2AOTB

Histamine methyltransferase complexed with the antihistamine drug diphenhydramine
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
288
structure length
286
Chain Sequence
b'MRSLFSDHGKYVESFRRFLNHSTEHQCMQEFMDKKLPGIIGRIGDTKSEIKILSIGGGAGEIDLQILSKVQAQYPGVINNEVVEPSAEQIAKYKELVAKTSNLENVKFAWHKETSSEYQSRMLEKKELQKWDFIHMIQMLYYVKDIPATLKFFHSLLGTNAKMLIIVVSGSSGWDKLWKKYGSRFPQDDLCQYITSDDLTQMLDNLGLKYECYDLLSTMDISDCFIDGNENGDLLWDFLTETNFNATAPPDLRAELGKDLQEPEFSAKKEGKVLFNNTLSFIVIEA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histamine N-methyltransferase
publication title Structural basis for inhibition of histamine N-methyltransferase by diverse drugs
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 105
structure length 286
sequence length 288
ec nomenclature ec 2.1.1.8: Histamine N-methyltransferase.
pdb deposition date 2005-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13489 Methyltransf_23 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2aotB00
3NVKI 2GA9A 2BM8A 2P40A 3B7PA 2BR5A 2AOWA 3K0BA 1AQJA 2Z6QA 3L8DA 4G56A 5FWDA 3U81A 3WSTA 2FK7A 2R3SA 3A27A 3EEOA 1IM8A 5EC8A 4RX1A 3M6WA 3OZRA 4BY9E 2IFTA 2XYRA 3GDHA 3P9CA 3B3JA 2PLWA 1XXLA 3VYWA 1TW3A 4X41A 5JUWA 3KQVA 3PX2A 4ISCA 3KQYA 5T6BA 5DTQA 4RTMA 1VBFA 3IEIA 3FUUA 1R00A 4ER3A 3KHKA 2P3QA 2AZTA 2GB4A 2Y1WA 2ZBPA 3LECA 3LKDA 3P9NA 3NWBA 5EPEA 3DLCA 3H2BA 1JG2A 3HA7A 3M6VA 5CVJA 3ME5A 5FA5A 2IP2A 2P7HA 3HVKA 3O7WA 4CKCA 4DM3A 4ER7A 3TMAA 4YMGA 2NP6A 2AOXA 2FRXA 3BWBA 4QQKA 5E1DA 4HSGA 5EQJB 3MTIA 4C08A 5JR3A 2HMYB 2BH2A 3LHDA 2QRVA 5FHQA 2AOVA 1D2HA 1P1CA 1V39A 1X19A 3CVOA 2FCAA 5KYGA 2LD4A 2PSSA 2BR3A 2ZIFA 3CJRA 5K0NA 4RTKA 3HVIA 2OPBA 3G2OA 3O4FA 4FT4A 4P7GA 1RJEA 2KW5A 3KQMA 4YV1A 3KU1A 5HEKA 1L9KA 3QOXA 3ELDA 3E23A 2G8NA 3UJDA 4CTJA 3I9FA 5FHRA 2EG5A 1XDUA 3MCZA 1NBHA 2OYRA 3SMQA 2CL5A 2NXJA 3KPUA 5F2OA 1SKMA 3UJ8A 1M6YA 4F86A 4AX8A 3E7PA 4IWNA 3NMUF 1ZG3A 3BGVA 2IIPA 2QY6A 3PVCA 3P2IA 5E9WA 5KQRA 3KQPA 2O06A 2PXXA 3GO4A 2F8LA 3UBTA 2H11A 3BWCA 5DXAA 4X63A 4C07A 1O9GA 3C0KA 1R74A 3SR4A 4GC5A 1DUSA 2UZ4A 3EVCA 1X1CA 2IGTA 5EG5A 4L7VA 1JG3A 5LQJA 3ER9A 1VP9A 3OFKA 3M6XA 3EVGA 4RTQA 5BW5A 5FWAA 4RSRA 4RTRA 3DXZA 1G38A 3G7UA 3VSEA 3UA3A 2GLUA 1QYRA 5E8RA 3FYCA 3TM4A 2YX1A 3GXOA 3A25A 5T67A 1Q0SA 2N47A 3R24A 3P2KA 2BM9A 1YB2A 4KDRA 5CVVA 3UJAA 3UJ9A 1EQAA 4E30A 3OU6A 4PNEA 3THSA 3BKWA 1FP1D 4R05A 1L3CA 3SSMA 3LSTA 3R9XB 3MAGA 1NBIA 1RI3A 4RVHA 5E1OA 2PWPA 3UJBA 4Y30A 4AZSA 4E70A 3ORHA 3MTEA 2OKCA 2YVLA 2ORED 1YF3A 1JQ3A 1IXKA 1I9GA 1XCJA 3EVEA 4HH4A 3ID6C 1PRYA 2O05A 2UYQA 5DSTA 3V8VA 1WG8A 3I53A 3IHTA 1JSZA 3G2MA 1INLA 3IV6A 3SSOA 1JTEA 3BWYA 2VS1A 2V74B 3OU2A 5DPMA 2FK8A 3LDGA 5DX1A 2JG3A 3P97A 2PY6A 4PYIA 5G02A 4EQZA 4PYKA 1SUSA 3T7TA 3P9KA 4XUDA 4PONA 2IH5A 1BOOA 4QDKA 2FPOA 1N7JA 5HIJA 3NW9A 3OE4A 3TFWA 1JG1A 2YQZA 5EHGA 1MHTA 5DM4A 3EVBA 3FTDA 3Q7EA 4M37A 4P58A 3KR0A 3OFJA 2I62A 2B2CA 3A26A 4H0NA 5EZSA 1WS6A 2QE6A 4FSDA 2YUIA 3MB5A 3HVHA 4LECA 1EG2A 1UFKA 3CJQA 5EMKA 3TR6A 4IV8A 4YUVA 5HFJA 5EZQA 3SSNA 2HTEA 2B25A 4P7KA 1G55A 1G6Q1 3RODA 2NNWB 4PYQA 3TKAA 4XCXA 3P71T 4EK9A 2ZVJA 3EVFA 1M0EA 1KYWA 1EAMA 1AQIA 2Z6AA 3A7DA 1NV9A 4RVDA 2UYOA 2O07A 4GC9A 4M38A 4ZTBA 2P1DA 3AXTA 2Q41A 3Q87B 5LQCA 4BLVA 2ZULA 3G88A 2NXCA 4M36A 1TPYA 2CMHA 2PX5A 3CCFA 5ERGB 2XVMA 1X1AA 3FPHA 3G5LA 4Y2HA 5HOQA 5K0JA 4YV0A 3LDUA 4RTPA 1KXZA 5LQNA 4C05A 3CC8A 4R8SA 1HMYA 4RVFA 4WVLA 2AN5A 2CMGA 3KPVA 4EVIA 5GIPE 2IBTA 2Z6UA 3HP7A 3PT9A 4EKGA 1M6EX 4AUKA 3GCZA 5K09A 3HM2A 4KVZA 3G8AA 3TM5A 2AOTB 4OA8A 4HG2A 3HA3A 5EVJA 1KYZA 4OX9Y 3ERCA 5DM0A 1XVAA 2H00A 2B9EA 3F4KA 2ONZA 4LWPA 1VE3A 2PX2A 4NECA 4E2YA 3UJ7A 4DCMA 5DLYA 3KQOA 2XBMA 2JH9A 2AVDA 4P7JA 2C7QA 3ELUA 4DMGA 2ZIGA 1ORHA 3FUWA 4AZVA 2UYCA 2P7IA 3G2QA 3C3PA 3LBFA 5CVEA 1X1BA 3HEMA 5EOVA 1JTFA 4FP9A 2ZZKA 3EVZA 3OU7A 4FR0A 2ONYA 4V0QA 4DF3A 3I5UA 1Y8CA 3LX6A 2C7RA 2JJQA 2JHPA 3M70A 7MHTA 1WY7A 10MHA 5M5BA 1MJFA 1F38A 1YZ3A 2EJTA 3HCDA 4UOEA 4PYNA 2C7OA 2G1PA 2PX8A 3MHTA 3LPMA 5FULA 2DULA 2NXEA 3AXSA 4CKBA 3AJDA 4KWCA 5IKMA 5DM1A 3JWHA 3M4XA 4KIFA 3D2LA 5LQKA 2ERCA 3UFBA 5GIOE 2IPXA 5K8VA 3O31A 1D2GA 4RTLA 2OO3A 3GGDA 5E2BA 3BZBA 3P2EA 1L3IA 2FHPA 3BWMA 5DX8A 5DX0A 3X0DA 4ATNA 5GINE 3GRZA 3OE5A 3S68A 3EMDA 3I58A 1WZNA 2AOUB 2HNKA 3DXXA 1WXWA 2B3TA 3SM3A 4HGYA 3IYLW 1FPQA 1B42A 3SX0A 3ER8A 3B3FA 3NDJA 3C3YA 4HTFB 4IV0A 1KIAA 3KPJA 3T7RA 4R6XA 4E2XA 4DA4A 3KR9A 1KP9A 1KPHA 3DH0A 4YUXA 2IH4A 2V7EA 1ORIA 3FTFA 1XCLA 4MIKA 4E33A 5EEHA 3TRKA 2G72A 4PCLA 2OB1A 3G5TA 3BGIA 4Z2YA 4ER0A 2IDKA 4CTKA 4A6EA 4IKPA 2GPYA 3UJCA 4PIPA 5K0GA 3B3GA 1RI2A 5F2NA 2ZZNA 3KQSA 3TQSA 4KDCA 2GH1A 4PYOA 3KQTA 2ADMA 2NP7A 4MQ4A 1EIZA 2OZVA 2QM3A 1UIRA 3NDIA 2AR0A 5D1HA 1O54A 1X1DA 2PBFA 3KKZA 4DZRA 1SUIA 1YZHA 4EKIA 4E2ZA 1YFJA 3AWIA 5EIWA 1FBNA 3DR5A 1NT2A 5K0EA 2EFJA 3GRRA 5FUBA 5FQNA 5ICEA 1I1NA 1KR5A 1I4WA 4OQDA 4ER6A 1KPGA 2YR0A 1NW5A 2VDVE 2YXDA 1NW8A 2YXEA 1Z3CA 2ZLBA 3DLIA 3EMBA 3FTCA 4PYMA 4QTUB 5CVUA 4BP3A 5LR6A 1TW2A 2XYVA 2ZWAA 3GWZA 5DM2A 3BKXA 4KRGA 1P1BA 4LWOA 4GBED 3JWIA 4RV9A 3GU3A 5GM2A 3UJ6A 2ZWVA 1RJFA 2B78A 3DMFA 5K03A 5DT2A 2PWYA 5CM2Z 2QYOA 2ESRA 4R6WA 5CIYA 2P3OA 1VIDA 4E32A 3B89A 2PGXA 2H1RA 4RVGA 1IY9A 3DUWA 4RWZA 1DL5A 9MHTA 3DMGA 3EVDA 1ZGAA 1SG9A 2R6ZA 1BC5A 5DXJA 5EMMA 3TKYA 2OBFA 3HNRA 1NW7A 3CJTA 3HCFA 1JR4A 3M6UA 5EKXA 1FP2A 5P8WA 5CUQA 5HZMA 4RTNA 4U7PB 4OBXA 4C03A 1P91A 4C4AA 4FS8A 4P7FA 3P9IA 1G60A 4GQBA 1PJZA 3KQWA 4MTLA 4GUAA 4E2WA 3OPNA 2NYUA 1L3BA 3OCJA 4LG1A 1RJDA 4FT2A 4QTTB 5DSXA 1YUBA 3FZGA 3I64A 1BKYA 1NW6A 2HV9A 5CVDA 3FRHA 5U4XA 5HIKA 4CWAA 2Y1XA 5K0FA 3A7EA 1RI1A 3ELWA 3HCBA 3CGGA 1KHHA 5EMLA 4GOLD 3EVAA 4A6DA 4QVGA 3CBGA 3JWJA 3T0IA 3FRIA 4F84A 3C6MA 3AY0A 3DTNA 4K6MA 4XUEA 4QQNA 3KPYA 5LSAA 1VPTA 3HCEA 2I6GA 4CXMA 1NW3A 5FTWA 4CKEA 3K6RA 4PGHA 3SVZA 4ER5A 3FPGA 5E9QA 2I9KA 2EX4A 3EGEA 5CCBA 2AN3A 2JHAA 2K4MA 3VC1A 3PLAE 5DTMA 1JQDA 2PT9A 1T43A 2PXCA 2VDWA 2YTZA 4B17A 3KR1A 2O0LA 1R6AA 4OQEA 5LQUA 5EGSA 3G89A 3LBYA 1H1DA 3EPPA 3HCAA 5K0BA 3PX3A 1BHJA 3TPZA 2AOTA 5CCXA 4MHTA 3MERA 1NKVA 2ZSUA 2XYQA 4OA5A 3HVJA 1EJ6A 4AZWA 3GRYA 4GOMD 4X60A 2CKDA 5FQOA 3SXJA 4RTJA 3PTAA 3LCUA 3HCCA 3PFHA 3TOSA 2OB2A 3DULA 2P8JA 3LCVB 3LL7A 2EJUA 1UWVA 4MWZA 8MHTA 4FZVA 3ANXA 2O57A 2QRVB 3OZSA 3B5IA 2VP3A 3KPWA 4E31A 1AV6A 4RTSA 1AF7A 1F3LA 4BP1A 4U7TB 1ZHFA 1NE2A 3CKKA 3NTVA 2HR1A 5C9ZA 4JXJA 3GNLA 1QANA 2FYTA 2ZFUA 1RI5A 4QDJA 1VL5A 3FUXA 5K0LA 3PS9A 4QVKA 2P35A 3GIWA 3NJRA 3A4TA 5KQSA 2ZTHA 4PYLA 3MGGA 4POOA 1HNNA 1VP3A 4OBWA 5C1IA 3DXYA 1L1EA 3RIEA 3C6KA 3E8SA 3FYDA 3UA4A 3R3HA 1SQFA 4YUZA 3LKZA 4O29A 4YUWA 2IDJA 5F2KA 3T7SA 1O9HA 1Q0TA 4GF5A 5E2AA 1VLMA 1NV8A 2OY0A 5EMJA 2GS9A 5LQRA 3LDFA 1R8YA 2PJDA 2XVAA 3DMHA 4KW7A 5DRTA 2AOUA 5E8JA 2PXAA 3V97A 1VQ1A 3G8BA 4EMSA 1FJXA 4BLWA 4DQ0A 5K05A 5C0OE 2YXLA 4HTFA 3UZUA 3FPJA 3RW9A 2PKWA 3E05A 3DOUA 4DCGA 3FPEA 4RYLA 1P39A 1ZGJA 5KVAA 2G71A 2VZ9A 5EKUA 4FSXA 4R8RA 5B1SA 5T64A 3THRA 4X61A 5LQAA 3KQQA 4YV2A 1XDSA 1XTPA 2ZBQA 2UYHA 3REOA 4RTOA 3VC2A 3EGIA 3FPFA 3JWGA 2IH2A 5DTRA 1R18A 4BLUA 5ICFA 4PINA 1RJGA 5BP7A 4PIMA 4GOOD 5H02A 4PYJA 5MHTA 3TLJA 2AS0A 1QZZA 5DWQA 2AN4A 5E9JA 2G70A 5HIIA 1OR8A 3PFGA 5K01A 5BXYA 4HRAA 2E5WA 3PB3A 5DRYA 3UWPA 2P3LA 1RI4A 4GEKA 1QAOA 1KPIA 1WXXA 5EHIA 3MQ2A 4DKJA 2JHCA 4QPNA 5ICCA 5D1NA 5GOZA 4HGZA 1JG4A 4QPPA 3KR2A 1JQEA 3BUSA 2CWWA 2PT6A 2ZBRA 3EGVA 5GWXA 3BXOA 5FA8A 4C06A 2C7PA 5E1BA 5EEGA 2ZZMA 3R0QA 4PWYA 1EJ0A 2WA1A 3GRUA 2P41A 1ZKDA 4C04A 2BZGA 1XDZA 3BGDA 5GM1A 5BW4A 4PGGA 2PVCA 3EEYA 3GRVA 3FUTA 1R8XA 4AZTA 1YFLA 3NVMB 4FGZA 4X1OA 4YMHA 1D2CA 2GAFA 2WA2A 4KIGA 3G2PA 2BR4A 3LCCA 4PCAA 2ZCJA 2OXTA 1G8SA 3FTEA 3HTXA 4GOND 4F85A 3HA5A 2PX4A 3DP7A 5CD1A 1SQGA 5FCDA 1ZQ9A 4V0RA 2DPMA 2ZW9A 3LGAA 2VDUE 2ZIEA 3M33A 5ICGA 5GP1A 5K0CA 1DCTA 1QAMA 1U2ZA 2I7CA 3QOWA 5FADA 3P8ZA 3QV2A 3BT7A 4HC4A 1XJ5A 3FUVA 2NXNA 3GJYA 4YUYA 2AVNA 4XUCA 1N2XA 5E1MA 5EIFA 5IH3A 5HIMA 1QAQA 3OZTA 2WK1A 1SVUA 5KS2A 3MCTA 3ELYA 5HILA 2JH8A 3R6TA 3NWEA 2IBSA 4M7RA 4WXHA 2HWKA 3SGLA 1JSXA 1G8AA 1N7IA 2A14A 2PV0A
chains in the Genus database with same CATH superfamily
5IXJA 3NVKI 1CETA 1JH8A 4N0PA 3BTVA 4P92A 4HX2A 2WD8A 5KYYB 3EPKA 4YJKA 4WZAA 2JK0A 2R7LA 4ZZIA 4IFEA 1XEWY 2HXYA 5J1SB 3MSXA 3DOEA 3NCHA 1T3GA 1Z39A 4J1QA 4LHSA 1XD2B 2VQFB 5EC8A 3S4YA 4EATA 5HJ5A 1T36B 2XYRA 1Z4QA 2IEBA 3P9CA 2FPXA 2WP8J 3GN1A 3EGDB 1XDDA 3KQVA 3NASA 3ZDQA 1EZ4A 3FMOB 1N6RA 1BU8A 2QOEA 1JIQA 1B6GA 2X42A 3LQ4A 4KMSA 4M1TA 5DTQA 1I2MA 3E5NA 2BYTA 3MVEA 1XPJA 1XCOA 3A6EA 1GNPA 4UNSA 4YRMA 5I9LA 3N5KA 3C39A 4MJXA 4EABA 2AXNA 2C0CA 4JNKA 2YWCA 4K9QA 3VTAA 1D5WA 4F8YA 5J58A 2QD3A 4C7VA 2F9FA 3EZYA 3B8EA 3IVMA 3KKNA 1SUCA 2ZSIA 4ZJZA 5HMLA 2J6CA 2HH9A 4YRIA 3EFEA 1ICEA 2NIPA 5E1DA 4AW9A 2PUGA 4IDOA 4PSUA 2I3ZA 1K8RA 3HLKA 3TI7A 1O95D 2XQKA 2ZIFA 1NN0A 3CJRA 2I03A 3VZBA 4NABA 2O1EA 2X14A 3HVIA 1GNSA 5AM5A 2ZJ7A 1ECLA 2C3MA 1NVTA 1PX2A 3HACA 1U2RA 1GCUA 4CM1A 1GR1A 3E58A 5AM2A 3ELDA 1GPNA 1I13A 4TQUS 2CXTA 3CNQS 5EMHA 1NVDA 1N5MA 4BCCA 5KJ6A 7ABPA 5JIBA 3WP1B 4B6EA 1NW9B 1GYPA 1W5BA 1Y9EA 3GBPA 4KG7A 2R65A 1I94B 2X5XA 2ODQA 4HEHA 3B78A 1HQCA 3IBCA 1UBHS 4G1FA 2X3YA 2C88A 2X1MA 1GA1A 1WUKS 3T06B 1YR1A 2ZPTX 3KQPA 5LLTA 1RZRD 3DVQX 1THTA 4I66A 2G9QA 5GPBA 1XDBA 3SR4A 1E96A 1REQA 2C5BA 2GBIA 1ISSA 4J9UE 4L3OA 3OQHA 1CR2A 2Q3JA 3WYNA 3ZDYB 1F12A 1PV2A 3WYBA 2VFAA 4GKJB 3LRTA 2C3PA 5I9MA 2RHTA 2PSHA 5BW5A 2WU8A 3O9ZA 4C01A 4NDAA 2B2NA 2CJYA 2NZJA 3GQBB 5FWYA 4C2TA 1NBOA 2CE2X 5DOZA 3G79A 3TW6A 1JLLB 1K63A 2WWFA 4FUTA 3ZYZA 4IO1A 4BU1A 2DYKA 1QYRA 5E8RA 4ZEMA 1NONA 3JATB 1UT8A 4YFYA 1ST2A 1SC1A 5LYJA 2DUWA 2N47A 5IMBA 4D44A 5JROA 1N5JA 3E7FA 4G9EA 2QBYA 2OV3A 1IAVA 5JMPA 4E30A 3K6SA 3RVLA 4A2CA 1IUKA 1PK7A 1TZJA 2LDXA 3WLLA 1OFTA 1OAOC 2XJ9A 3ZWBA 4D99A 1P0CA 4DR1B 2WFMA 4LZOA 1RM0A 1Z74A 2FX5A 3IC5A 2EVWX 1SOMA 1QRRA 4LIPD 4RJIA 1K1EA 2D5BA 4X8OA 2GHQA 1SFRA 1IFXA 1EB8A 3GLFA 1YF3A 5J4LA 2WMYA 3Q2IA 1PX0A 1SN7A 5IM5A 4LE1A 3RTDA 3ZDEA 3T34A 5LOVB 1LDMA 1DHRA 3I53A 5EJFA 1JLHA 1Y37A 2R5FA 5KHAA 5JJ5A 4OMDA 1WD7A 2XF8A 5DPMA 4OUDA 3DZFA 5JNRA 4FGJA 2ZSFA 4PYIA 2WIAA 2P9CA 3DBVO 1DWUA 2NYVA 3Q3VA 4LMRA 4NU6A 3SDSA 3TLXA 3I9JA 2VRNA 4EB6A 3Q8WA 4PSCA 3TGPA 1QQBA 1G3IA 1H0RA 4TKUB 1P0PA 1LJ8A 1IMOA 1K2VN 1J0CA 4AY4A 3L7JA 3JU3A 2H2GA 4K40A 3S8YA 2WC1A 1UBCA 1L8QA 4BE7B 2VTBB 2QE6A 3KSMA 1WVGA 3HVHA 3WJ2A 1W1WA 4HLQB 4F04A 1CY0A 3BIOA 3KJXA 1ZWKA 2RGXA 4LBZA 3KC2A 5M3BA 3HK2A 3WNVA 4LAFA 2JIOA 3WZ2A 4C6RA 4PG5A 1XTZA 2KSQA 2QLNA 4ONEA 3TKAA 4BCBA 2F55A 1H8HA 5KQMA 4NCNA 1Q1QA 5F1OA 3A7DA 3QQ5A 3ESAA 3I05A 4LGVA 1VG8A 4M38A 4NG4A 1P7ZA 3KUUA 4KOEC 5B58T 4M1WA 1J7JA 2AHRA 4DLKA 4QFBA 3AEUB 3I28A 3KAJA 2NXCA 3EDCA 2QUAA 2GPSA 1G19A 4O4LB 1EX1A 4XGIA 3U4CA 3KTAB 3F5DA 2QJWA 4BVBA 2X6TA 2FQ1A 2AQ8A 3P9YA 4IJWA 3JVIA 3BG5A 4ZI2A 3T99A 3MYRA 5HR5A 2QN3A 3U3OA 1R9GA 1V35A 3WKBA 5HZKA 2NG1A 1WSAA 2AK2A 3OQBA 3RKUA 3JAMA 3TW4A 2LW7A 4M1YA 1IZ7A 4JL6A 3HJFA 1JXAA 1RXCA 4O0MA 4YRQA 3GXBA 4IQGA 4O63O 1PV1A 1LI5A 1W4ZA 1WEHA 5L3RA 1QTNA 2HA6A 4QM6A 4JDUA 1TA0A 3BYZA 2PAFA 3DWGA 1VL6A 3KQOA 4I19A 4IX1A 4L4ZA 5HE9A 3PQ2A 3PXDA 1O6BA 2GEDA 4ZOQI 3SLGA 4CM6A 1MEOA 3UW3A 2DGDA 1FSFA 3D2BA 4UQPA 2NV0A 4I50F 1V11B 1PO7A 1DLJA 2PRJA 2ZZKA 3BCRA 4Q3CA 4YJ2A 3I6MA 3ZGOA 3IT3A 2JHPA 5LM3A 1SUAA 3I39X 2ZM6B 1MJFA 4AL4A 3DKRA 3GFFA 4RQUA 2P69A 2PX8A 4X90A 3S2FA 2C7OA 3MHTA 2ODBA 1FJGB 3R6DA 4KGZA 4KWCA 1EGAA 1WXGA 3WLEA 5IKMA 2HF9A 3LHSA 5FX2A 1NFFA 1YB4A 2PSJA 3ZE6A 2B4AA 4R2KA 2HU8A 1WKVA 1KC1A 1PL6A 2REQA 2X0FA 4EDFA 2OO3A 1XZQA 4ED9A 2DEUA 1K7SN 2ZUBA 1E6CA 1GNQA 5BWNA 3DEIA 1UANA 2IA5A 1SH7A 1BKSB 1CP2A 3UK1A 4CHTA 3K1AA 2YV4A 5EY5B 2NACA 1UZNA 3EEQA 1RWKA 3SM3A 4B7AA 4JLMA 4B9EA 5C7IO 4NDZA 1XE3A 1DB3A 4DA4A 2VH5R 3IB6A 1Y5MA 1VLVA 3IE2A 1T2NA 1IM2A 2JFGA 4ZOEA 1DI0A 4LRTB 4I36A 4QDUA 2FPIB 3EDYA 4QU0A 5DBEX 1J8FA 2C3YA 5CA0B 1EESA 1Z25A 5IK2A 3I01A 3R5KA 4J3JA 2GXQA 4BGVA 5I4BA 4JSRA 1NG9A 3PJEA 3PC4A 3QBDA 3E22B 1HETA 3ZLTA 1RXSA 1ZIOA 1OV4A 2DC1A 5CFLA 3ISVA 5GONF 4EO7A 1CQXA 1LXCA 2IF2A 2GXAA 4UHFA 3GT7A 3TQSA 4KDCA 4DQVA 4OX9B 1BCRB 2JNWA 2WU3A 4GMGA 4RY8A 3AIOA 5FTJA 4DADA 3NDIA 3CUKA 4FEYA 3KYCB 4G4IA 2XIJA 1SRQA 3PC2A 3G2HA 4BC0A 2M98A 1RPJA 3O2QB 3KWLA 5ERXA 5I45A 1I1NA 4BHTA 3ESDA 3STYA 1II0A 4YRDA 1OREA 1WZUA 2GCOA 4IMPA 3I9OA 4C6TA 2ZK7A 3Q72A 1T24A 1HOTA 3B9BA 1LK7A 2L0XA 1TYCA 1ZJYA 2R8RA 4D4JA 2HF8A 3LF1A 2A94A 3MJEA 4B3TB 3Q6MA 1T1EA 1GVHA 2G1UA 3IFSA 3DZ8A 1I5OA 5A9TA 1Q7BA 2PRKA 4LF6B 3T1OA 5I9IA 1PT8A 3IAM6 3RG2A 2HY7A 2WFLB 4Y2PA 3A37A 3OLZA 3ZCRA 2P3OA 4MS4A 2ZANA 1M0TA 2PGXA 3K2QA 3PF8A 1U0NA 3T7JA 1OLOA 2F59A 3ROMA 3PCXA 1ZGAA 4B43A 4IIXA 2RC5A 3N3BC 4R8KA 2G07A 4IDPA 2Q5HA 2QX7A 3H0CA 3EF0A 1ZGCA 2XUIA 1KEPA 1RC0A 2A7XA 3DXFA 5TRTA 4YGYA 4OBXA 3KOZA 4TTSA 4WN3A 1CS4C 2IU3A 3NIWA 1MLDA 3ZW7A 4CR7A 1J8VA 2Z56A 1OB5A 1HT1E 3DLAA 1WDKA 1H2RS 2XVXA 4PQRA 4M9RA 4G0PA 4PHFA 5FI1B 3UJ3X 2AUMA 2XDYA 3WMWA 1XMOB 2J1LA 1L5NA 1BXGB 4RLHA 1W36D 4LF5B 2Z1DA 3CO5A 3UMSA 2AI1A 1KMQA 2LDBA 3DNPA 3AZQA 3LPNA 2IZ0A 3WGMA 4DANA 3O95A 1JU9A 5A1JA 4GOLD 2QE7D 1YJXA 4KXLA 3DLBA 3E35A 2JZNA 4OHRA 3KP1A 5ECDA 3U1TA 4F84A 5IASA 1XD8A 4B2YA 2YWHA 4TLEA 1RABA 4PHHA 3DE4X 3OFSA 3U49A 4EUFA 2TSYB 4ZTZB 2R1TB 3FX2A 3URKA 1K5PA 1RADA 4ER5A 3PEVA 3PICA 1JPUA 1KSHA 2C4KA 2W2OA 3KKEA 1XVVA 3Q1LA 3PQ3A 4NDNE 5EZYB 4B3FX 2R4QA 1M2VA 3L8EA 4GKVA 3V8EA 2FWIA 1HDRA 4S0ZA 1QIGA 4HPJB 5L3SA 3TCNA 4BZZA 2PXCA 2XUZA 1I3OA 3FHCB 5EP1A 1DOZA 2O0LA 4MPDA 2DVMA 2HDHA 3AUTA 2QAIA 3DE5X 3LBYA 4IYRA 5C4GB 4E0BA 1ZR4A 2EKDA 1F0YA 4R7TA 2GBCA 2GCEA 2ZI9A 3B85A 3LWNA 5BSEA 4JVLA 4KVAA 3HRHA 3E3LA 3FLAA 3ASZA 3OP4A 5CYGA 1NF9A 1YKGA 3AUJB 3CN9A 3Q7IA 2CFSA 4M1ZA 4LDAA 1ODJA 1VI5A 4II2A 1AE1A 4E15A 3MMNA 3SAJA 5BVGB 5KTPA 1LSOA 4MDEA 3QWAA 4DIKA 4RIEA 1D6SA 1KI2A 2OZLB 2HBYA 5CG2A 3LT4A 2OK8A 2VDNB 3S6JA 1V1MA 1Z82A 2XDWA 2ZRMA 4EPWA 4YYZA 5HPYB 3DPIA 1R66A 3L6UA 2GMWA 5BN4A 1WCWA 4YRPA 2OP1A 3VXKA 4D81A 4JYAB 1JA0A 3DZIA 5EQDA 4CMEA 4KAXA 4E5VA 1N2BA 2WJGA 2XE8A 2ZIZA 3SQNA 4BP1A 3V8QA 1IOZA 5IYZF 2H1SA 5LWQA 3H42B 2HQSA 1DIGA 2WTUA 4JXJA 3VGJA 3F6CA 1JWAB 5EKTA 4YRFA 3HZRA 5JS2A 2Z58A 3FUXA 4DHWA 1QP8A 5I4CA 2VJAA 4MW9A 3WL3A 1AO0A 1JJ7A 1RKVA 5CX1B 4C7JA 1EDEA 4F71A 4UARA 3S2SA 3L79A 4JLWA 2RBEA 1TYEB 2ORIA 4R8VA 1DKMA 1VLJA 5ALKA 5JBIA 1W0JA 2FTKE 2IPNA 2PBZA 2Z3VA 3GRAA 3I6IA 2YJNA 3IOMA 3QJYA 3QUSA 4G5FA 1VKZA 1Q6ZA 1A9XA 3QVTA 3IOCA 2R9VA 3H1GA 3SBDA 2OM2A 2K2QB 5KMGB 1IBMB 2O8BB 1X94A 2PR7A 3S2UA 1DE0A 1M5RA 1T4CB 2XVAA 4L27A 4LXQA 2PS0A 3PE3A 2FXVA 5TARA 2D5LA 3NQ41 4GKKB 3RRFA 1EP2B 2EZTA 4U4AA 4AP5A 4RK7A 4LE0A 5CGZA 4OIMA 4DLLA 3NEYA 4QAQA 7REQB 4LOKA 3RT1A 3DZGA 2O7SA 1LSUA 3RW9A 4LBWA 4K6GA 4RJ2A 3K53A 2JLUA 1MIOB 1JILA 2EDAA 2Y1LA 4YMLA 4IO0A 4P7BA 4UEOA 3AF1A 3TIIA 3FI0A 1FFHA 3R5JA 3FMGA 4LJYA 1Y3DE 4RZ3A 5AKEA 4NV3A 2F4NA 5BNFA 5C7LO 7ADHA 3GP5A 1Y3CE 5JMOA 1AKVA 1Q19A 4OVKA 2FZCA 1V1JA 1UK7A 1ZBDA 2IIVA 1KJ9A 2OCXA 4NFYA 5BP7A 4EECA 2Y71A 1YMVA 1GU7A 1E8DA 1M75A 2XMSA 4RVOA 3DJFA 4R3UC 1CQIA 1E7QA 2IGBA 2NV2B 2WIFA 1CY7A 4YT8A 5JNUA 1P5JA 4CNQA 2VKTA 1KVTA 1W2GA 3ND9A 2NW6A 2ZRFA 2XUJA 2I4NA 4RMJA 3WB1A 2XSZA 2B35A 1KMHB 2XCUA 3JD0A 1H4TA 3NNDA 4JENA 3Q6IA 1S1CA 2OSBA 2IS2A 5F7ZA 5CDUA 2C31A 3BZUA 2OHXA 1RAHA 5GOZA 4P84A 1IHYA 4INPA 1NVVR 1R10A 1JQEA 3OETA 4G63A 4MQFB 1BXRB 4XIJA 3AU8A 4V03A 4YCAA 5E6RB 4OUKX 5KKAA 4GX1A 4UOQA 5CB4A 1SHZA 1YZNA 4X65B 1ZWLA 2C57A 2Y1CA 4BNTA 1YD7A 4ETWA 1U6KA 4WNCA 3P9RA 5D5PA 2D4AA 3L8YA 1XDZA 4Z5XA 3GJ7A 3UCEA 2NZVG 3AR6A 4DW8A 3HN6A 1HSOA 2J0UA 1UPBA 1WWKA 3U31A 3WV4A 3UMBA 1D2CA 2GAFA 4RSMA 2ZCJA 1U0BB 4DM4A 3LA6A 3CWCA 1UH5A 1G8SA 3HCPA 3RC9A 2CDAA 2LZ0A 2ZAGA 2B8JA 4O2AB 4RF5A 5KOYA 1RLTA 1F0KA 1ZQ9A 1JG7A 1G8KA 3MTGA 5IG2A 4BLPA 1HYGA 4V0MA 2ZW9A 5AO9A 3PI6A 5FPPA 3TPFA 4GT1A 2OVBA 3M3HA 1QAMA 2AGVA 1E63A 2BKAA 4HGRA 5FWNA 2RGYA 3HNPA 3RAEC 4B0PA 1XLUA 1L7RA 1KAOA 4J4BA 3P2MA 1QYWA 3SIRA 5EIFA 3AC0A 4QREA 2CKMA 1PJ3A 1YMUA 1L7MA 3HGMA 1FSZA 1GFWA 3HJGA 4G23A 5AWFC 2WVJA 5HILA 5JG7A 2HWKA 1B6TA 4EGCB 1THMA 2PV0A 1KKUA 3MOSA 3QVLA 4J0CA 3D4BA 4N3AA 1LC0A 3RU7A 3ZZTA 1ZSYA 1KNQA 2UUPA 2LVBA 3D6AA 4L4UA 1JIVA 2BGWA 2J9RA 1E2QA 4AS3A 5L4SA 1U2SA 1WXIA 3PYMA 2BFEA 4HDKB 1PSWA 2DY1A 2G9RA 1E9FA 3HXKA 4EITA 3N2ZB 1CDDA 4BKQA 3PEYA 4Z1MA 3M6IA 3OQIA 1JDBB 4X41A 4RNDB 3CKLA 4M6WA 4BQIA 3WR5A 4F9TA 3UNXA 3A4IA 3IPRA 2I91A 5K0TA 4B3BA 1LI4A 4XX1A 1ZK1A 4IS2A 2O52A 1FUIA 3LYUA 3NR2A 5JOQA 2B7LA 2Q5FA 3DL0A 3ZDDA 2F9LA 3CONA 2R5WA 3OAAA 3TB6A 1HR0B 1QPZA 1KRWA 3I1IA 3QF4B 3GNQA 1RWXA 1E5QA 5HF9A 3WKAA 1TK3A 5GJVC 1U3VA 5B6IA 2WHPA 2C8VA 1IQRA 4I0WB 1IZ9A 4M76B 1ZPDA 1B2RA 3ROEA 5L51A 1WA5A 4PZUA 1WUIS 3H0EA 3MT8A 4I3FA 5AKHA 4AI6A 1CQJA 5BQOA 4G0OA 3IAS1 4D9KA 1PL7A 4J0IA 3FM9A 4TSKA 3PYXA 2H1IA 4HMQA 3VH1A 1W29A 1VHWA 1OI4A 3A2MA 1UPAA 1Z5NA 2NTEA 3IA7A 1FFCA 4DLSA 4HVCA 1KYQA 2J3EA 4LJRA 5TMEA 2XODA 1Y9JA 1SURA 3HO8A 4U9UA 4YAIA 2REOA 2JAOA 3UJDA 4ZFNA 2QORA 4IFIA 4YC7A 3TCKA 5FHRA 3EH1A 4ZGBA 1E3SA 2DCUA 1M2HA 2EFHB 4BVHA 1UBOS 1M6HA 1QE0A 3FB4A 4QPJC 2SHKA 3CRQA 1OHHD 4IDFA 5JTTA 3V1MA 2BLNA 2CEKA 1EYZA 1RQ2A 2HZBA 3D2AA 5FOXA 3H1TA 5KAPA 5CB0A 2GQ0A 2W0MA 1AIPA 2BMFA 4AZ3B 3L2OB 4Z1OA 4TXLA 3MJ4A 2PNFA 4UFNA 3PRJA 1FTWA 1N2CE 1RCUA 2UZ4A 2B7BA 3R77A 1M8GA 1OIVA 2D5CA 1VP9A 4R0VA 1JHUA 3HDYA 821PA 3O8CA 3W5UA 1H93A 4N5IX 1T3LA 1R5JA 1RLOA 5JSYA 1NJ2A 4G2NA 2C2ZA 1IYZA 3ULKA 3O82A 1NUHA 3A70A 3OUUA 1CEXA 3L4EA 4MVJD 4F4UA 3R24A 2I3DA 3MAAC 3MJCA 4WN9A 1YV9A 4R1PA 1GAQA 4PXYA 1PR6A 3MGCA 5B4VA 1VMKA 3NBAA 2XKJE 5JAZA 4EF6A 4A15A 2QXYA 3KSAC 2W6ZA 2YXBA 1T5LA 1OBVA 2QSJA 5A5DA 1JTVA 4KPUB 4EYOA 2NO7A 4PTZA 3D0OA 4CTOA 1QFZA 4ZYXA 5LYJF 4PHCA 3EVEA 4K81B 4DA6A 4GRAA 4TYYA 5IP5A 4MVYA 3VPAA 1EINA 5H1YA 3JPWA 2DFNA 2QN2A 2G1AA 1J0XO 2EHDA 3SNHA 1K8XB 4JBNA 1Z0FA 1YU9A 3WHIA 4F2DA 4HBGA 2GJSA 3EVTA 1N7JA 4WNIA 5IC6A 2PT5A 3FTNA 1F14A 3VYVA 1JG1A 1ADJA 1DAPA 1G98A 3ND6A 2P0EA 3ZZUA 5DWVA 3OTIA 5BOSB 3C5VA 4UEQA 4N8EA 5LMZA 2HO5A 3KVRA 3TQOA 1EXNA 4ENQA 4FFBA 1W85B 4YRBA 1M54A 1WB5A 2V6IA 4L3WA 2JIMA 5L4LA 3O47A 1HEUA 5BPFA 5KTMA 1UOQA 5EMKA 2DLNA 1ONNA 5EZQA 2IZ6A 3K09A 1QG4A 3EA5A 5SZJA 2V9ZA 3L0YA 3Q11A 2VDRB 4PGMA 4TLDA 2ZVJA 3G49A 2BM1A 3O73A 1SZJG 1EAMA 1Q7CA 3GGOA 2HT6A 3PD0A 4GR4A 3TEJA 3LBIA 3MSCA 2O8NA 3G7SA 3MWJA 2P1DA 3I2IA 2JGKA 4DCNA 5K1ZA 4BLVA 4EFDA 2XEXA 2VRCA 3V3TA 3GLVA 2NPIA 3IQHX 4DREA 2PGJA 4UTRA 3WL8A 1PHPA 3TGLA 3DDHA 5EXPA 4Y2HA 1KS2A 1KXZA 3RUCA 3ZWCA 2Q1TA 4BASA 4Y6RA 3R9XB 4WVLA 2AN5A 4FS3A 2JLQA 1ZIPA 4RF2A 1QC5B 2EJVA 4DMKA 1OB2A 2GAJA 3K9HA 1S7CA 4PLCA 4EKGA 2F1HA 2Q6TA 3HDVA 3HM2A 4V0KA 1D9XA 2A1TR 2WF5A 3FTQA 3HJAA 1E60A 4G5OA 3VNSA 3N5CA 3DVLA 4EIWA 3OCUA 1EBUA 1G21A 4L3VA 2QP4A 5IJ9A 4GOJA 1CYEA 4FINA 3WK6A 3K15A 2VH1A 4L74A 2HI0A 4LHVA 5THQA 2ZI7A 2VQ6A 3VVLA 2AZXA 3D2CA 3AEZA 4HUJA 2HRDA 2YFQA 7AT1A 2GN1A 5JNSA 3GJSA 5ICCA 4EKNB 3WMGA 2BF4A 4ITUA 2EOAA 4HDCA 1BRTA 1UMCB 2X9NA 3LBFA 4TMFA 3SZOA 3UKJA 4MAFA 3B9QA 4OFBA 4V0OA 1C81A 1XAIA 4QOFA 2QNBA 2V6BA 1KJYA 2CY0A 3OU7A 2X8WA 3TK1A 3UIEA 3TRHA 3ZKAA 4LMPA 3EEFA 3M70A 2FP3A 2JCGA 5JJCA 4DRZA 1BMDA 2ZM5A 2O1WA 3DOHA 5JATA 2B4TO 1DBPA 4ZA2A 3FH0A 3KDPA 3LPMA 4ZXPA 4XTCS 3H1EA 1QHYA 2BWJA 3Q9UA 1L4BA 1G17A 1A50B 3O4GA 4J43A 3FZYA 3HYTA 4LK3A 3AY3A 1I0IA 4NAVA 4KYTA 4KSYA 3MWFA 2CNBA 1ORRA 1L3IA 2FHPA 3R5FA 4AIRA 4NMLA 1YDFA 4PXSA 1A9ZA 2ZSHA 1F17A 1SCDA 4CIVA 5JD4A 3I5AA 1IE3A 1YVPA 4YCJA 3BILA 4B3HA 2RHLA 2GEJA 1XEWX 5EWMA 5JDIA 4LDRA 2HHCA 2V0CA 1FU8A 2FJUA 1FYEA 4MQBA 2X4IA 1E1KA 2ZYGA 4J03A 4ENPA 4OQXA 1SWWA 5DYYA 3UJNA 4JQOA 2X40A 4Q1EA 1P62B 4JSTA 4WPGA 5JNWA 2V7EA 3WBBA 2VYCA 3K0SA 3GPCA 4QC2A 2DUUA 4XDHA 4EA7A 4R8MA 3RRNA 3PPIA 5A02A 2BGIA 4Q19A 1XZMA 2CVFA 3ESBA 1N34B 1B15A 4Y0AA 4G4SP 4PIPA 3REGA 3WNBA 2NMVA 1XLWA 2LKCA 3ZGXA 3LXXA 4MMXB 3HB7A 2WMOB 4MR8A 4YI5A 4BQRA 4JQCA 2PCJA 1OY1A 3IL2A 5AQEA 2BGLA 1QV9A 2WAMA 4YLGA 1S2GA 2QQ0A 2G76A 3H84A 3AWIA 1CF4A 1CUDA 1NR5A 3N7UA 1HSZA 3OOEA 1BQ4A 1G6HA 3T5GA 1ZNZA 1KPGA 1P80A 1J42A 4HH0A 1M1YA 1SCKA 5AHXA 3S7ZA 2JGFA 3VR4A 4CNBA 3D0RA 5J2TB 1OU0A 1Z6AA 4MYUA 4WVFA 3VO9A 2JPDA 1EE9A 2J3JA 3OEEA 5DB4A 1JDPA 1Y1KE 3I1FA 3HYLA 3FVVA 4KQJA 4PANA 3CUTA 3LZCA 1AQLA 2C77A 4MLPA 4X6XA 3QTLA 2XTAA 3C5CA 2A86A 2WWHA 5FPSA 4A8JB 3NTXA 1B8UA 1XFDA 2XB4A 4YUXA 5CYPA 5AJHA 2PLAA 2GERA 3HNRA 3D0KA 5EKXA 4ACAA 1NNEA 1U6JA 3OOJA 1BHSA 2G17A 3IURA 3TLCA 1RYMA 1ODKA 3L0PA 4L2IA 1FSGA 1QP4A 3HMKA 3K4QA 3MS7A 1VYUA 5CA1F 1DAMA 2QY9A 3ZIUA 3Q8MA 3VR4H 2GD0A 1NR7A 2WUVA 3QXGA 4NAUA 1AUQA 4K05A 1JRLA 3SJ7A 2CHUA 3PKIA 3N8IA 2HM7A 4FW8A 5HUJA 4D56A 3FR8A 1PBNA 1H2AS 1QKJA 3FZGA 5FORA 1NW6A 5C46F 3JRNA 4HVLA 4LGYA 2XGJA 4Z9FA 4UJ3A 4J76A 2JIPA 4H1VA 1NPTO 2GSDA 4IEIA 4RDIA 1OH8A 2G3YA 2GVNA 4G1UC 1A1SA 13PKA 4K6MA 5FKJA 4BNMA 3BK1A 4H6WA 2GZRA 2VNKA 4LYAA 1VB5A 3RF6A 2GSWA 5DK4A 3K6RA 4NBRA 1XO1A 3FPGA 2ILTA 2AF4C 2IBMA 4J8PA 3SICE 3GJTA 3ENVA 3H86A 4CN8A 1YNSA 4I5IA 4PQFA 2VSXA 1JA1A 1ZINA 1P60A 1E6UA 2WSYB 3AR3A 1XPUA 5IPFA 3IKMB 1NDUA 2W2NA 4AG6A 4BPRA 4ARZA 1AGPA 1RKQA 3FCYA 3U13A 1SGWA 4FNMA 3Q1KA 1PLJA 3DMTC 3O9MA 2R8ZA 4OA5A 1RWQA 3W1VA 4GOMD 4B8WA 3L4BA 3SEFA 5ALYA 4OIFA 1NXTA 4IW3B 2P8JA 4FGUA 4DLRA 4OL0A 2A5YB 1TRHA 4FMDF 2FW1A 1R0SA 2HQBA 3UMYA 2QGNA 3H9EO 3L02A 5FPYA 3DEKA 4G1BA 4BVJA 4DR6B 4D8VA 2HRBA 2AEJA 4MYSA 4P6VF 1TT5A 2FLKA 1RRKA 1SBIA 2DF8A 3RNLA 3R40A 4LDJA 1K4MA 1CD5A 2ZJYA 4QULA 2ID7A 2I9PA 5BQ5A 4C5AA 3K32A 4JEHA 5C8YF 3SE7A 3QE3A 5DGDA 1P5RA 1FJ2A 2B1QA 2V45A 2JKZA 4CG0A 2ZS7A 2LV8A 1H2XA 5CVCA 2VAWA 3HB5X 4QEDA 1M8KA 1R27A 5I7EA 2J3DA 4K28A 1VP3A 5C1IA 4NZMA 2D54A 2QZZA 3EFHA 3PDIA 2VAXA 2VDPB 2OG2A 4TWAA 4Z51A 5IKPA 2O5EA 1MQ9A 1YMQA 3ANLA 4K8RB 4KK4A 5CB8A 1N8TA 2GM9A 4UDOA 2BJHA 4GPTA 4XTRA 3PA6A 4ZQBA 2OZPA 2WIBA 2ZJBA 5E2AA 4N41A 2YVKA 1QLWA 3FSGA 5TB5A 1KR2A 1ZVJA 4M1MA 1TF7A 2HRRA 2DECA 5D3QA 5FUVA 2CB9A 1S8AA 2DHEA 3HFSA 2B0JA 3L84A 4LY9A 1NR1A 1M8FA 4Q1BA 4H08A 5CXQA 2XNKA 2HIGA 4DQDA 2VXCA 2DJIA 1COWA 1RYZA 1QM5A 4KN8A 5AJUA 3TTUA 1DRKA 1JL3A 3MMPA 1JDUA 3FPEA 3KTOA 3B53X 4MW2A 2I54A 2A1IA 4FNOA 3FETA 1ZOOA 2ZYAA 1LLQA 1YI8A 1CRQA 3EIWA 3QFRA 1UJ4A 4ZDWA 1AKMA 3WWDA 2DWPA 4DM7A 3ZZ1A 3T1YB 1CPYA 4L8GA 2Z2YA 3KIPA 1GTZA 4RTOA 2D5AA 3FPFA 1XSEA 3K9BA 1X74A 1R18A 1SUBA 2UVPB 2R8EA 5ICFA 1JDVA 1LQ2A 4MI1A 1BMTA 2CL6X 4R3WA 3ZWYA 5HSGA 2GBPA 3ZY4A 4L02A 4AF6A 4C0AC 3PITA 1I3LA 3D7SA 1NXWA 1QZZA 2A0XA 3GUYA 5KJEA 3VR5D 4PX2A 2FUNB 4MB6A 3NP9A 2H1WA 3B2EA 4BVGA 2TYSB 5LJLA 4KR3A 1GAXA 3IUEA 2D0OB 3CX4A 1DXYA 1E1QA 1U8CB 2VT6A 2I4IA 4P3NA 3P9PA 2J45A 2F1OA 4CM8B 5IJ0A 2CDNA 3C7TA 5C8XA 4RXTA 4NNOA 4HRVA 1TYDE 2I4TA 4H7FA 1NQVA 3BZWA 1M7HA 1GFSA 5JS8A 2XTMA 5TPZD 1VG1A 3SFVA 3U6KA 3BAFA 2RJ3A 3VU0A 3PI7A 3DDZX 3LW7A 4WXMA 5EEGA 1TM4E 1B0PA 1KJ8A 2HRZA 1DC3A 4JYBA 4FOLA 3RK4A 3WRWA 4PLVA 1ZKDA 1YRQA 1UBNA 1YBVA 3BTOA 2PMWB 3EEYA 5K3FB 3PZRA 1YK1A 3BWEA 3RPEA 3T9AA 4DZTA 1ZH0A 1P81A 1UJBA 5J2UF 4I1PA 1EQUA 5K5EA 2MYTA 2PZ8A 4ZYUA 4U3JB 3AHIA 3OZEA 3HTXA 2IYUA 4RZUA 4J1NA 2YHIA 3AESA 3HU5A 3IHLA 2I6SA 5FCDA 3KQKA 2DLDA 1CRPA 5CB4F 1SHLA 1ZEMA 2ZUCA 4OHFA 1ZR2A 4EB0A 4ND2A 1BH6A 3B1YA 4YRGA 2PUBA 5A6VA 4B46A 2AYXA 1ONSA 2X23A 4KXMA 3QA3E 2TS1A 2AC2A 2EP5A 3NHAA 2EIHA 2NO5A 3DLTA 3P4YA 5DYWA 3ROKA 4URXR 1QAQA 2C1EA 3C87A 4LSGA 1L5HA 1SVUA 2FE1A 1WP4A 3MJTA 2WM3A 5A04A 4G8DA 1NAIA 4XD7D 4RE5A 3OT1B 1CIJA 1LK5A 3BFXA 4ND4A 1M3SA 5DNVA 3LT2A 3HWRA 2OXFA 3KOMA 3C85A 2Y66A 1TO6A 4LSWA 4GXNA 5B3JA 3DFUA 2BRUA 3UWKA 1BKDR 2RGGA 5TGZA 4EHJA 4DG9A 5IT0A 2NUAA 1K7XB 3PQ8A 3Q3GE 1KAEA 5FLXA 3VH2A 2QVCA 2NYRA 3GH1A 4FX2A 2EFDB 2VF8A 2FX2A 1GUDA 4U2BA 4NK5A 3AIKA 1BAPA 4WKOA 3IKVA 3KQYA 3MIZA 1D5CA 3E8XA 3IP3A 4XIYA 1SK9A 4JOCA 4OD0A 3IRVA 4Q4AA 3VOTA 2I8AA 2CD9A 3A6JA 4RHFA 3DA8A 4PNHA 4GGMX 4BKUA 3A6HA 5KWSA 3ZUGA 4LMAA 1X7WA 5PGMA 2RKWA 3M6VA 3QG1A 5CVJA 5FA5A 1UBFA 4GNRA 1RXVA 3O7WA 4M87A 3KJEA 2Y77A 3OWOA 4DM3A 5ALUA 4F1WA 1QZXA 4LF9B 3CLTD 1ISJA 3MTIA 4AJIA 3MJDA 3GG2A 5KKCA 5A1TA 2HC9A 2BH2A 2UVDA 2RGEA 4RV5A 2PT7A 1YHNA 1S8NA 4IXNA 3RRXA 3BL6A 4PC6A 3SEQA 1KZ6A 1EHIA 1QGAA 3TOVA 3JALA 5DKFA 2GI4A 2HQ1A 1PNTA 1T6ZA 4X00A 3TTSA 4QNRA 4D98A 3SWWA 2JLVA 3G8YA 4QWMA 5KTRA 3HSYA 3VPXA 1BN7A 1QGYA 2RAVA 4A2PA 2EG5A 1VIMA 3MNFA 3PPYA 3ZHZA 1AMNA 2CSXA 3MUNA 3ROPA 3W3AH 1JVSA 4MKGA 3ZE8A 4YJFB 4AJJA 5C1BA 1O95C 2H31A 3U16A 1CEQA 4Q1DA 4IQ4A 2GRAA 2QY6A 3P2IA 1N9GA 3BD7A 3FB1A 3W6PA 5I5EA 1U2GC 5DFAA 5ULLA 4NENA 1F2TB 2JA1A 1HEIA 1EVJA 3HEAA 3KT6A 4RPHA 1PJAA 5BYBA 3TSAA 2CLMB 1C7QA 1BMFD 1YXMA 1MGOA 5DTEA 4Y2SA 2XB9A 3PE6A 3J7TA 1KGSA 1TQ2A 1V3VA 3HBJA 4A3SA 1TJNA 3EVCA 4R7GA 4L7VA 2BFCB 3DHEA 4ZI7A 3THYB 1LJUA 3HKDB 4EY6A 1Z2AA 3MUEA 3NHWA 3C3BA 5ITZB 1RJWA 4H9GA 3BE5A 3SF8A 3UA3A 3V4VB 2WQZA 1GVNB 2YX1A 3AHEA 3QKRA 4F6RA 5H82A 1JEOA 3L7LA 5I7OA 2WKRA 4MR7A 1OCEA 3OZWA 2Y1EA 3F9RA 5H16A 1O4WA 1XTJA 3NO4A 4V0LA 1G18A 2ZI4A 1FP1D 1GUBA 5FOUA 2E85A 1V6SA 1ZI9A 4PLPA 4TL6A 1SUEA 1NBIA 4HYTA 2P27A 3P5BA 3KB6A 4RVHA 4Y2JA 2W22A 2AX3A 5K51A 3DJYA 4E70A 1T9HA 2VJPA 4H2DA 3GLGE 2WWYA 1H3NA 2PJZA 4BFCA 1A96A 2G83A 4R69A 2FMXA 5BYKA 5ALSA 4CKWB 1SIWA 2BFAA 3KK0A 4JNCA 2QT0A 1QOQB 4UUBA 2DR0A 3SBOA 4DUPA 1YVRA 3U7FB 1ZH2A 1PFYA 3BMNB 4NOJA 3KZNA 4OI4A 2HWYA 4P82A 1CJUC 4RD3A 4QDKA 3H8JA 4GPZA 2FV8A 4L4YA 3OE4A 1AKTA 3KAKA 3GT4A 1F1JA 1JVNA 1CR4A 4RKRA 1JEQB 4NEGA 5EIBC 3VH3A 2OBMA 3FTDA 3KOWA 3Q7EA 5AK6A 5DXFA 2HA2A 3A26A 2XTNA 1WDMA 3EGXB 3QVVA 3JAKB 4FFPA 3HUDA 3CUWA 2B5WA 2EFCB 4Q05A 3D6FA 4FK8A 2HTEA 3BF7A 1ABEA 3FPAA 3QTBA 3PHGA 4GBJA 4XIFA 1PQPA 3G9QA 5FOQA 2G88A 2ZE8A 4DJAA 2YCLA 4MPRA 4K9KA 1DAIA 3MWGA 2IDZA 2O07A 2PZKA 5IH7A 2ZBVA 3Q8XB 4ZALA 1DPGA 1M5UA 5GV8A 1IXYA 3UMMA 4Q1FA 2AFHB 2L69A 3NG1A 5ERGB 2PX5A 1LLCA 1T8SA 4UUQA 4KODA 1TUEA 1Y4AE 1SOUA 3I8OA 1SQ5A 3EDOA 1R5NA 4K86A 1SO8A 1CK4A 1X1TA 4H6VA 3QKIA 5E3IA 5HW0A 4QKQA 2CNWA 3B6ZA 1G64A 3MRTA 1E1LA 4YAEA 5K6AC 3FYHA 2DBQA 5DOVA 1U7UA 2DH6A 2YQ5A 5EVJA 1KYZA 1PZGA 5LZ7A 3ERCA 2BGKA 3IRUA 2ZXEA 3ZWQA 3RK1A 5B3KA 4RO0A 4XARA 1F0PA 1Z5PA 1CFJA 2YOHA 1KFBB 1W5FA 2XX3A 3ADOA 3GRFA 4GE3A 1AUXA 3WAJA 4DCMA 3C48A 2VHQA 3KLNA 2PA0A 4AY2A 3BREA 5KCMA 1YOVA 3LY5A 4P7JA 3KYJB 2XBMA 3KUKA 2N9UA 1U1EA 4O2RA 3C24A 2X5NA 3EGDA 3R7BA 4N7JA 2I6UA 4JUCA 4LV8B 4Q48A 5EN4A 4ZIRA 1NRJB 4V0QA 1SBYA 3AEXA 2Y6UA 3I5UA 4XD2A 4B3JA 3AQ4A 3FKJA 1WMEA 5AJTA 1TADA 3DTYA 3OVMA 3L1HA 4JELA 4YASA 1F38A 4YRLA 3ETLA 1NI3A 4I4TA 3IX7A 1Q91A 2E1PA 2FEKA 4NU5A 4OQ4A 4PYNA 5JE8A 3DB1A 1YCGA 1Z0AA 3I4CA 3TLGB 1CJMA 5IULC 1TUIA 1BS9A 1O6FA 1GGKA 3IXMA 2QAGA 3LM8A 3M4XA 3NKVA 3OA0A 3D3NA 3QPBA 4BNFA 5BURA 4V1CI 2FMTA 2D7DA 4QOSA 3ENKA 2XWQA 3M4NA 3WLAA 4ZYZA 1E94E 2GT1A 3P2EA 4EYQA 4AYWA 4O2BF 1QP7A 2EX0A 2ORYA 3BWMA 4KWEA 2CMKA 1D2AA 3E1SA 4XYBA 3N0RA 5AUQA 4XVRA 3OE5A 1Q83A 1CE8A 3WFIA 3FSJX 5CTAA 4I6GA 5AVKA 5BWOA 1JDJA 5LNK6 1ZIYA 1O58A 1PQ4A 4O4JB 1GL9B 3CPHA 3PIDA 1MB0A 1YB5A 3O5AA 3ITEA 4MPTA 4XSHA 2QD4A 2MR6A 3MJVA 3VDNB 2A84A 4IV0A 4E2XA 1QIFA 3NDPA 4QYXA 4KHZA 3W8DA 3DH0A 1UOEA 1V1RA 2WTNA 3PR2B 4UW9A 5F21A 4G5GA 4IQFA 1KO4A 3T94A 3HU1A 1LZKA 1HM5A 5FEUA 1ZN7A 2IZZA 3TRKA 2AF3C 2OB1A 4FXOA 1K92A 4B76A 4PEVA 3L7OA 3L7AA 4D3SA 3ILVA 1EFPA 5FYDA 5A0VA 1D1SA 2X0JA 3X44A 4D9JA 1BNCA 1H8HD 1QO9A 2QENA 5KU1A 1E3DA 1E3WA 1GAWA 4ZT7A 1G2OA 5B2ZA 2J5RA 4RJLA 5A5GA 1AGRA 3KQTA 2ADMA 4MVJE 4BO8A 2DR3A 3V9PA 4P0QB 4LFAB 1VHTA 1UBSB 3QBTA 5JD3A 2JIZA 2AR0A 4DFDA 2X8BA 1K75A 3IDAA 3KKZA 3VJLA 1ZGGA 4UBLA 1NGSA 4UNRA 3T5BA 5JBQA 4LJ7A 1LPSA 2HA7A 3OIUA 2YRXA 5ICEA 1FTSA 4L7QA 1NBMA 4R3NA 3QXCA 1ZLXA 1KVRA 3QGMA 5HKOA 3JATA 4X8LA 4INJA 3P9QA 2WMNB 1K7YA 1YL5A 2WSLA 3M5PA 3IIMA 4Z3KA 1WKBA 2BBOA 1A7UA 5LPNA 1QIKA 3RVKA 4P3OA 1E1CA 1E32A 1SEPA 2DFVA 4AG3A 4GBED 1QHNA 2WB4A 3KOYA 3ZCUA 4AJLA 2P6NA 3OSZA 4DLXA 4YJGB 3EF3A 1ISIA 2QN9A 4CM4B 4ME6A 1SB8A 1XZKA 2R96A 3H18A 4C30A 3IAUA 4N6NA 1UKYA 4RLQA 3HJNA 1M6VA 1N2HA 1G7RA 4RWZA 4WK0B 1L5GB 2EKBA 2ST1A 1J1ZA 5SZKB 3RYCB 2CVHA 3UAOA 2VUHB 3E3MA 1NW7A 1G2IA 1WCXA 1LA2A 2A9QA 2E18A 3CIOA 4HZUB 2Q0XA 3O8LA 5HJ7A 4FOSA 2V7GA 2P2LA 4HNUA 2RB5A 3ZGZA 1ZOSA 4XVHA 4ZEWA 2IY8A 3GELA 2BGRA 4RS3A 5FH9A 2WHQA 4IX9A 1DEHA 3W79A 5KWJA 3D54D 4NYIQ 1RWBA 2IHJA 3OCJA 2JIQA 1CC1S 3DE0X 2IUYA 3THWA 1XR3A 1G8HA 2VTBA 3FRHA 4A8TA 3FWKA 5JJKA 3FUCA 4IL5A 1FQOA 3EWNA 1RI1A 3MF4A 4FW9A 1BW9B 4JKYA 3RH0A 1R16A 2NAPA 2P30A 1N9ZA 1KK0A 1PYGA 4OK3A 4UJ5A 5ALNA 3RFXA 1B7GO 3FYUB 3EH2A 3U56A 3H3XA 3TRJA 3Q7PA 1QIMA 1RHRA 4FN5A 3AERB 4JVNA 5JC1A 1VPTA 221PA 3QVUA 1E7RA 1YRLA 4K9OA 2Q5JA 3PL1A 5BSMA 4MCIA 2O23A 1Z47A 3KKQA 1I8TA 5BVHA 1EHCA 4O4LA 2A5DA 3A04A 4AM8A 2ZUSA 2BKLA 1CB0A 3C98A 3UK6A 5IK2D 4NOLA 2AEEA 2PYZA 5DNDA 2QROA 5BNWA 1B00A 5BRJA 1SIUA 1Q50A 4IKEA 3WLKX 3D64A 4R4JA 1TAUA 2ZJFA 3PX3A 2JBAA 2VWGA 5E7JA 4W9NA 1D09A 1K27A 3TPZA 4BVKA 2JRLA 2PZFA 2D1SA 2XYQA 1CXZA 1E6WA 1Y3BE 2VNJA 2EEZA 3HVJA 1U8YA 5CAEA 3GP8A 1JJBA 1E2KA 3SXJA 1NWCA 5D01A 1E9BA 4A16A 1MENA 2FGJA 4IXMA 2GEKA 1R4NB 1I51A 3G1UA 4U63A 3VR1A 3MJFA 4KQ6A 1CT9A 2VJMB 3C6QA 4GGOA 2V7VA 2ZB7A 2I1QA 2O2YA 4LFCB 4KAJA 3CSUA 4P5PA 4R1SA 5TDHA 2IK8A 5EHZA 2RHOA 4J0QA 3O0DA 2RG1A 5JSZB 1EGQA 1QK4A 1V5GA 1SD1A 1WMDA 3KUXA 5F5XA 4URYR 2YDYA 4JYPA 2WAOA 3GK3A 3X1YA 1XZBA 3QV1A 3TD6A 4WBNA 1U0JA 2Q1UA 1M1XB 5G0TA 3HPQA 1I0ZA 4MUXA 2JLYA 2QUJA 4G5YA 3FOZA 2EBUA 4RADA 2IZ7A 1YKSA 3O1LA 3UK0A 1RBQA 2GZ2A 5AI9A 5CDFA 1BGXT 3T7AA 2Q9UA 4PYLA 3L6RA 4RAQA 2LRHA 3R7WA 2VK8A 3O21A 3OURA 1FX0B 1D9ZA 4IDNA 4WOBA 1NXXA 1XP8A 4F3NA 4QXAA 3GUHA 3QE9Y 3OSUA 5ES3A 3ETCA 4MWCA 3VOSA 3QWFA 5LQRA 3KYBA 3CEAA 1YULA 4LI3X 1YAJA 4Z49A 1ECCA 1R8YA 2OENG 4M7PA 3R7AA 3HBNA 1T2CA 1IAQA 2AEFA 2DR2A 2X9QA 3MOGA 3RADC 3DGFC 2QX4A 3A3NA 4QARA 3Q41A 1YJ5A 2ZROA 1VJ1A 3E9ZA 4WKNA 5IBPA 5IAOA 3CLRC 5KZMB 3JYHA 1NVUQ 4HMPA 4LOJA 1DDGA 4YALA 1KYTA 2M2IA 2VJLA 3FJ1A 4G84A 3QPUA 4DSTA 5JHHB 3I04A 2R47A 5T64A 1EVYA 5L3VA 1X13A 4OQMA 4S24A 1WJGA 4QNMA 4XXHA 3F7NA 4KLCA 2QTNA 4JCOA 4M8IA 5KNDH 4FB5A 1R5BA 1TD1A 3RYHA 5F12A 3ORQA 3O03A 2ZREA 3I37X 1ZUD1 1OVMA 1DLIA 5HBGA 3RRMA 3TR0A 2V7WA 3FCOA 1C8BA 1Z5OA 1D0SA 1UMDB 4HQFA 4LRWA 4E94A 5BQ3A 2IS6A 2HWXA 3PX7A 2IHBA 5HIIA 3PFGA 3G1WA 2XUDA 1SM4A 4DDTA 2G08A 5HF8A 3QELA 8OHMA 2FG6C 1GSOA 1KS9A 2VBFA 3BD6A 5EHIA 1GGHA 2ACKA 2PD4A 3AYXB 3MWEB 4ODIA 4MQLA 2RGAA 2GUGA 2QUIA 1UOPA 4AJNA 1L4GA 4YP5A 4PZ0A 4YMSA 3ABOB 3ROZA 5CLGA 2BT4A 4MYDA 3STWA 4AF7A 2P2GA 1NM5A 3DP9A 3GRKA 4GMXA 2Q9BA 4I1IA 3JQ9C 4UZEA 2ECFA 4II3A 4Y2GA 4R1OA 3X1DA 4EEZA 2VT2A 5FJJA 2V7PA 4CIYA 4ZAGA 3BHNA 3BB4A 7GPBA 1NP7A 4PQYA 5AW4A 4HEA6 1O96A 1T0BA 2HNAA 2JVIA 2XEDA 3I6QA 3IJEB 2AW5A 3LAWA 4RHYA 3AEKA 5D5HA 1IL0A 1VA5A 8ADHA 2WFLA 1YDGA 1Z6XA 5T4FA 2Q7OE 2IS4A 4O02B 1QDUA 5EIOA 1KFEB 4AROA 1JB9A 1KBZA 1X7XB 1NSFA 1R8XA 2RB4A 4PO3X 3ZH9B 4J0EA 1PKEA 3NVMB 5LJIA 5HJEA 3VPHA 5KAMA 2RD2A 2SICE 4CDNA 3HFRA 5TF4A 1C5KA 5K6RA 3QFHA 4P3PA 2H08A 4YB8A 5I8PA 1AQ6A 1ZA1A 3INGA 1VKRA 5LD2C 3JQFA 2FPGB 1U2ZA 2ZS8A 5E0KB 3RSOA 4TL8A 4BKMA 1JYEA 4EPXA 2P2NA 3FUVA 2OV2A 2Y1KA 3RNOA 2FZGA 3JX9A 4AMYA 4D43A 2EYUA 1JHMA 1I5EA 1P7VA 3OZDA 5ALQA 4C3VA 4BX9A 1DV1A 2JIBA 2CLHB 2FUG1 2JD1A 5HJ2A 3A3OA 4UVHA 5AVVA 4QJ4A 4GP6A 4ZEXA 2BIFA 2V4MA 3OG9A 1NLMA 5BV2P 1OJ7A 1TEVA 3S2ZA 2GA9A 1R0BA 2IPAB 3B7PA 3ZXYA 1IC6A 3K0BA 4J0JA 1FDWA 1AQJA 4RA9A 4R83A 2Z6QA 2XMPA 2WJIA 1IWPB 4XYMA 2VUTA 1SCUB 3EXEB 3OIFA 3OJEA 3JTMA 4JUDX 4MUNA 3R3XA 4MGYR 1DVRA 1XDWA 2E4ZA 5IVKA 3C3EA 3QM1A 4DV1B 2B8WA 4BTLA 2FEXA 1DBWA 2D8MA 2IDMA 3UXHA 2VJCA 2ZR8A 1UM8A 3HXQA 2EBHX 4FOTA 2RGRA 2PKRA 4ETMA 2GB4A 4LW8A 4WA8A 1UOOA 1QYDA 2C2OA 2ZUFA 2EU8A 3RFFA 1Z6GA 1V9SA 4ETIA 3S81A 3R7FA 2ACVA 2ZSEA 4M0DA 4N9QA 5LZ5A 3HA7A 2QVGA 1IBRA 1VRWA 1YI0A 4LY3A 4NPAA 1CIPA 1D3AA 2VK4A 4I1YA 1D7OA 1QTRA 1UDXA 3DEJA 2GZDA 2HMYB 1U7TA 4A0QA 4RVNA 1D2HA 2PLRA 1V39A 3PFKA 1WSWA 4QOGA 5AR1A 2WHEA 1W8DA 2XSZD 3FMPB 1BVRA 2W6NA 3KL2A 3QHAA 2A2ZA 4OLHA 4ZZ3A 2Y92A 5JSHA 2BAGA 4NCKA 4YV1A 4PICA 2YIJA 4N40A 4P7GA 3GLHA 1PEYA 1IM5A 2KPOA 4NHEA 2CUKA 1DEOA 1X39A 2Q99A 3JYQA 5JFOA 1TGVA 3PHLA 4PFSA 1EFRA 4EUEA 4EFKA 2A3RA 2M6SA 1JAZA 2OLKA 1FRVA 3FVRA 1Q7GA 4OLFA 1CUFA 1EEXB 1VJCA 4Q0MA 1NDHA 3SMQA 4QQ8A 3L9XA 5CX1A 4MB2A 4DYHA 5J4YA 4QT4A 3PC7A 5B1YA 5LVAA 3B48A 2Y3IA 2J9GA 4UCQA 3G5AA 4MDYA 2BEUA 4W1QA 2HW8A 1V7QA 1PVDA 3ZC3A 4X8HA 5H83A 1DRUA 2H18A 4FGLA 4BO2A 3TZLA 2HCTA 1E99A 2FFBA 3GNTA 2ARKA 1CY6A 2G06A 3EOZA 2RC6A 4KITB 4QUIA 3VZPA 2PTGA 4UAUA 3EXIA 4IIDA 2X2EA 4V2IA 1R74A 4Z4EA 1FS5A 4KLAA 2B4KA 1ZY2A 1KO7A 5DM60 1A76A 5J3JA 4DLUA 1IATA 2IGTA 4V38A 2AXEA 2B7CA 3NDRA 3F6BX 1II8A 2IF0A 2PMDA 2QD1A 4D8YA 2QGZA 1PAUA 2GHRA 7REQA 5M29A 3CW2A 4RD1A 4LDPA 4RK0A 1VBNA 4MV6A 3WZMA 4DMMA 1MFZA 1ODCA 3GXOA 3A25A 1ND6A 2FR8A 3OMLA 5T67A 3K0FB 3UMCA 1L5LA 1T5HX 3UC5A 1GZSA 1G20B 2R8XA 2H17A 3OU6A 5DHUA 3L7YA 4OF4A 3ECSA 2WKPA 1U1FA 2J08A 2Z0MA 3C3KA 4JN6B 2VSFA 3ETJA 1U02A 4PZAA 5FAXA 5LN1A 4R05A 1L3CA 1VHDA 2C5LA 4Y2UA 4ZI7F 3TSOA 1ZVVA 4MDFA 4R1LA 4MQMA 5JSUA 1THGA 1HNWB 1YHZA 4IFBA 2IHYA 3DKVA 3DLPX 4YAUA 3NEJA 4GOKA 4EJSA 3K05A 4Z1MD 2ZI3A 1XWFA 2QL7A 2XUQA 1NZFA 3O2NA 3OX4A 1NYTA 3AG6A 3DTVA 2ZYUX 1KMHA 3AQIA 1WW3A 3COSA 3EBOA 4L5IA 4RK1A 5G02A 1IBSA 2YH2A 2QTRA 1QQ7A 2W0SA 5JCJA 3OAAD 1Y63A 2VHUA 2IH5A 2G63A 1BOOA 1SU7A 2FPOA 3K0CC 4IPTA 1KDYA 4NYMR 2CF6A 1CEEA 5E6RA 1A5ZA 1BXRA 1DQPA 1LZLA 1MPTA 1EFAA 2FW9A 4M37A 3KR0A 4C21A 4Z4FA 2I62A 3BIXA 4HLUC 4TMVA 1W19A 1A4XA 1P5HA 1R3UA 3JVEA 4W63A 4XWTA 3RI3A 3TZQA 4B09A 4Q3NA 4CIWA 3IP6A 1X3SA 1ZBQA 1G55A 2BN4A 1OUMA 2FFJA 2QIPA 3IBTA 3JQBC 4YCBA 4R1QA 3VFDA 3WSWA 4DT1A 2GN0A 4Y2YA 1KDRA 4O33A 3GRCA 1OU4A 3E15A 1E2IA 1MH9A 1Y8QA 2W2LA 5ALHA 5EJ7A 4M9UA 1E4EB 4MPPA 3G88A 2HIMA 2BKXA 4P4SB 1NZJA 2RGUA 2XBUA 4JUAA 3CQ9A 4MVCA 3SKVA 2VCEA 4IHQA 1NURA 3FN4A 1P19A 4S35A 4YAFA 4EHDA 3BCHA 1TTQB 5BSHA 1YR9A 4PIVA 1SCQA 2AT1A 3V2GA 3HWWA 3ROTA 3VOAA 4K9PA 5DHAA 3WLQA 4C0BA 1EP9A 2PRIA 4BGDA 1PTJC 1O2DA 3G8AA 3HVUA 3HA3A 3Q85A 5KOJA 4TKZA 1XVAA 4NP6A 2WOOA 4L85A 3J81k 2GF9A 1ZCBA 4QSMA 1BFUA 2YNMA 3S2YA 1HX7A 2IE8A 4FHEA 5DLYA 3F5MA 1VJRA 2Y2UA 3HDGA 3W8RA 4B3DA 4E4YA 1BIFA 2OLEA 4AZVA 4DV7B 4MYTA 5EOVA 2ZT8A 1C7IA 4FP9A 1HZZA 5ALWA 4KSBA 1BMQA 3QYPA 2XXAA 3M49A 1TT7A 3NNSA 3X2FA 1A88A 3V55A 5FFMA 4D4GA 2D06A 1VE7A 2DUNA 3P1JA 4KWHA 1YR2A 5F9HA 3E2IA 1Q0PA 1G8JA 3QX8A 4IS3A 1DXOA 3QF4A 4RLSA 1ZD8A 1DMRA 3C14C 1IN4A 1EB9A 3RTCA 1CR6A 3VR2A 2VQEB 1Y1PA 3R75A 4BXOB 4KCGA 5FOVA 3R3WA 1D2GA 1IZ8A 1U8TA 4R98A 4BYMA 1QHHB 2RK6A 3CSDA 3W9YA 3WIBA 4EARA 1ZJZA 3WV5A 1DDIA 3O8BA 3LUGA 3F73A 1P3JA 3LUJA 1Q0HA 3RSGA 1JHYA 1U2EA 3GJ6A 1W88B 5DMXA 1G3MA 1QV6A 2MYUA 1Q1ZA 1CNFA 3R3YA 2D1QA 1J21A 4AQYB 3OJWA 4N5DA 3NDJA 3C3YA 3T7RA 6REQA 1KIAA 1IOWA 3N07A 2R00A 3GUCA 3KZMA 1KP9A 4CL2A 3DMDA 5G0VA 3M3DA 1MJGM 3H1AA 1HPLA 3MM4A 1ESMA 2X77A 4IIEA 4JI1B 3M5WA 3TL6A 3GR6A 1M7GA 1QX4A 1DIHA 3OQPA 5J59A 4Q82A 2ONJA 1GRNA 3SMVA 5COAA 3DT6A 3M1LA 4B71A 4CM5A 4I2VA 4JLBA 5LMCA 2JJYA 3Q9SA 2IS1A 2CCKA 4UD6A 3LOQA 2YV5A 2CB0A 4YO8A 4BX3A 1RZVA 3AOEC 1PR5A 3MB8A 3D6JA 3ODPA 2VRCD 2YWXA 1P2BA 1P6UA 2G6TA 2OHOA 2QM3A 1RRVA 3L0DA 4MV7A 1R0LA 4BJ5A 1X7YA 3X2EA 4QEZA 4Y1FA 4WZAE 4Z0TA 1E1RA 2EFJA 3RUAA 3QX3A 1YE5A 5DDIP 4B4WA 4KFSA 2ZJ6A 4ZOCA 3OO1A 5LP6B 2Y9PB 1E9VA 3W8NA 1NW5A 4DQXA 5CLQA 4F3KA 5JVDF 1O7JA 1Z3CA 2A6PA 1P0FA 3GVPA 4KXFB 4PLWA 1GKUB 3V7UA 1P3DA 3WL7A 2GF2A 3A1SA 3KBOA 4AN4A 1R15A 1RQ7A 2OBNA 2WWWA 3LUKA 2BHSA 4Q1AA 3AJ8A 4XJVA 2P8SA 1VSQA 3VTFA 5A9SA 3JQ6A 3W5DA 2JFNA 1VIYA 3AKZA 1BXZA 2RKBA 1E7SA 1RWMA 1DAGA 3EWIA 4CMAA 3X1WA 3DDCA 4Z8XA 2VZ8A 1RKBA 1TKCA 1ZCFA 3QI7A 4CR8A 2BCGY 4YDQA 2A5LA 1HT0A 3TKYA 1C1YA 1ACLA 3N7AA 5KKNB 5FV7A 3C2QA 1FP2A 1E2DA 3BK2A 2V3VA 1U7XA 3IMGA 1A4UA 1H9AA 1XRMA 3ZK8A 1Y42X 4AMBA 3QSYA 1PDVA 3BHMA 3D7KA 2NUTA 5EJ5A 2Z4RA 3A2KA 4JUFA 3L3BA 2H9AA 3I2JA 2OBXA 2VWQA 1T5TA 3DOCA 4GQBA 4NFLA 3O3OB 4Y2XA 3TXAA 3WK4A 3IERA 4H3SA 4XYEA 1KOLA 1RYBA 1XAGA 2XMQA 3ZTTA 5TJHA 1FUYB 2V96A 4W5WA 1I5RA 5CVDA 4EFNA 4YRRA 1RHKA 3KKKA 3RFUA 5KYNA 5LOVF 3ZJUA 4EA6A 2Y0CA 1BDIA 1UDWA 1J5PA 1GQYA 1R0YA 3KT8A 3ED1A 1XMPA 3WLTA 3ZIAD 1D1PA 3CBGA 2JAUA 1PDOA 1LTHR 1U80A 1MRZA 4W8GA 3LYHA 3MT0A 4KR6A 5TSDA 1JU3A 1VJTA 3B6IA 1DIRA 3KPYA 1U1DA 2R0QC 4F3YA 3NHMA 1D4OA 3JARB 3EG9A 1GLGA 1JPVA 3LQKA 3SVZA 2XYGA 5H59A 3UUWA 1TJYA 3IJ5A 3WI7A 2GWHA 1XZHA 3WMRA 2V9PA 1ZU4A 2X58A 4A0GA 5I3ZA 2I33A 3IPCA 5DTMA 1N8NA 3D7LA 1ESZA 4JQYA 5LQUA 3I0NA 1V25A 3WY9A 2J5XA 2YRFA 2NU8A 2ODWA 3FPCA 1S3SA 5A6SA 1GPDG 2ZKLA 4GLJA 4GRDA 5A05A 2ZSUA 3X1MA 4K1XA 2W4MA 5JNVA 2VPTA 4RTJA 5IVHA 3GY0A 4XFJA 4WCFA 1HXHA 3E03A 5LB4A 4ZEVA 2ALJA 1VMAA 1FLNA 2QJTA 2VJNA 4O4LF 1N57A 3EPHA 3LK6A 3DVRX 1B0AA 3LK7A 3DKIA 4D0NA 1RNLA 2VTVA 3LX5A 3EGWA 5AVZA 4ML3A 4XI9A 2RAFA 2GD2A 3PFWO 3GLFE 1NVEA 2OZEA 3VR4D 1R4MB 1X8KA 4GI1A 1I7DA 1Y4SA 4OB8A 1H4SA 3TL3A 3DHYA 2VF2A 3OZUA 1BFDA 3GNLA 4AO8A 4J16A 3OEED 4BMZA 1L8OA 5ALJA 1RLUA 3CLVA 4TUYA 3VAYA 5BMOA 4QVKA 3MGAA 3L05A 5JYEA 5K8TA 3HB1A 3UUEA 3IMKA 3MWDB 5F7OA 2YW2A 3NOQA 1JWBB 4I9UA 1T25A 4XOIA 2NUPB 2V6FA 5TT0A 1DXHA 1UXGA 3E8SA 1MPXA 4HSEA 2PKEA 3ENZA 5IWCA 1QYIA 3P4UA 3UHPA 1C29B 1EFTA 1TYZA 2QQEA 4GF5A 3VZSA 5DZSA 2PRZA 1TF5A 1J4AA 1U0EA 5L3ZA 3BMQB 3LO5A 3ZNOA 4XDGA 5JS1A 2C9OA 2HQOA 3DHWC 4V02A 2LNDA 3NBMA 1UPFA 2Y1FA 1MBZA 1ZVKA 1XG5A 3TN7A 8LDHA 2ZJ1A 1B1CA 4ZAXA 2FLVA 1JHRA 2JJ1A 3M34A 4K6KA 4KQIA 2ZB8A 1CQZA 3DL2A 3LUHA 4PR0A 5A9RA 1XU7A 3F97A 4C5CA 2B69A 3C1AA 1IQPA 3OJFA 3TJMA 3QJGA 1XA3A 4UASA 5JI2E 2XXJA 3DM5A 2G71A 3R9IA 3T1QA 2G25A 5B1SA 1X6VA 1E9RA 1CVLA 2JVKA 2O6HA 3F7OA 3OD5A 3I62A 4E2FA 2R66A 3REOA 2A9RA 1JHDA 1EFCA 4P3KA 3KEOA 3ZLJA 1TJ5A 1SBCA 4PIMA 4OI2A 3IQDB 5MHTA 1E2MA 3KVVA 1MMFB 3P96A 5IDYA 3RYCA 2R79A 1PZNA 4TROA 1OFGA 4KQGA 2GZAA 5CA0F 3EOAI 3LRPA 4PU0A 3L0CA 5JAIA 5LZ9A 3OUZA 3WRVA 2ECOA 3ZY2A 4JD5A 2H0RA 1N25A 1UDCA 2G1KA 2VBCA 1PUJA 2PGAA 2K2WA 2QLMA 2VPYA 1YQQA 2WJHA 3EW7A 3IEUA 1UDRA 4G3XA 3B6MA 4Y1GA 3SKYA 1U9JA 3RYFA 5J2TA 2J5BA 1KYVA 2MIIA 5LZ8A 2G9UA 1NBAA 4QUGA 4FD2A 2QSZA 1GGEA 2PKQO 3T38A 3CF0A 1X7ZA 2C5FA 3HY4A 2GCIA 3JTEA 4FFMA 1TOAA 3O8QA 4K3UA 4JI6B 1T8UA 4UTOA 5K0SA 3HJCA 1W35A 2JC3A 3PLRA 2Q0HA 2RI0A 2BEKA 1I7NA 4GAEA 4A8JA 3W1EA 4BV8A 4PHTA 4RFSA 4ZYVA 2OCDA 2OZKA 1TAGA 3GHYA 4HATA 5AIBA 3EQ8A 2O5VA 2P75A 4OGGA 2ATXA 1X70A 2MSKA 4FI3F 4YIKA 4I1OA 3RVRA 4C4ZA 4EHNA 5B36A 2Z2JA 4QDXA 3DZJA 3VJKA 3HA5A 2PX4A 3PNPA 1SQGA 2GEFA 3OWXA 2XMRA 1I32A 4ZT5A 1YBMA 2ZU0C 1B8OA 2V6JA 3BDAA 1EVQA 3PTLA 3SSAA 3WWPA 3HZHA 5CCDA 4EUKA 5U9CA 4CEHA 3H5OA 3REFA 1W46A 2I7CA 3C4VA 3SHWA 3UAGA 5TEVA 4TMKA 3P8ZA 3U3RA 4B4VA 4BC1A 4GXTA 4NZZA 3E27A 4WCDA 4HC4A 3H11A 2R85A 2HHHB 4AJ9A 2R8YA 2CUZA 1N6NA 4UZFA 1QGDA 3T3DA 3DMNA 3ELYA 4C0HA 4HY3A 3V8RA 1TTHA 4WXHA 5H80A 2SKCA 4D5GA 1VBKA 4AJPA 2B4YA 1DX4A 3FWZA 3C41J 4MS3B 4I6EA 1F2UA 4O8ZA 2I3GA 3SZ3A 4D3XA 1HE4A 2OC9A 2O9JA 3FNIA 5JQWA 1RAEA 5HZHA 1XB2A 2LE0A 1JU4A 5ELXA 3IR5A 3FOBA 2BHTA 2VHTA 1GN8A 4LHWA 3VR3A 5KSWB 1COWD 1UMBB 3E3OA 1WIWA 3GYBA 1EXWA 4C2BA 3NXKA 2JGIA 3QENA 1RLJA 1TW3A 3P0HA 2XMZA 3PX2A 5CXSA 2AL7A 3SC4A 4QGAA 3QU4A 4J0FA 3IEIA 4RSGA 3FUUA 4F4DA 3IKTA 1E3TA 2ZJOA 5CM9C 1S2OA 2VDJA 4WCVA 1Q3TA 4KGVA 1V8BA 3FDXA 2FSUA 1HDXA 4ZVRA 3WGQA 1HC7A 4H0CA 1KDPA 1XCPA 3ZHVA 4KJZA 2VP0A 3G7NA 1M2OB 5F1PA 3E48A 3ZDZB 3HN7A 3DLCA 4EG7A 2FEOA 4LBVA 1FRNA 1NHGA 3AVOA 4IVNA 5GZ6A 3ST7A 2DFDA 5C7OO 2FRXA 2L18A 5EZYF 1VB3A 3CZ9A 1L4MA 4BNIA 1TDJA 1WMAA 1N1EA 3O9VA 1Z33A 4TSFA 3GIDA 4BMSA 3CVOA 4HXEB 3BQMB 4ZZ0A 3U4MA 2BR3A 2CLCX 1E1QD 4TKVB 5JARA 1VGVA 2GBLA 2GYUA 2FPRA 4BWFB 3KU1A 3QSGA 3H9UA 5HEKA 3QOXA 5K20A 5CJ2A 1EUCA 2O7QA 3L1VA 3KTDA 4M89A 4FDMA 1VCNA 1IXZA 3BCSA 3VNRA 3PFIA 2JGNA 1XKQA 1RYFA 4MVJI 1YGPA 3V8PA 3FKQA 4MW0A 5DM70 1SKMA 3KYIB 1Z0IA 3HKBB 4UDNA 3M7IA 1AJEA 5HGJA 2P3SA 3TJRA 5KQRA 3LP8A 3SQXA 3JCZA 1I3MA 1W5EA 3ROXA 5CNKA 4BRWA 1X1QA 4U7GA 3BRQA 3ECCA 2C5AA 4MAAA 4P98A 4MR9B 3ZZMA 5DXAA 1LLDA 1ESCA 1MNAA 4N8SA 1PWZA 1C9EA 1Y9AA 2PN1A 4XA8A 3TQHA 2JGAA 1DUSA 2GVZC 2CYCA 1P9OA 4OXRA 1TJ3A 1X1CA 3AMVA 5HF5A 4FLFA 3SK0A 2INGX 3F7MA 3FYSA 4RTQA 4WA7A 5FWAA 3WWOA 3ETNA 3HO6A 3ZS8A 1DFIA 1UEIA 4WE3A 4OREX 1D6NA 4LEIA 2JCXA 3WK7A 4XGNA 1PVOA 3P9XA 1NU6A 4WFKA 1G0OA 1SQ0A 3D4PA 3FIJA 4TZKA 2MT9A 3RVDA 4QGFA 1GAJA 1N5KA 3DAOA 1T3TA 3MINA 4LOHA 2GNOA 2IY9A 1KU0A 4PRKA 3R7DA 3ESQA 1EHYA 4LF8B 3AVYA 3RSFA 4G26A 5AXCA 4M49A 4FB4A 2X6QA 3LCRA 2C0PA 1CS0B 1Z75A 3M83A 3NIFB 1BX3A 2HRQA 2PH7A 2NU9A 3TR5A 1CR0A 2CXXA 2PZMA 4HADA 5K8IA 2R6FA 1C8LA 1Z8DA 1VPDA 4IAOA 3DZBA 5TJ9A 1RM4A 1VI6A 4KVFA 4P4UA 1NWHA 1QR6A 4DLVA 3IHTA 4U2EA 3KD2A 3V9AA 1YVDA 3SSOA 3ZD7A 4DDMA 2Z30A 3DF9A 2VUIB 2H4FA 1AHHA 3LA8A 1RCFA 2C20A 1ZD3A 9GPBA 4XUGB 1GDTA 1XQYA 1Z36A 2VP5A 4V1CB 3NH9A 1M2WA 1OI7A 2FQXA 4F1JA 3LCJA 2X41A 5DNEA 1AXGA 3MTQA 4IJQA 3JQ8B 3GLIB 1SBHA 4ZTUB 4LE2A 4TGLA 3TZCA 2CUNA 5MFZA 3OFJA 3HGTA 1Q21A 2QTMA 3ILXA 3AVVA 5IJAA 4HVTA 1QH1B 3ET4A 5JY1A 2QJOA 1R0RE 2I2XB 4C3UA 3RT9A 3E5MA 4EZIA 1EG2A 5KHOC 1TE2A 3MTJA 3O83A 3PXAA