9EA 3OJFA 2P35A 3VU9B 1CJUC 1X1QA 2ZRBA 3T9DA 5JMOA 4B71A 1PEYA 4WINA 2G5GX 4QAJA 1QB7A 5B2FA 5KC8A 4ALNA 4G1CA 3CW2A 3TI9A 1G5TA 5A7HA 5DNEA 1ODIA 2I2AA 3CUEF 4JAVC 3FVVA 4RHFA 1UH5A 2Q7XA 3X2EA 3GJ3A 3DEYX 2ZW9A 3DBLB 1ELOA 1XI2A 3OZAA 3FPKA 4U7PB 3RODA 1I10A 2Z2JA 1GGHA 5F7OA 1U2TA 2G5PA 1MOPA 3SX2A 5A4JA 2GK4A 2R47A 4RD2A 4PGGA 1N6OA 5DGHA 2OB1A 5SY9A 5JH7F 2NW6A 4FKBA 1OHHD 1FLVA 2GVZC 2DHCA 2H5LA 1FRZA 1PNOA 3PT9A 3RVMA 4QNRA 3G8AA 1C80A 2ZAYA 3DDZX 1Y81A 2IY8A 3BQMB 4UFNA 1QHFA 2QZZA 1UJ6A 3I39X 3KFXA 4F4FA 4YRGA 4PF1A 1MX5A 3BK1A 1SHTX 1QLJA 3FZYA 3L7YA 4HGZA 3RSGA 3O8QB 1GG5A 5DK4A 4BVJA 3U7FB 1MT3A 1UFKA 2Z5GA 2EFJA 1FP4A 4HB2A 2HHHB 1J49A 1QYWA 4OBEA 2IYLD 2C58A 2FPIB 5CT6A 5DDIP 4C4OA 5EESA 4EPRA 1QV9A 1GCIA 2NXJA 4V0SA 3HLKA 3E22A 1CJCA 1F2UA 2QJOA 3C6QA 3EWSA 2YICA 4OF4A 3TQIA 4BGIA 6PFKA 4D0SA 3SPXA 1UC4B 4FMPA 1JA9A 3G5TA 5FA6A 3QKTA 5C7YA 5JECA 1U0JA 4ZC1A 4YRTA 3ZHXA 1VJDA 6LDHA 3K5PA 1RQ7A 4K6FA 2NU8A 4XYMA 2YN2A 1CFZA 4O25A 3UOAB 3JASB 4GDFA 4ZOLA 1Z22A 3A6LA 1GDTA 3GLGB 3BBLA 5IK2D 3HO8A 4R9NA 1TF2A 1VG1A 3V48A 2FJPA 4MS3B 2PX2A 1CU1A 3UAVA 1J0XO 5CXSA 4EOGA 2PYDA 3V9PA 2FN3A 3EZ7A 1U9IC 2FWIA 4CF7A 5JTUA 3TSCA 3WIDA 4JNCA 1QBKC 9MHTA 2XOKD 4EA9A 2RGBA 4XD7A 1HDXA 1RQXA 5K3OA 1PJSA 1JQEA 3RWOA 2V6JA 2ZYVX 1RWVA 3EB9A 3MCVA 3USZA 2VTKA 3TD6A 3H8WA 1M2WA 2UXBB 1DG1G 2FQ1A 4HLUC 2V7VA 3SS9X 4DRXA 4M0DA 4O1HA 3HADA 3C1OA 5D7NA 5FJIA 1H2YA 2D2XA 4YT4A 4QM7A 2G25A 2I62A 4FSHA 4JBXA 4MZXA 3ZHBA 1KYVA 2X9LA 3DPIA 4XWTA 2I8AA 2W7TA 3BHJA 4CM9A 2PKWA 4WESA 4MQEB 3ZQKA 4FBLA 4I14A 3VPDA 1O0SA 2XCLA 3R6DA 1RYHA 2VHXA 1B6GA 1EJ0A 5AVWA 1DARA 1K8YB 4TYNA 2CEAA 1MVNA 3DMPA 3SIPA 2Y1OA 3KV1A 2BZ0A 5DGTA 3V5NA 3SEQA 3I6ZA 1ZVQA 2WD9A 5DMXA 1A97A 1AGNA 3MOIA 4FLEA 3UMJA 4MRVA 1FX0B 3VMMA 3VV3A 3LKDA 5GWXA 4ER3A 1QSGA 2JLZA 2XBUA 2I7DA 2BFEB 2APJA 2PT6A 1KIMA 1D2EA 3IBFA 3ZHCA 3UK0A 4WY2A 4FI3F 3BIXA 2CUNA 2XJ4A 3S99A 4DBZA 5F7XA 2D3WA 3HS3A 3SLGA 2E6KA 3L8MA 5G1OA 4ZVUA 3H2ZA 4FFMA 4N82A 2UV8A 1P3DA 4L50A 4MUAA 4XDYA 3IO3A 2GPBA 3LQKA 4WKPA 3KHKA 1HYBA 3GCZA 4JLPA 4YDQA 1I6WA 1Y4AE 1G3UA 1GNSA 2ACEA 2UDPA 3EAQA 1SC4A 3GUYA 3OLYA 4OIFA 4R8VA 4D0GA 4GICA 9GPBA 4G5SA 1YZTA 4JOQA 4DDTA 5JANA 1BVUA 1VCMA 3MS2A 4N5HX 1WB6A 1E2LA 5FUYA 1ZMXA 1Y1QA 1JH8A 3DCYA 2NSDA 4BC1A 1BE1A 3C14C 4EI9A 1DEKA 1FX1A 5JI2E 1RXIA 3HDYA 4YRQA 3K0AB 1V16B 4N5MA 2QD5A 1R37A 4WV3A 3U1TA 1SXHA 1CC1S 3A1NA 3D6UA 5E8RA 5JDIC 3Q12A 4UKDA 1RHUA 2Y71A 5CT5A 1BZYA 1VJCA 2DBZA 3IQZA 1W7AA 4L57A 2Y2VA 1PFGA 1GSOA 1P4GA 5LUBA 3L4KA 4X44A 1KEWA 1G4HA 4G0MA 4J1TC 4PQEA 3T35A 3FUTA 2VQSA 1HY3A 4QUHA 3HRIA 1P39A 1HA3A 3KKPA 2Q5IA 2WZCA 1I1NA 2A0YA 3PL5A 5FBQB 3SK0A 4AUNA 4U7HA 4E2XA 1IWBB 3MJTA 2ZWVA 5KIAA 2RBKA 2WQ6A 3SBDA 5IDXA 1QPZA 4TYWA 4AY4A 1ADGA 4ZIRA 4IJVA 1HDOA 1II8B 1Z35A 2C3OA 1HR0B 1R9JA 3UWPA 3SYLA 1AXEA 1WS6A 1X1SA 2VDPB 2HWXA 4L6IA 4L9RA 1W4ZA 5KMGB 3AUTA 3I8OA 1JEEA 3IHKA 4TZKA 4KSYA 5AICA 4Z0TA 2AF4C 4RWEA 1THZA 3ZIUA 3UAZA 1HSZA 1L7PA 3DWIA 4GM0A 1EP9A 3H19A 3KQQA 3BXEA 1SULA 3E4DA 3K8QA 2RAUA 2PSFA 4OYYA 4HRAA 3KLNA 3TX2A 4KV7A 1RRFA 3B53X 1TE2A 3PNYA 4IS2A 1QZTA 5FBKA 1DL5A 3AVPA 4QIHA 5IASA 4MWOA 5EKDA 4YACA 5EIXA 4KQ2A 5ETJA 4US1R 1JHQA 4Z0PA 1K8RA 3UMRA 1NV9A 4JS0A 1GUAA 3W3AD 1RRKA 1D4FA 2P77A 2K5UA 4HAXA 4MQMA 5HCUA 5T4EA 3WYDA 4DA9A 4D74A 5EHGA 3D6HA 3MTDA 1IXZA 3AJDA 3PU6A 4ZEMA 2I9KA 3HV2A 5J2TF 4PZAA 5HIMA 2C95A 1NUSA 1E2FA 1A04A 1QOZA 2CHQA 4JY7A 3FOCA 4WGGA 2NTJA 4B7UA 3ITEA 5KQLA 4F0JA 2ZYWX 2O9JA 4WY8A 2WD7B 4HH4A 4I5DA 5EMLA 4M9CA 1DDIA 4DLVA 1FP4B 1Y33E 1NQUA 1RXYA 2JKZA 1MH1A 5C8YB 2L19A 2Y76A 1C14A 4V0NA 3UZUA 4AJPA 2ZIZA 1IU9A 3QVUA 4X61A 2WW8A 2IYXA 3RHSA 3TTVA 2IYPA 3A0RB 4B6FA 1SHLA 2JJMA 3E22B 1VLHA 2G63A 3K70D 2WHXA 1XV5A 4OGKA 2VQEB 2VS1A 5JCOA 1N5LA 1CEEA 2JA1A 3R5JA 2FEXA 2IY9A 4IG4A 4H16A 3LKVA 5KVCA 3NM6B 1L3CA 3ER6A 3KSDO 4ZOLB 3SQOA 3O92A 1POWA 1HURA 3OMXA 1XFDA 4EA6A 3PQ6A 4P22A 3A27A 2V5UA 2C7QA 1JHPA 1PG0A 4EDFA 3P52A 1G4UR 2B8TA 4KWIA 2ZRFA 4N7BA 2OGTA 3G2HA 2DKFA 1DKOA 3AEUB 3ANLA 3A32A 4QDKA 4F85A 4W5OA 3BIWA 3JQ8A 1U3GA 2CXXA 5A6VA 1DIAA 4BB9A 4QGFA 1TZMA 5TT1A 3H2SA 3EDRA 3AF1A 3FYCA 2VJDA 4PXYA 5DYGA 2F90A 3TDNA 4OHYA 1Z88A 2ZSUA 2OFXA 2QMYA 1QGED 1JI3A 4NCNA 3ILYA 4RS3A 3RGGA 4YCJA 2ID9A 3H65A 2CLHB 2VH2A 1RAFA 1KP3A 4QATA 4M0FA 3A9WA 4BMZA 5CB8A 3D3EA 1JP7A 4DCTA 3PHCA 3LXRA 1VPDA 2B6NA 3BFVA 3K92A 4DPKA 4NJMB 2I1VB 2EKPA 3E5RA 5FKJA 1GUFA 2DECA 3TEMA 1XT6A 3GVXA 1GUZA 3PVZA 1XDDA 4B48A 2X4LA 1OVMA 3PA6A 4G5OA 1H3FA 3WRWA 4ESHA 5KTPA 3MWYW 4UCQA 3C8MA 1SU6A 3HGQA 3IAAA 2BBSA 3V4ZA 1WABA 1UBJS 3VBCA 1ZUWA 2HFKA 4JYZA 4GL2A 2WKRA 3H83A 3VKVA 3EAFA 4MWEA 3GELA 721PA 5BT8A 4HAVA 1X1EA 4KLNA 4X7BA 1E9DA 1R4MB 2G88A 4FMCF 1EVQA 1SHZA 3BULA 3KTAA 3V6MA 2GEKA 2V0GA 4WLEA 4BE9A 3A1WA 1SGWA 4IHKA 3DHNA 2KLHA 1JU3A 4DUYB 2A1TR 2OV3A 2ATXA 5KPDA 1II0A 1DVRA 4RVCA 3NPAA 1IBMB 4K5QA 1RZRD 4G0ZA 5GONA 2VQFB 3IUNA 3LXXA 1DBQA 4WJZA 4C7XA 1NFQA 1RRGA 3AUFA 1K75A 4TWRA 5BPHA 2Q4BA 4YR7A 3PGJA 4EY4A 1QX4A 4LKOA 4XQ9A 3Q72A 1N25A 2D5LA 1OBFO 1AURA 1XLUA 2HPVA 4PYJA 3EIHA 5K0TA 1XZGA 3KCQA 4L4SA 1WD7A 3W04A 2ID8A 3K4PA 3KOWA 1JU9A 2QUIA 2R3SA 1A9QA 2XE7A 3IAM6 2XRYA 3BRWA 3C2QA 3Q88A 2PGIA 3H6GA 3TL6A 2GD0A 4IFEA 4MNTA 4B8YA 4FS3A 2CXSA 4GI7A 2RG7A 1XK7A 2X2FA 2NVUA 1NMQA 1HNXB 2ZB3A 4G3XA 4TSRA 5M7EA 3AQIA 4QGAA 2OTCA 3K05A 5KX5F 3LC1O 3L4BC 1F3OA 4G36A 5I45A 1JA0A 4ILEA 1PT7A 3D6TB 2ZJ0A 3KXLA 3PC6A 3DEFA 1AV7A 5ESRA 3ZHSA 2VHJA 2R751 3GEDA 1Q2XA 1QO0D 2O2HA 4AMVA 2VQDA 5GADl 3EVZA 3JQQA 1D07A 1ENOA 1V1RA 3DXZA 3EUAA 5JZ9A 2I1LA 3H5VA 5K5EA 4H7IA 1G8HA 3OQHA 4IP0A 3EW7A 3U7HB 3DYIA 2HF2A 2XVZA 1XQ6A 1TIPA 4KO3S 5H9VA 2R1ZA 3EPRA 3FTEA 2FHPA 4E46A 4L4YA 5E4FA 1HYQA 1ONOA 2Y66A 3OF2A 4PVDA 1A95A 3WSVA 1F60A 3U3RA 3V8NA 4QKQA 4HNVA 2C2WA 4L74A 3RYTC 5HYVA 2G0NA 4Q82A 4DB2A 3RIGA 3H97A 1IQRA 2O3TA 4GPD1 4BNTA 2AFRA 1IK4A 4JJ7A 4QOJA 1RKXA 5EUQB 4EGJA 2P7HA 5BY2A 5JH7A 4LF5B 2D1YA 4KC0A 2OZVA 4S24A 5JSQA 2VAWA 2AQ8A 2H06A 4JGGA 3DLBA 1N8KA 4IM7A 4JVMA 2DYKA 1G8AA 2WSIA 3KTOA 1PL0A 1JR3A 2QE6A 3V2HA 4BO5A 1J1IA 4N5IX 1PHPA 4RZSA 4D9FA 1YS1X 1B8UA 5AK5A 4HT3B 1NP7A 2HIHA 4BVFA 3VR6H 2QN8A 3ZKAA 2QQEA 4K46A 2O07A 3SKXA 5CD1A 3OM0A 2Z3WA 5HOEA 1FP2A 1V95A 3ONWA 1Y4DE 2EWWA 4HWRA 3FTNA 1QRDA 4HWGA 2H85A 4QNMA 5C5IA 3E05A 4O0LA 2WHQA 2OO5A 3K3PA 1ZK3A 4ZU6X 2V7BA 3E1GA 4B31A 2ZVJA 1OBHA 5C80A 1PLLA 5IVKA 5GAJA 3PVSA 1BWRA 4ZYYA 3S6JA 1OILA 2LDBA 5AP9A 5TB5A 2JLRA 3FZEA 4G8BA 4GQBA 3WQRA 2GWHA 1J25A 4KYUA 4NE9A 5B7QA 1F6WA 2MU1A 1ZQ9A 1SOUA 5D84A 3OCYA 2Q5JA 4CFYA 4GP9A 5GZ3A 1UBTS 4XI9A 3ACBA 1N0VC 2OLKA 4GHWA 3QE9Y 2ZSDA 5AKYA 3ZHVA 3BJRA 4LYEA 4JASB 4ESOA 2VJBA 5HBRA 4Q47A 1T3SA 3ABRB 4IIJB 2YJNA 2O2GA 3DAFA 3GA5A 4WADA 1SKYB 1LTQA 1J0AA 3I2YX 4BPRA 4ZI7B 5KOHA 1R5OA 5BW5A 4NWIA 4X66B 2RB5A 4RTJA 4Z9XA 4HDMA 3WDSA 2I29A 1XMSA 1GGNA 4CMIA 1W4RA 1RJWA 3DKPA 4NZ9A 2J5QA 1I6LA 2O4UX 1HGXA 2C97A 3RC7A 4F7DA 3DE2X 4YDSA 3WTCA 4DHEA 4ZEVA 4C29A 2MYUA 1E1LA 4QOGA 4QLBA 2SKCA 4JLKA 1FRVA 2ZP1A 1GQYA 3MBOA 3JQ8B 3ZHTA 5LQKA 1T2CA 1NJSA 3UW1A 3F4BA 1JLRA 1OKKD 1RHKA 2GTHA 3B6KA 4BO6A 1WW3A 4HDCA 2OLEA 3U09A 4NCJA 1EDOA 4UHBA 3A1DA 4LK2A 3VR3D 3EMVA 3F96A 4W6ZA 3NWEA 1SUAA 2BONA 2CLKB 3ECSA 5HP4A 1JYEA 2X0IA 1BMDA 3FCUB 4Q4LA 5HJ5A 4DARA 3CO0S 4I55F 3OQPA 4K9LA 4PYOA 3WB1A 5KYTA 3QUSA 4HDKA 3IODA 1K4KA 1GA6A 2HB6A 2CJPA 3JZAA 2OL4A 1H94A 4N3NA 4OP3A 3FSRA 4QTTB 4Q4JB 2Q50A 2JFPA 4LYFA 3KSMA 2WZQA 4IXNA 4MRAA 4ZRNA 1C41A 1EZ1A 1M5TA 1DG9A 1MJNA 3OZBA 4KJZA 1HZZA 4C0LA 4LGYA 1YHNA 4F2PA 1OFUA 3I4CA 2J9GA 1RRVA 1FLAA 3H2HA 3GMSA 1J8MF 4OM8A 3KZNA 4B6EA 2P68A 2WTUA 3TMAA 3PWKA 2FR8A 4MYSA 8ABPA 4I81A 1PDOA 2GEBA 3ENNA 3KQYA 4M8IA 3V55A 4EJFA 4MGEA 1I5RA 1BXRB 2YXLA 2VJYA 3HUDA 4RHCA 1QHHA 4TKUB 1RHJA 5EZ6B 3UWSA 4RTMA 5CIQA 1P62B 3W0LB 3SQDA 5CPBA 4E7PA 4KBGA 3UYKA 2WABA 4BQPA 1G7CA 1Y7TA 3OSZA 2P9JA 3T94A 3UXMA 3LYUA 1ZG3A 1J2JA 5CDUA 4KR6A 3KUUA 1X87A 2X4IA 1O6CA 1L1FA 2XE4A 1I9GA 3HJNA 3C8ZA 2V97A 2BKUA 1HYEA 2O4CA 1JJBA 2Y8EA 3Q9SA 1ZEMA 3R3ZA 1ZH0A 4PHHA 2WG0A 3AFNA 4K9NA 3G6KA 2BUCA 3SOZA 1VE3A 3EQ6A 3HCOA 3WLMA 3JY6A 4YQFA 3IIJA 4CQNA 2X5OA 4MGKR 4EENA 1XZBA 1W1IA 2OO5C 4Q1DA 5KNDD 4TKVB 3W9YA 3O3OB 3DVSX 5KU1A 2M6LA 2WFLA 3NKVA 5B6JA 3LLSA 3QE4A 2QLFA 2BSAA 1VGQA 3AR5A 4FD2A 4FT4A 2EJUA 3M4ZA 2OPHA 3NEPX 4UDYX 1DJLA 2PRKA 3EGVA 3LOQA 3QBTA 5BUQA 3HXMA 2C8JA 1YAHA 1XZMA 2ZQ5A 3EBPA 3OCWA 4G9EA 2NVUB 3NAMA 1IZYA 4PTLA 5FH9A 3PKIA 4W63A 1PN3A 1WMDA 4PZYA 4ZEWA 1QYIA 4HFRA 2PJUA 4YC7A 2YHAA 1WUKS 2F7SA 4EJSC 3GG9A 2I91A 5SYNA 2RHRA 1M2FA 1YZHA 1ZH8A 3QG1A 3GXOA 3MJCA 2FUCA 3OP4A 4MO9A 5ALOA 3EE6A 4RPLA 4UAJA 4Y18A 2DUWA 1P73A 3NAQA 4JEUA 2EFYA 3WLTA 4TTIA 3HEBA 4EHBA 1LF5A 3DBOB 7REQA 2NZXA 3HYCA 3ND5A 3W9BA 1Y6GA 4QHTA 2GGSA 2CB0A 5ER9A 2Q5HA 4H3VA 5B30A 1V5FA 4N3AA 2C20A 5A1JA 1X92A 3MWDA 2NV0A 3THXB 4QM6A 1NMEA 4C0AC 1F1BA 2Q4OA 3QELB 1QHIA 1MO6A 1RXSA 1PE0A 2H4HA 4R7TA 2A9JA 4IDEA 3AFIA 4UJ3A 4GF5A 2C5EA 1KC3A 2JJ2D 4ETNA 2V7PA 3ZE9A 1T2NA 1S01A 3E9ZA 4BUZA 3D0QA 3WGTA 3LFHA 3D3JA 1MA0A 2VZ9A 4C03A 2C0PA 2EZUA 4X8OA 2AQIA 3UAXA 2OFPA 1KBQA 5KTTA 1NF3A 1Q44A 2AF3C 3ABOB 1TB4A 3LPLA 2WINI 4R0VA 4XWAA 3HUTA 2ZI3A 1G1MA 4IQ0A 5UKDA 2YOHA 1KAQA 1Q19A 1YA4A 4MI6A 4DGSA 2ZBQA 3JQGA 5IBQA 3RJZA 4C3OB 3BFPA 4ALIA 4EL5A 3CM0A 1TUBB 3OTHA 2GJAA 4KRYA 1DRJA 3ZHRA 3JSAA 4D8XA 5JSKA 5J2UA 3ZD8A 1E18A 1VMAA 3VKWA 3NI2A 4FJ1A 2G5CA 4X9XA 4PLZA 4W4TA 4BB6A 4DMUB 4DM4A 4D4GA 1Q50A 3HZHA 2Q3LA 4JSRA 4KQGA 1ISMA 4BQRA 3PZRA 5JYBA 3H4VA 2AMYA 1RWBA 1PR4A 2C54A 2PH1A 3HRHA 3NUGA 2Y0EA 4UHCA 5CHEA 4CLOA 4ZGBA 1L1RA 2FQWA 3KFVA 3L8DA 3H87A 3ESRA 1QYRA 1HZZC 2OCXA 3DHYA 1VFPA 1YHYA 4FI3C 4MQ5A 2ZAGA 4NFSA 4BMNA 2JAUA 3G8BA 3IUMA 4J16A 2YX1A 3FB4A 4LZZA 4M1WA 3KUXA 4YBRA 4YJ2B 5A9SB 1LPMA 1Z0UA 1UADA 2FR8C 4ITVA 4ARBA 5CCBA 3QH4A 4KACA 3ZY3A 3KQHA 3KQKA 2OG1A 1F8XA 1MGPA 4UFOA 3VR5A 3W5DA 1OFUX 4EB8A 3UUFA 2R1UA 1XKXA 2WI8A 3QVJA 2XUOA 2CL6X 1VHTA 3WX0A 4TKMA 4DJ5X 5HIKA 3ZNOA 3TEFA 3P97A 1M0WA 4GR5A 5DNVA 1CNFA 4WJKB 1OX5A 3UQZA 3ZDXB 4HNTA 2DAPA 3RFFA 3OF5A 4LGMA 1WKCA 1O03A 2VYVD 2I5PO 2R62A 2WWWA 3I8SA 1M33A 2K87A 4NX2A 1QRUA 4Y3UA 3T7DA 1L0BA 4CMIB 3ZXSA 3IQFA 3F6PA 4LV8B 2UXDB 1GPYA 1E69A 1TZJA 3RSLA 1M8JA 3OPNA 5GJBA 3QEOA 5HHTA 3D0OA 4N03A 4TYYA 4NS1A 1N9KA 2Q5OA 3P9RA 1FNCA 3TK1A 1P7PA 2PE5A 2ZBRA 3K20A 2HOQA 3NASA 3AP3A 3CNLA 3KOUA 4LHVA 4D25A 2VLIA 2ZJ8A 4WGFA 1WOMA 4HRXA 3TIFA 3WV4A 1AMNA 3RF6A 4RKFA 4CE6A 1FFDA 5P8WA 1ZK2A 2BJHA 3I12A 4KIWA 2EHJA 3RIMA 3EX7C 1YNOA 4RQUA 1CNEA 1E7RA 4HPXB 1YB1A 3IVGA 1UJNA 1CIVA 3GRRA 4Q16A 1IFXA 4ZP1A 4WUTA 3AIMA 2JF0A 4LN1A 3N07A 1AMOA 4JI7B 2XRFA 3G82C 2DPGA 5ALMA 5HA5A 3HY3A 1M1XB 2CDRA 1LNQA 4JBYA 3AFMA 1TT7A 1O5TA 3MPOA 3DT8A 3RARA 4E5NA 1G2PA 2OHGA 4EB0A 1AHIA 2IELA 4MV0A 1K86A 2DSNA 1NVWQ 1ZHFA 4MULA 1JQ3A 2PUJA 3QHAA 4LKRA 2J0UA 3JCZA 3MHPA 4MZDA 3S3TA 2G70A 2NXWA 3JARA 3AM1A 2VG8A 3GT7A 2C2KA 3CSDA 2QI9F 3ABSB 3DMTA 4PPFA 5THQA 3GNLA 5HILA 1HE4A 1ZM3A 1N6NA 3IKJA 3NQ41 3IJ5A 1IUKA 4URFA 2H65A 5EIFA 3K73O 3L7MA 1CQPA 3MXOA 3CVJA 5BQFA 3TYXA 3ZD6A 3UH1A 4D42A 1XWFA 2WTAA 3R0QA 4LRYA 3UBMA 1UBLS 3F6SA 8AT1A 1DC4A 1Q7EA 3DEKA 5JNLA 1U31A 3VNRA 3C39A 4YAUA 5A4IS 1FS4A 2X76A 1KZGB 2FZKA 2Z2IA 3F8WA 2CLFB 3SC2A 4TMVA 2H4XA 1EEHA 3H9CA 4LXGA 5B7GA 4W8OA 3UFXA 4IFIA 3W4IA 4FQ5A 4RWZA 2PUWA 3QEMB 4XB2A 3VYTB 5D1HA 1SU8A 3FTQA 1HG1A 3C8UA 4DCCA 3E84A 1KNQA 4MKGA 5JAZA 2JDID 2G9RA 2V9CA 1JXQA 2HEIA 1HWYA 4FU0A 4KL8S 4OQYA 5ECYA 3CVWA 3L0IB 1MOQA 3OY2A 1L7XA 5ENDA 4Z5XA 5KX5A 4M46A 3ZUPA 2CKDA 2ZYHA 3MGGA 1TQ6A 1T36B 1PJCA 4YJFA 3UOGA 3DNFA 3S8EA 3UMGA 2WFLB 3PNSA 2PGOA 2PZEA 3QKRB 5AJXA 2NIPA 5DGIA 1ZNQO 1NU8A 1EE1A 1GUYA 2KLBA 1PEKE 3ESAA 1P9WA 3UMYA 3N28A 1DCTA 4RZQA 1MQAA 2PK3A 3WHIA 5K4GA 1X77A 5TQ0B 3QPBA 1V4NA 1BMQA 2VHUA 3KKOA 3LCCA 3RRYA 3WLHA 4FR5A 3O8OB 2QVXX 1XU4A 2ISQA 1YB2A 2JASA 2ZUTA 2AFVA 1G6HA 3H9UA 4WK6A 3A05A 4UMFA 2NPOA 5E0OA 3GU3A 4US0R 1OIWA 4QXAA 3SZGA 2HTFA 2YN4A 1XTBA 2IUFA 2DC1A 2A5FA 5AKLA 4RKRA 2QIOA 3ORRA 1SIBE 4JUCA 5BMOA 1USKA 1HDZA 2QGNA 4XJXA 4G0WA 3MWDB 1PL7A 4MS1A 1W5TA 1XDBA 5ARBA 3CRQA 4KQMA 5FTWA 1OW3B 4ZOCA 3DZDA 3DO6A 2IYRA 1CQXA 4UXHA 4Q4AB 1ZONA 2C59A 2DY0A 1UWLA 3HQ4O 2C9OA 1DJPA 2YVLA 2I3BA 3OPVA 3VNQA 4UFPA 4L76A 1Q92A 4LOIA 2V7UA 2P2DA 2IVZA 1ESNA 2CMDA 3H1AA 2XJ9A 2A88A 5DSXA 7ABPA 4I1PA 5IAKA 4Y9RA 1XZEA 3SC4A 1HZJA 3IE2A 3KLMX 3MWGA 1I4TD 4GH5A 2I4LA 1JKXA 4QL3A 4E94A 2BF4A 5C1DA 3NH9A 3F90A 4G63A 4A8HA 1SUDA 2QRUA 2BTOA 4OV6B 2EJVA 5J2UB 3LSTA 1U0SY 1OC4A 5TNXA 2O59A 4G0XA 1U9ZA 4HN9A 2OD9A 4BASA 4HCJA 1BDJA 4L0MA 5FWDA 3S2SA 1DAKA 1CDZA 3FDIA 4KFRA 5GJCA 3TUZC 3A26A 1OBOA 4M38A 4PRYA 3Q7PA 1W8IA 4FR0A 4H6PA 5JS6A 3DMTC 2VDQB 1PZHA 2B4TO 5LP6A 3Q11A 1IJKA 4KOAA 5AVOA 1FC0A 1QYVA 1MQSA 2LRHA 3AG6A 3QZUA 5AJYA 5KNCD 1TLTA 2HL6A 4BKOA 4D3SA 5BSFA 4R0NA 1LTHR 3RS5A 4RXUA 3T3IA 2H4JA 2XGGA 1SUCA 1XF9A 1XTUA 1QWSA 2CVOA 2VT7A 4X5OA 1DEAA 4LGVA 5EERA 3B78A 4L3OA 1JIVA 2HU7A 4W1RA 5DTJA 5JD3A 2RAVA 3DTNA 3VJKA 3HYNA 1TGYA 2VT6A 5I7UA 2Q3FA 4HWPA 4QPPA 4E33A 4DYVA 3MWEB 1M72A 4DLLA 1MZPA 4PSUA 2VP0A 2XA9A 3M4JA 1O95D 5CVTA 1OIXA 3R3XA 4DUGD 4RIIA 3LBIA 4Q3AA 4IIBA 1FDUA 2Q07A 4J0KA 5LQAA 4B85A 2HXYA 3W5SA 5CLIA 2IUUA 1OZ0A 5BNWA 2CC2A 4COKA 4LJ6A 1ESMA 1L4LA 1RPNA 2IXGA 3PXGA 3SYKA 1MF7A 1TJ4A 2OMKA 4ZZ3A 1IN8A 3E03A 3B9QA 1YR7A 3IALA 2J3IA 1W29A 1FMLA 1XHLA 5AKHA 5ULLA 3QOWA 2TYSB 4Q4HB 1HFEL 2BM1A 3VU0A 3ZDZB 4YDHB 3R8XA 3LZCA 2W6OA 3TDMA 1QFMA 3AFHA 2H2IA 1SRQA 2QJWA 3CLUC 3NWOA 2RHBA 3ZHQA 3MWLA 4KO1S 4IIYA 3FFXA 3IQDB 1XELA 4LXXA 4W5HA 3DDNA 5FUXA 4DIOA 2OZLA 1OROA 4O33A 4ODIA 4UASA 4QUJA 4C2UA 1QZZA 4JP1A 2R66A 1IK6A 1LI5A 4BPBA 1Y9DA 3U3JA 3FMOB 4B84A 2QP3A 3IYLW 1QANA 3Q3VA 4AWBA 2OK7A 1P5JA 1U0GA 3KYCB 4IRXA 4WMLA 1EQAA 4ZV9A 3H1EA 4B43A 1KYQA 4CVNA 4E1VA 4E7OA 2ZU6A 3DWFA 2R2AA 3IPCA 1U8EA 3PX3A 4RNDB 4G67A 3O3CA 2YH2A 3RU3A 2Y6VA 2WJIA 2QLNA 4D0NA 2R25B 4MX8A 3L0CA 2IYUA 2NU7A 3M5DA 1NVTA 3RTEA 2W8BB 2XODA 1E2DA 1UIRA 3IA2A 4GX2A 4YB8A 5IMBA 3URMA 1BN7A 5TGTA 1VE7A 3V1UA 4BO3A 3Q7IA 1ENYA 5ITVA 1AN9A 2JFWA 3QX9A 2JGAA 1R7RA 1RC0A 4YT5A 4S1PA 3JXEA 2ZI5A 3AHCA 1TEHA 2DQYA 4WVFA 3KD3A 2TSYB 4ZJZA 3TTYA 1IEVA 4S05A 3HJHA 4YJGA 1C9EA 1QCYA 1ND5A 5FBHA 4DR5B 3C6KA 3O0TA 2FLWA 5I7AA 3L0BA 4BP3A 4TXNA 3VR2D 2E82A 4P7FA 5JD6A 1E61A 1XZNA 1NMZA 2BTEA 1PEDA 2G82A 3D4NA 3QQ5A 3BH7A 3AZPA 4G01B 3AK4A 5FADA 1NXTA 5K8CA 2CZGA 4S1OA 3CH4B 3OOYA 2JFQA 3UK2A 2AW5A 1IPEA 2PX8A 3F6BX 3NPMA 5BQXA 4J4BA 3GYGA 5ALKA 3ZGVA 4CMHA 4RFVA 4WXYB 2HMUA 1KXZA 2W4MA 1NN3A 1F14A 4DSNA 1U1DA 4S2EA 2FPXA 2P4HX 4FCWA 4XWYA 4MR7B 1MNAA 4G0PA 3HKDB 1JR3E 1Z4OA 2BEKA 2PPVA 1VSUA 2PLRA 1C29B 2X5KO 3NP9A 5LP6C 5TDHA 5CEEA 1GG8A 1CP3A 1WXQA 1ZU5A 2WG2A 4YJFB 3A3NA 1Y8ZA 1N6PA 3GJ6A 4XM0A 2IZ0A 3SN6A 4RO0A 2QMEA 2OQIA 3EHEA 2UZIR 5K4AA 3Q8WA 4BIIA 2F1OA 7MHTA 1ZD8A 2VJPA 2K2WA 3VU3A 5JYEA 4JIMA 1BU5A 5HF9A 2DBYA 3F8TA 1N2OA 4KQFA 4LYJA 3I9V6 4UUPA 2DBVO 5G3YA 1CUUA 3WJ7A 1SJ9A 4FZRA 5EXEA 3RRMA 4D9HA 1N4DA 2HM7A 3G9ZA 3GDFA 1XAGA 1MFZA 4QOEA 2G4CA 1ATIA 2W6PA 2HLNA 1ECJA 3MILA 4J6FA 4LXUA 5E3JA 1M9NA 5KJEA 1RP1A 1GOTA 2VPWA 3ZS8A 4L07A 4E6EA 3L8FA 4L5YA 4AYWA 5I7SA 1FFXB 2TMDA 3DE6X 5AKZA 2NT4A 3T5BA 4P1ZA 3S5UA 3TQFA 2CXTA 2ANCA 2EV9A 5E3IA 2HC9A 1WM1A 1K8QA 4PSAA 1J99A 1GKLA 1TMYA 1X38A 2B2CA 1YJCA 3IDOA 4PC6A 4BBZA 3QMMA 1VCNA 3HJTA 2G06A 4OGWA 1J0EA 2G77B 2C88A 2VP2A 4XAQA 2PBFA 4JA0A 1SH7A 2G08A 1OT3A 1E5VA 2JH9A 2R7LA 3K6JA 3IELA 4PZPA 4CU2A 3K70C 3SM3A 5CIYA 2RAPA 5EIAA 2ZAMA 1W94A 3CO5A 4GNRA 4EZIA 1KEKA 3ADDA 1G4AE 1KIAA 1WXDA 2Y1CA 4FOPA 1BDMA 2QMQA 1DOAA 1WTAA 3OFJA 5LMNB 2VYCA 5SYAA 3VHXA 3GGGA 5I48A 5L3VA 5LWQA 4JXJA 4F84A 1TIKA 1J7KA 2CVHA 2QPAA 1QE3A 2FSFA 2WSLA 1Y6QA 3HYTA 5LZ5A 3WNDA 5AVQA 1Q17A 4PHFA 3GLQA 5T57A 2ZUFA 1B0ZA 4YRLA 3AWDA 3K8OE 1NVXQ 2W2LA 4GZMA 4H3HB 4DQLA 4E09A 2QRPA 4ZQCB 4QTYA 2RK6A 3I61A 1SCQA 1MABB 2Z30A 4TKZA 2CB9A 4MKRA 3I28A 4EY3A 1U8CB 1WMBA 2AOUB 1T2DA 1FRNA 2O7NA 3IVXA 4OU5A 3Q2OA 2PXXA 4NQRA 1L6RA 3EG9A 4P4LA 4OH1A 3GCDA 4KQJA 4D3YA 3O84A 1I1QB 5DI3B 3NVAA 5I7HA 3VQTA 1NY5A 3EC7A 4IWYA 1SA0A 1R0SA 3S2ZA 2E89A 4CLEA 1D4AA 1LQTA 1F17A 2HPZA 2WOOA 4ZO7A 1CV2A 3BWCA 2YOFA 2CLEB 3WQSB 3LLVA 5FV4A 1KWKA 2CY0A 1D6SA 1D2GA 1L1EA 2PO5A 2BR4A 4RXTA 4DLTA 4H1WA 1Z5GA 5CIWA 2YZGA 4Y8VA 1RW4A 1NBIA 2BF7A 2EX1A 2IP4A 4FW9A 4YCSA 3B9BA 1UBGA 3OI7A 4I4TF 2BPOA 4OSEA 4ZQBA 3WMWA 1VMEA 5J9FA 3EQZA 2QRKA 3LP8A 3P9ZA 4RYLA 3SICE 4UEKA 4D81A 2R5NA 1G6KA 1E9SA 3LUHA 5LQCA 2H6EA 1N5RA 5K0FA 4FIDA 1DQYA 4KRGA 4N4AA 2C5FA 3N9IA 3BE6A 4PLFA 2XRZA 4JDPA 4NU5A 1X42A 4WBXC 3RSCA 5C46F 1OV4A 2CL5A 3OE4A 4URUR 4IDPA 3ZV3A 1V41E 5BN1A 5ICEA 1W25A 2X2OA 3CUSA 2LR0A 1KRWA 1YXMA 3TUJC 3UEOA 2JI6A 1T0BA 1X70A 2PLFA 5D1NA 5ADWA 2ZT5A 2W6NA 4JI8B 3JSXA 1T6ZA 2VDVE 3FBGA 1JEOA 2W70A 4W5NA 2IDKA 2J0EA 2QTTA 2H7YA 2EJCA 4A0GA 1XNHA 1FNDA 3MD9A 3HPQA 2XZOA 4MPJA 4BMXA 2NSLA 3KJIA 2I33A 4ZI5A 4ZCRA 2CK3A 4U1RA 4XFKA 1BMFA 2OSBA 2W5UA 4XPZA 2ORIA 2XYPA 4F86A 2G1KA 1QFXA 2F48A 3MERA 4PNHA 2P41A 4YMLA 2XEXA 1VIMA 1B42A 1VE9A 5HE9A 1YR3A 4IJ5A 3JYNA 3A25A 2ZWAA 1U5BA 1ZC3A 3IAS6 3R24A 1W52X 5BUCA 2RJOA 4L7QA 4KPEC 3DDOA 3G0GA 4U2FA 3TQCA 4ZI7F 2ZE6A 4YRAA 3GZNA 3ILXA 2R8PA 1ZS9A 1BCRA 4D9EA 1I4LD 4FBMA 5BQPA 4YMUA 4AYXA 4POAA 5CT9A 2OBFA 1TQ8A 3L40A 3Q2KA 4M1ZA 2G4LA 1UWCA 4NPAA 5D3ZA 3EEOA 1DDOA 1O96A 3DOHA 3JQ7A 1OKKA 4Q9JA 3PFGA 4EB6B 1GQQA 3H3XA 2CJWA 3O75A 4EMTA 2PL9A 2PJRA 2R5WA 3WLKX 2OP0A 5HBGA 2BBOA 2B2NA 4JOSA 2LZ0A 2UYGA 3B82A 3AO0B 3I4FA 1DC8A 1YMQA 2Q5CA 3AF2A 3QF4A 4HOYA 4O4IF 3TLKA 5CBPB 3K9NA 3HXLA 1KZ6A 1VCOA 3U4AA 2QSJA 1GQFA 2O8FB 3PUZA 3SJAA 3HA3A 3EGIA 3UTCA 4AAYA 2ZXEA 4DCOA 1WLSA 1DTSA 3ISVA 4OUDA 4QGGA 3U4GA 5U4XA 5T4BA 3PFBA 2KWIA 4GP7A 1RKVA 5A2QA 1T9DA 4TXJA 2CHEA 4Z7NB 4TN1A 5ECWA 1GQ2A 3L0SA 4FYXA 4QU5A 1SCKA 1FU7A 4FX5A 4CM4A 1V2HE 3UPUA 2O5VA 1K4YA 5LOVA 1F06A 2H1HA 1L7OA 1EXWA 2ZT7A 4WUVA 3IP5A 3OZRA 1M6VB 3BQ9A 1ULUA 3S27A 4B74A 1R12A 2ZBDA 2PL5A 2NGRA 2FETA 4KIUA 1HNWB 1GAQA 1T0HB 5FEUA 5IUKC 5DYWA 3EEYA 3GJ8A 4GOLD 1UWVA 3Q98A 2VF7A 4M0LA 1S9HA 3MB8A 4J49A 1U7UA 3FM9A 2COEA 1EHCA 4NENA 3H0CA 2FFHA 5IUNC 1TNDA 5CT8A 2VPQA 5U4QA 1J23A 4GXTA 1P1HA 1U8YA 4BNNA 2HBQA 3D6FA 4I46A 1OX4B 4LC0A 1TKRA 2XTMA 2W6ZA 1GLNA 2AJCA 3ICOA 4C04A 3MT8A 4INOA 3A28A 3TGWA 4BNIA 3ROGA 3KTDA 1KH2A 1EX6A 2R6HA 2RI1A 2QU8A 2GVNA 4L0QA 1E3TA 2IYVA 3PFFA 1H2ZA 4L5IA 4A16A 4NQZA 2PZLA 1SUWA 4C3ZA 1KHTA 3UH0A 2PLAA 2R1VA 1PQPA 1I7SB 5BURA 2QA5A 4IILA 5JDCA 4XWGA 3PI6A 4EX6A 3D2CA 2JIZD 4FTWA 3JAWA 3KEFA 1F4LA 1AS0A 3P2JA 4MW7A 4F6CA 2BZSA 5DT2A 4I5GA 2IA5A 2QZSA 2W6CX 2JKYA 3I4LA 4K6KA 3KKLA 4XSVA 4NXMB 5JUWA 1PGQA 3PXCX 2VKTA 4H60A 2HMWA 2DF8A 1VL0A 2GK3A 2VK8A 4N0PA 4RF2A 5IXYA 3EZFA 3L7AA 1H93A 3DE3X 3TOCA 1H85A 4NFLA 1JV2B 2DT5A 1A72A 2D4AA 2I8LA 4TLBA 2J5BA 1G8SA 1P5ZB 2V6GA 4Q1CA 1JDBC 1JKJA 1MC4A 4JBIA 4IH1A 4EYQA 1MXFA 1N2GA 1CE8A 1G8PA 3R6TA 5HKAA 1N3LA 1XL1A 2PQ6A 2CDAA 1NQVA 3BF8A 1JAHA 4CG3A 4EHHA 2P78A 4KOEC 3QVGA 1X1BA 5HUHA 4CZ2A 2QX9A 4XPIA 1EVIA 2WJ6A 2E9SA 4RVOA 4C5CA 1EPUA 2QI9C 1TVKB 1H23A 2CNBA 1DMSA 2VSFA 5SZHB 4F2DA 1PDVA 3I5MA 3TL3A 1XTSA 2AK2A 1YR8A 4K88A 1CUZA 4GYWA 4MW6A 2YXEA 1CY6A 2W11A 3I3SR 1MA3A 4IGIA 2VNJA 1FDIA 1V48A 3TLEA 1N5JA 1BWPA 1TCCA 1W0KA 1AA6A 2J33A 4MGYR 4UTVA 4X24A 3R9XA 4IVRA 2OO3A 4WXPA 3FI9A 4GVLA 4H6VA 3CCBA 1HK7A 2CFTA 3N8NA 4LRQA 5CU7A 2RE8A 2CD9A 3M4NA 4ID3A 4CEJB 1DC3A 4KLAA 3HWSA 4CQMB 1ND6A 3ZOKA 3N7TA 4V0MA 3KSAC 1P0MA 3OOSA 2RD2A 2NYUA 2WSSD 4AX8A 1CLEA 1X0XA 1L7RA 4H9GA 4KE8A 2IOHA 3TD9A 4D6XA 1VG8A 2IS6A 3OIUA 2Q9UA 1QO9A 1W6RA 4HX9A 4UNQA 5BMVB 1NL3A 4ETWA 1NM5C 2Q6LA 3CZ9A 2GI4A 1TK3A 4MIKA 3ECCA 5EHQA 5IM4A 4PCAA 1LVHA 3DOUA 1JDNA 1JR4A 2JL1A 3H5AA 4JIGA 1YB5A 1XSEA 3CUWA 4JP2A 4PX9A 3RVNA 6YASA 3VNUA 1UC8A 4JI3B 3COVA 5JJBA 3INNA 1ULBA 2BJVA 4JH0A 3M3DA 4BEWA 3FHLA 3D02A 2G8NA 4WK4B 1Y7PA 3M9LA 5AI0A 5IWCA 2QTAA 2GFQA 1Q7BA 5JASA 3PJFA 4LEIA 3S2IA 5AM1A 2AIRA 3OJLA 5FAKA 4MCIA 3VI4B 2C4MA 3GLFA 3C7TA 2WWRA 3FFBA 3E3MA 4R2LA 3F9RA 3T52A 1A4RA 2CHUA 1JPVA 2A1UB 1JN0A 4Y2HA 3EC2A 4R41A 3HP7A 1I36A 5HGXA 2CV1A 2OFOA 2GILA 4BN0A 1DKMA 3QA9A 1DAMA 2PD3A 1KJNA 3MS4A 4FFBB 1J6UA 5LQRA 3L0YA 2IHJA 1NI4B 1XQVA 1YBAA 4ER6A 1KHHA 1SWVA 4RS4A 3ZVRA 5DWQA 1EWRA 2Z95A 2IQ5A 2W0SA 4EVRA 2ZI9A 1XD9A 2Z2ZA 4IUYA 1EUYA 2R4QA 1LLCA 4PIPA 4YMIA 4BLSA 5E3HA 4EFNA 3VZSA 4KGDA 1EI9A 5HM6A 1LPPA 2NXNA 2Y1EA 3OT1A 4OEHA 3UJAA 2CV0A 3D43A 1OTYA 1WDKA 4JLBA 1IUOA 3VSBA 1F1JA 3AJAA 3KWLA 3BS4A 2BCGY 4TRMA 1MAVA 1QTRA 1T3LA 3WSWA 4U0KA 1SXQA 2I78A 3GZNB 3PPXA 1WZUA 1BXZA 1MDFA 3HA5A 4HGRA 1KQ3A 5FOTA 2XYQA 2B92A 2HCTA 3SWWA 2CNOA 4ENPA 5JDCC 5LLDA 3ZDDA 3KJZA 2EZ4A 3D8TA 2HH9A 3KFLA 1Q11A 1FTGA 4Y1FA 1F2TB 5CNIA 3MJEA 1O96B 1O6GA 1AK9A 3H4TA 3HBJA 3JQ7B 2YWRA 1KP9A 3DNPA 3L6EA 1RZUA 2CJWB 1U5AA 2YCBA 1QYDA 4FMDB 3H75A 3C5WP 2BBWA 3T7IA 4G09A 5TX7A 3DC2A 1N9GA 3GG2A 3QF4B 2EXXA 4Z3DA 4OJMX 5GZ1A 2Z6AA 2HWYA 4DABA 2GNPA 4PSKA 4YYEA 4FEYA 1MIHA 1JXMA 1M66A 1CY2A 4GEGA 4CMGA 5JYCA 3H2GA 4K40A 4UQOA 5LNK1 1GG2A 4EIWA 1BW9A 3AC0A 5CDHA 1F9AA 1TK9A 5FPKA 5FL3A 3W7AA 5DV9A 1RR6A 2EATA 3PNMA 3DAOA 2I4RA 2IEZA 1ZL2A 1HDEA 1OZHA 3HSKA 4IZIA 4QYSA 3UW3A 1PLJA 3RANA 4DIFA 1Z82A 1Z68A 2OC9A 3IJEB 1UOEA 4KLCA 1JEQA 4G0VA 4I6EA 2BFFA 4JQYA 4UCFA 3L1HA 4ZHSA 1W8DA 2WAOA 3ZX5A 2FUKA 4L15A 3MS7A 3A9VA 4P8RA 4JB0A 2ORYA 4BRWA 4E14A 2AFHA 1NQAO 2ZLBA 3L7IA 3VPAA 1NOIA 2YW2A 3G7UA 5ELLA 5CCXA 4EHKA 3VJMA 2K7ZA 2O7RA 4MCAA 3PFCA 1Z5OA 5FOSA 2I6TA 3GRVA 2HJVA 2FGKA 2IH2A 1NASA 2QOEA 2V96A 4FSXA 1YL7A 1ZUNA 3HCDA 3ITNA 3JWIA 4MUGA 3O83A 4UCWA 2DY1A 3SSAA 4WNAA 1VBNA 3KSUA 4Z6KA 4IMJB 2AH5A 4ZYZA 1L4EA 4BFYA 2PZFA 2H59A 2J3EA 5J5AA 3QGMA 1CUDA 1TUIA 1WSBA 3I30X 1T8WA 1KU0A 1Z6TA 3KT6A 1ZMTA 3PUIA 3QU7A 2R1VB 1DIGA 3PDUA 1WUIS 5CVUA 1H4QA 4JI2B 2LD4A 1KKMA 4MJLA 1R0XA 5F35A 5I7VA 1LFDB 1ETUA 2FYTA 5T3UA 4D9KA 1QIJA 1DBSA 3A1EA 5AM4A 3DCNA 3SEAA 3VFDA 2FPLA 4M1SA 1BIFA 4M9UA 2GN4A 4RKQA 3A9SA 2ZAIA 4QQRA 5IJXA 3P7MA 3RREA 1P1CA 3VAYA 5CMLA 1CIPA 1MD9A 3IPAA 1D2NA 4TWBA 5G4KB 1N2CE 2GJ4A 1WR8A 2Z8ZA 1Z7GA 3H1GA 3W5IA 5FBWB 5L3QB 2ZJ7A 2PFGA 2XQIA 3HEAA 2JFUA 4DY6A 4FZ3A 1JKJB 4M55A 4B17A 1DBVO 4V1CB 1QHEA 2A0FA 3BA6A 2EP5A 3HB5X 4Y2UA 3UV3A 4Z49A 1UK6A 3N2KB 3WIEA 5AIBA 1SBHA 5C5DA 4Q9IA 1M3SA 4MPTA 2HU8A 3HHEA 1MTOA 5BV2P 2A0UA 1KOGA 1CUVA 4NIMA 4BE4A 3GN1A 3KT3A 1BWSA 2GCPA 1R27A 4CN9A 3GEBA 1W5SA 2IKSA 2QZPA 2GCOA 5EA2A 1F5NA 1V1MA 3AVUA 4I4TA 1EX1A 4B4OA 3T5TA 3EDQA 2DH6A 5F9FA 1A3CA 5CH3A 5HCNA 9LDBA 2ODAA 3DEZA 3LXUX 4WN9A 5HQTA 1WZNA 4AJLA 3NGXA 1IRXA 2YNMD 4GLOA 1XPJA 3RT9A 5KHOC 1RMYA 4CM3A 3MUEA 5K9ZA 1A7AA 4H0CA 5CLGA 1E98A 2WIKA 1SZJG 4DIKA 5C4MA 5EC8A 2JLSA 4UD2A 4XUCA 2FWMX 2AEFA 4C1NA 5BOVA 1O6ZA 4AY2A 2OAQ1 5D3MA 2UU9B 4ILKA 1HDIA 1EXNA 3MWKA 3CR7A 3GWGA 1BE0A 3HM9A 3WADA 3LG2A 1BXKA 2L17A 1UFQA 2CEKA 4GI3A 2GAJA 4KK4A 4FGWA 3SMVA 3T6KA 4D4JA 5C18A 1PVOA 1O6BA 1TO6A 3ROKA 1HV8A 3TPZA 1HE1C 2JHPA 2R6JA 2XKJE 1PJAA 4V0LA 5HKBA 1DPGA 1XAIA 4H15A 3IQHX 2YY7A 1U2RA 3A6GA 1CJSA 1RHQA 3L1VA 2ZJZA 3TKLA 5KWJA 2YC4C 2Y1WA 4CTJA 2FCAA 1P0FA 5GVRA 1F0KA 5KNCA 1UL1X 5AXDA 1TKCA 2AC4A 3GAZA 1J33A 4GSKA 3KS9A 3O4RA 3IIMA 3TIXB 4RJLA 1JHAA 4QEZA 1W9MA 4RCZA 1KERA 2AE2A 2QD1A 4NRDA 2BMFA 4ZPXA 2GCIA 3ESDA 3VPCA 4F1KA 1NVUQ 5KTOA 4Z8XA 2P4QA 4ERXA 5KOYA 5G0WA 4B6OA 2Q28A 5IM5A 2B9VA 9ATCA 1X7ZA 2AT1A 4R8LA 3TNJA 3OESA 1Y1LA 1DQRA 2WJAA 3AETB 5HSGA 5HW0A 5AM0A 2NP6A 4S0XA 3VH1A 2CCGA 4ER5A 1KVRA 4BFLA 1SKQA 3WRXA 4EUSA 2DB3A 1H0RA 4PZ0A 3U5ZB 2VN8A 4FGZA 4IIUA 1PL6A 1IY1A 1XZ8A 1KMCA 1YSCA 3WJ2A 2FRDA 2PRYA 3EIUA 1SG6A 4RPJA 3KT0A 3O31A 1Z0JA 2BFPA 2JLVA 2AHOA 5JVDB 3GHHA 5GQSA 1A4UA 5EWLA 4NEQA 3DFKA 1I2MA 3MPUA 3EPLA 1P45A 3LWDA 3V8MA 2ZCVA 5TGZA 2WHYA 4INZA 3P26A 2NP7A 3JRWA 1YVPA 1P2VA 3NXKA 1U1FA 4B9EA 4UAVA 3TSOA 3IPRA 1JS1X 2FOLA 3LRTA 4L2IA 4OA8A 5LDGA 2FI1A 4DNFA 1N9GB 2P40A 2SKDA 5F77A 2I66A 3QLUA 3DTYA 3FPGA 1P2UA 1VBMA 4L08A 4UVDA 3WIVA 4AG5A 4BV3A 4D8TA 5B1YA 3WLJA 1XALA 5I9NA 1PR2A 1CTQA 1VYUA 1Y80A 2BGIA 3A6EA 3KD2A 4IDHA 4GZ6A 4L0DA 3WGJA 4IG9A 1APBA 1OSNA 3F5MA 4UNPA 1WX1A 4NCBA 1WB4A 2E6UX 3I6MA 2PMKA 4U3JB 1IHXA 2DTEA 2P5TB 3LT0A 1V0JA 4NCKA 2CXQA 2IP2A 3VVMA 2PRJA 2XAAA 3ZVKA 5J58A 1BD3A 5DXFA 4KR7A 1C8KA 1OLXA 1UT8A 3R7FA 1LBSA 4UU7A 3LQQA 4FVTA 4HEA6 2JVKA 4Z7JA 3MM4A 1KZ9A 3C3MA 4YAJA 2PZGA 3VXKA 5GMOA 3PDIB 1Z4QA 3FKJA 3ESXA 2V7XA 4L1KA 1GXSB 4IW3B 4MW9A 4PFQA 2FEAA 2PWYA 3EZ6A 1KAOA 1BX3A 4U7FA 4YCNA 1PNRA 4FS8A 4YWHA 4KFCA 1C3JA 4ARUA 5F76A 5FFMA 4C7OA 1H66A 2BDTA 5A9RA 4DADA 2CYBA 4LVNA 4EP1A 2CE7A 3W7BA 2YDYA 4IMIB 5GPBA 1G5FA 2VPTA 3PNBA 4NBWA 1G2OA 1XNGA 5JEDA 2FU5C 1H8HD 4LK3A 3EODA 4H4EA 4R8MA 4TOIA 2ZS8A 1R3DA 2PZMA 2RGNA 4ZVQA 2IEAA 4DR6B 4FHCA 1FQWA 3IVMA 4ZJUA 3FETA 2Q6VA 1U80A 3K8YA 4LA4A 2Y99A 4KR9A 4WNAB 1J24A 1C3EA 3EA0A 5IS2A 2IZZA 2V55B 2DFPA 5KQRA 3SLKA 3R3WA 4IDOA 4QZVA 2C03A 4MVJG 3O5AA 4ZEOA 1E5XA 4J29A 1OXMA 4QELA 1IY8A 3OEHD 3PQFA 2J0VA 3K9BA 3QRWA 2O57A 3C5HA 3LWBA 5HTKA 2NAPA 3RYIA 4EGAA 5F9HA 2FMHA 4JJ6A 1Y3CE 4LV5B 1K6MA 3RTAA 5K20A 3ASUA 3LUDA 3OZIA 4NPCA 3VGPA 2EG9A 5DBEX 4MI1A 4DA0A 3AHEA 3HGMA 2X1HA 4XX1A 3JATA 4F6RA 2B4QA 2WMYA 2K7FA 1B23P 1Y3BE 1XE3A 3EPJA 3DOJA 4HQ0A 1QHSA 4PIMA 5A3QA 1E64A 2V7GA 3KJQA 4J6EA 3T7TA 3OFVA 5CK4A 3NUZA 2F1JA 1FQJA 4B6QA 4J7XA 1H65A 4Q18A 3ON5A 2V4MA 2AKEA 3W79A 2OYSA 2VR1A 4TWZA 1N2IA 4GAEA 3HM2A 3WRXC 1JXAA 1EIZA 2IITA 3GD7A 4HUJA 1COWA 1JEJA 2PUEA 2P1RA 1I01A 3BH0A 1Y8AA 3IHWA 2PKRA 4AMGA 2G1AA 2FRDC 3T0IA 3PX7A 1M83A 4W9RA 1KJQA 3BG5A 4YXWD 1WLYA 4O4JB 4LDJA 5AW2A 4KQKA 3KZ1E 2CT8A 2RC5A 5C7LO 1ZGGA 3BREA 3VPHA 2R5FA 3CFYA 3KALA 5HDQA 3UNXA 4ECAA 1QYXA 2YR0A 3MJFA 5KS2A 1H2BA 3FPLA 1XCBA 4HTFB 3G6WA 4HRVA 3HJRA 2O23A 3S1AA 5LP1A 4CQMD 1TM4E 3B70A 2ISSD 1TADA 3NX4A 1FJ2A 3WE7A 3QM1A 1KQPA 1SCIA 4HQ6A 3OQNA 1N36B 4JELA 2QXYA 1UDAA 1J7JA 1T4BA 4V2IA 2P30A 5A71A 3ZZTA 4A8TA 3HFSA 3FWHA 3UMVA 5AOVA 3OCVA 1KI4A 2A2ZA 3QLUC 4Y2QA 2F9MA 3N0RA 2Q27A 1FQOA 2G9ZA 2GH1A 4FFWA 4PO8A 2MSEB 4ZDWA 1YHZA 3NWBA 4J0IA 1ATZA 1OTHA 1LBIA 2ODPA 4GXNA 3D8SA 2NOAA 2F1IA 1SUSA 5EJIA 1FIUA 2NO5A 3LUJA 5EIHA 3TRFA 2P2SA 4N7RA 1UBEA 3ZKWA 4IV0A 2BHTA 4HK4A 3SEZA 2JLYA 1TKBA 2ZYSA 3ANNA 3BXXA 2HTEA 1R4NB 3QVSA 2BFMA 1ODFA 1SOMA 4MWTA 3TB4A 3L01A 4Z3OA 3TZCA 1TO2E 5BOSA 4LZOA 3EEFA 4DLPA 1DT3A 4HPWA 1LS6A 1THGA 3BZBA 4MWDA 4EKIA 3AJEA 1WP9A 4MUBA 5B2EA 5MHTA 4CMBA 5F1PA 4IDNA 2AN5A 1JALA 3LUFA 3NIFB 3H2BA 3GPLA 4Z4FA 2IYTA 2HSDA 2HZ7A 2XUZA 1QNLA 3CEHA 2XX3A 5AW4A 1ZKDA 1SBTA 3M33A 1NZDA 4Z4HA 1KETA 4BFWA 3QY9A 2FQQA 5ITSA 3KTFA 3A37A 4MVJH 2H51A 2VDOB 3NHUA 1UMDA 1VLVA 4KO8A 5TIIA 4UM9B 3RRFA 1EB9A 4DSZA 5EKTA 2RGNC 1YI1A 4R84A 4KUHA 3DMHA 4E30A 1WMAA 3DE5X 3N0XA 4DCVA 1NJ8A 1X80A 5KNDA 3TZEA 1EX9A 1NXQA 1Q21A 1MB3A 3KYJB 4ZGWA 4RK7A 2GTIA 1Q84A 2Q1TA 2QPLA 3NDPA 1DTWB 4IIEA 4YHBA 5F73A 5IW8A 3D8HA 1CQZA 3QFFA 2D5AA 1XLVA 2FUG6 2WUVA 1Q0SA 3EA5A 2VK1A 4IOKA 4YMWA 4Z2AA 3DDSA 2B5VA 1SELA 2SKEA 3HUFA 2QIPA 4YAIA 4Z4EA 4GS5A 4JLJA 4DSUA 4U2CA 4XVHA 1A71A 1PT5A 2Z2YA 3JW8A 1KXJA 3BEOA 3S29A 1V7QA 2QMZA 2FMXA 5FBZA 3RIEA 4UD6A 1Q1AA 4QFDA 3KUKA 2CBXA 3BM5A 5CA0A 3TUIC 3BRSA 1VKOA 1N6HA 1ONSA 2I6QA 2PX5A 1RNLA 2KI5A 5IMSA 4BMSA 3C3BA 2DUUA 3OEYA 4G5GA 2WAMA 3WNCA 3PBKA 4RGYA 3A58B 1QP7A 2FLKA 3ZNQA 1BMTA 4DF3A 1ADFA 3LIPA 1G21A 2ODNA 2ARKA 2QJTA 2X8BA 3ZCVA 1Y7IA 4DR7B 3UMBA 3K9LA 4LNHA 3WC4A 5J47A 2M1ZA 2IC5A 5J5VA 2PJDA 4O4HA 2WJZB 4Q34A 2IX3A 5JQGA 1TM7E 2DFVA 3P71T 1LK0A 3AP2A 4WKBA 3G2OA 1UPXA 1FDSA 2GJ8A 3GLTA 3M4YA 1U0FA 4QPNA 3TTXA 3VSEA 2G1UA 2J59A 3RTCA 2P4UA 1OLXB 2EBUA 3AHGA 2X2EA 3WWPA 1OWOA 3LW8A 4B44A 4RTPA 3HXOA 1CIJA 4OMUA 1DFHA 3DOOA 3RV4A 3PQCA 1UEXC 5F51A 4YJ3A 4B09A 1I94B 1QC5A 4ZI2A 3FIJA 5DM70 3CVOA 3I45A 4MUKA 2YRXA 1FTNA 7GPBA 3V7UA 1KYIA 4C01A 3VHLB 4CLOB 4EFKA 1NR1A 4J3NA 1Y6JA 3CPEA 3VNAA 1OX6A 1QR6A 3L8ZA 3AFOA 2R6DA 5ES3A 2PQMA 3AKCA 4AS2A 5JS7A 5BSVA 5AH0A 1NR5A 4M9SA 4MDEA 3OQ6A 4E5MA 3ZD7A 3FZNA 4UEQA 4GGPA 2WPNA 4H4DA 4GWKA 3HP1A 3RTGA 1DKPA 2CZCA 3UCXA 4D02A 3DE7X 1V9CA 3K1TA 1CRQA 1KO8A 1ZW1A 3CZAA 1ES9A 5D5QA 1U28C 4AXBA 2A9VA 4REMA 1CR6A 1XNQB 1SBNE 1P0PA 3LCRA 5E7JA 3B6IA 5I01A 1OXXK 1YU6A 3L9XA 5AXBA 1S8NA 3VNBA 1C7RA 3QU5A 3TN7A 2XH8A 4OG2A 3QX7A 6Q21A 3TL2A 4V0ME 4WAUA 2P62A 2FG7C 4AN1A 2NO4A 3DT9A 4ZV7A 2UUAB 1ISFA 1ZR2A 1R6XA 3STHA 2L69A 4LNUA 4RIGA 4XCQA 4R3WA 4TQ9A 4GKJB 4WQMA 2OCBA 3G0OA 1N34B 4MQFA 1NBWB 2VUUA 4QYIA 4WY5A 2XKBA 1WBJB 3G2JA 4Z0HO 1VIDA 1A9RA 2EQBA 2HQSA 4G1UC 1NPYA 3ZE6A 3C6YA 1EB8A 3I76A 4I3HA 3RR2A 1N57A 2QT9A 4MH0R 2C7PA 2F8TA 1YJBA 2Q4DA 3EJWA 3NTVA 2ESRA 3AHJA 4GMXA 2IGBA 3SS7X 4KHPB 4QBHA 1W0CA 4F06A 3OM1A 3R7WA 1BFUA 1JFVA 4XUEA 5DN6D 2PH3A 4M98A 5C3MA 2WDZA 1Y42X 3TBHA 2XUIA 5EE5B 3ANMA 4RA9A 1QVRA 2YTZA 3HC7A 4K8RB 1NPTO 3I2KA 3MRTA 1ZDMA 3KXIA 3E48A 1B0UA 5KNBH 2XYVA 2ZJAA 3DW1X 3TAXA 4J7AA 4H18A 3R2JA 2WJHA 3CT6A 3MCWA 2WJ3A 1OWPA 2OXIA 1SUEA 1Z07A 1ZESA 2J1LA 2X19A 4A3SA 1YFZA 3R0VA 3CRRA 3R41A 3WLRA 2HYIC 3W1VA 1GTG1 3IDSA 4LTMA 4D57A 4PTYA 4A6DA 3V7YA 4HYQA 3IQWA 3G8CA 1QGOA 2DQSA 3QLVC 3AV3A 3DTVB 1J8FA 1ODLA 1RYFA 3R5HA 4IDFA 4K81B 4L5JA 4LY0A 1QRRA 2V3VA 4AJOA 2MIIA 3ADCA 1OB2A 4UREA 1SEPA 3LOPA 3H04A 4KI7A 1D6JA 2QNRA 4R1NA 3S2FA 4JUAA 2IUSA 3EOZA 3PEEA 1MHPA 3FOFC 2OE2A 3BZWA 1CDDA 1ZD2P 3OM8A 2BD0A 4ARVA 1T0PA 1ZLYA 2IDJA 2PVSA 3FGOA 3MQ2A 3CVXA 1I5EA 1C30A 1XK6A 3FHCB 4G5FA 4UBKA 2R68A 3SSOA 4PC3A 5KYWB 3A9CA 3OZSA 4K9KA 1B26A 4F5DA 4ZHQF 3M89A 2ONKA 1AKQA 1NATA 4P54A 3AIOA 2OVBA 3K09A 3A2LA 3OUZA 4ZOEA 5EZQA 3MCAA 4RJTA 4TTQA 4WLFA 3B36A 2FFRA 2WSSA 1JBKA 1UF9A 4J7CA 5U1PA 4WPGA 1Z8FA 3SOPA 2ZQZA 4NEGA 1R74A 1HLFA 3R7DA