2AP6A

X-ray crystal structure of protein atu4242 from agrobacterium tumefaciens. northeast strucutral genomics consortium target atr43.
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
104
structure length
104
Chain Sequence
MFYEIRTYRLKNGAIPAYLKVVEDEGIEIQKSHLGELVGYFFSEIGPINEIVHIWAFSSLDDRAERRARLMADPRWLSFLPKIRDLIEVAENKIMKPARFSPLM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a Hypothetical protein Atu4242 from Agrobacterium tumefaciens (strain C58 / ATCC 3 NESG Target ATR43.
rcsb
source organism Agrobacterium tumefaciens str.
molecule tags Unknown function
molecule keywords hypothetical protein Atu4242
total genus 26
structure length 104
sequence length 104
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2005-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07978 NIPSNAP NIPSNAP
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ap6A00
1X0PA 2GFFA 2AJ1A 2OFHX 1S6UA 2K7JA 2LQBA 1KQKA 3HX9A 3QGPA 1N5VA 1N5TA 5B0FA 2ROEA 2VV5A 3KNGA 2OKQA 2HLTA 3CJKA 1TR0A 1P8GA 2AP6A 4QOTA 2ZDOA 2OMOA 1LQ9A 1Q8BA 3T9NA 1Y3KA 1RJJA 2FIUA 1V3ZA 2GCFA 1APSA 1IUJA 1YJRA 1KVIA 2LDIA 2RILA 5T7LA 4F67A 1YG0A 1Y9OA 2KKHA 1W2IA 1X7VA 2IFXA 2W4CA 5IXUA 4DN9A 4A46A 4OJGA 2XMWA 2AJ0A 1SB6A 2N7YA 1Q53A 3BDEA 4NL5A 1GXTA 1ULRA 1QUPA 1JK9B 1TUVA 2OP5A 2KT2A 3IWXA 1URRA 4DPOA 3BGUA 2HFNA 2BYCA 3LGNA 5F0UA 3WDOA 1OSDA 2W4PA 1AFIA 1R6YA 2JDJA 1FE4A 2CRLA 2AW0A 1N5QA 2RSQA 1Q8LA 3HFKA 5B0CA 1Y3JA 1VQSA 2BBEA 3BF4A 2BUNA 2HQIA 1YJUA 2PD1A 3KG1A 3LO3A 3TOQA 1CPZA 3HHLC 2EW9A 3BN7A 4FNIA 3HHLD 3IWLA 2GGPB 1FVQA 2N4CA 2ROPA 2PGCA 2XMVA 3HHLA 2VH7A 2QIFA 2XMMA 2FHMA 2XMJA 2XMKA 1JWWA 2LXFA 3I9ZA 1WD6A 2HFOA 4Q2MA 1MWZA 2OD4A 3E8OA 4OIXA 3TRGA 2K2PA 1OPZA 5F0WA 4Y2IA 3UDCA 4HH0A 5A6PA 3HF5A 2BJEA 1FVSA 3KG0A 4A48A 3HDSA 4A4JA 2ASYA 2XMUA 1FEEA 2RU9A 4OJ1A 2FTRA 4OJ3A 4YDXA 2OFGX 2ZDPA 1TL5A 1AFJA 1OQ3A 4HI2A 1XBWA 1YRXA 2IYGA 2OD6A 2KYZA 5B0GA 5B0BA 1FD8A 3FRYA 2QYCA 3FGVA 3MZIA 1S6OA 2BJDA 2HLUA 2L3MA 2FB0A 4OJHA 2N4DA 1AW0A 5B0DA 4YEAA 1YJTA 5T7LB 4EFAC 1GXUA 2ACYA 1K0VA 1KVJA 4U9RA 2OAUA 2K7KA 3DXSX 2K1RA 4Y2MA 5B08A 2LQ9A 3FMBA 1N5SA 4DL0C 3BR8A 5A6WA 1YJVA 3CJKB 3MCSA 3K7RA 5K9FA 3HHLB 2GGPA 3BM7A 1TL4A 1Y0HA 2W4DA 2ROGA 4Q2LA 4ZA1A 1MWYA 2RMLA 4HH1A 4A47A 2KT3A 4Y2KA 4FNHA 1OQ6A 3KKFA 4ZOSA 1X8DA 5B0EA 3QMQA 1CC7A 2Q3PA 3GZ7A 3LGMA 4HI1A 2K1RB 1P6TA 2GA7A 5KAKA 3F44A 1Q4RA 2GV1A 1CC8A 2QLWA 1SQEA 1FESA 2HIQA 3DCAA 5B0AA 2QLXA 3VTIA 1TZ0A 4HL9A 2G9OA 3TNVA 1SI9A 1U7LA 1VQYA 3BB5A 2XMTA 2IYIA 5B09A 4NPOA 1FE0A 2GO8A
chains in the Genus database with same CATH superfamily
2X3DA 5GAEU 3C3LA 5GMDA 1SVDA 2C22A 2BOAA 2LQBA 2DGOA 4YY3J 4JYAJ 2R9LA 3WZ0A 3C19A 3CGIA 4V19J 5KG0A 1ZM2A 1RISA 5D4PA 5K20B 3AFGA 1HL6A 3KK1B 1JIHA 1WKJA 3AJ1A 3W7BA 4ZIWA 1PO6A 4FKYA 4Q8FA 2DKOB 3QGIA 5JXSA 1S1UB 1KVKA 2HHHJ 4P73A 2YQ3A 4WK1A 1LFPA 2IC3B 5D0RA 3O2IA 2OI2A 5HVHA 3I32A 2X1FA 1IKVB 4O44A 2ADCA 4X62J 1RHMB 1HPZA 2W01A 1NKCA 1DRZA 4DG1A 4B3RF 3Q23A 3T1AA 3PW5A 1EAYC 3FCHA 3J80Y 2PEBA 4R5PB 1ULRA 4NYOA 3W2VA 4DL7A 2QA4S 4DR3J 4F8RA 4JI7F 1S57A 2CQBA 3KXDA 4OLPA 3H42A 1T9UA 3CB4A 3IS9B 3WBZA 3UCGA 4I7FB 4PZVA 4Y65A 3HVTA 5J2NA 2DR8A 4JV5F 3CMQA 5J1PA 1RTIA 2KVQE 5DZ6A 2F8MA 5KFAA 4X4TA 3RR7A 3R6LB 3JS9A 2IM0A 4MFBA 4A8MP 1NK0A 3FJ2A 5T41A 4M8LA 1TFWA 3L09A 1N33J 1P1TA 2P9CA 2JFDA 2WSFC 4GO7X 4BS2A 2BBEA 4WXWA 2GZOA 5F9LA 4ES3A 2HBYB 2PMHA 3GV5B 1WWHA 4FNIA 2C3MA 2CJBA 3F0NA 3KHHA 3PJWA 3IWLA 3QRRA 1RXOB 2MY7A 2W25A 2I5JA 2B7BB 3CD0A 2PGCA 5ETSA 2ZHBA 4C8MA 2NZ4A 1VQLS 2BW2A 3N5BA 2XSFA 3ZTSA 5L1JA 3EPIA 1SKUB 3LAMA 3NNCA 2J0WA 4R8UA 1RT5B 4XO0A 1SPBP 2CQ2A 2CDQA 2CWKA 3HF5A 1U25A 4C3KA 3HDSA 4CLTA 1NJIT 1M5PC 2UUAF 3CC4S 4KTQA 2WONA 3RW6A 2HHTA 2UXDJ 5FJ4A 3SBMA 1RK8A 2FZCB 3L9ZA 1RT4B 1WC6A 1Q5VA 5CYQA 2V2ZA 3KDNA 1X0FA 4DX5A 3CCSS 4IOCQ 3QWUA 4X2BA 1SJ3P 3DRRB 3R5GA 1FXRA 3A8EA 3ICLA 1K44A 2XY7A 2OELA 4Z7CA 4YQWA 3K59A 3PY8A 5CYQB 1S9EB 1DHMA 1VHIA 2GIQA 4IQMA 5B0DA 3K5MA 2D3OR 1SL2A 1D0EA 4IR9A 1YVFA 4KHMA 3TEGA 5CCMA 2A10A 3ITHA 3MAAA 2QMWA 2CQGA 3F41A 3IRXA 5CYMA 4M95A 2PC6A 5B08A 1PYTA 4CO5A 4RX6A 2IRXA 1J27A 1UEKA 4B3MF 3G96A 4UQGA 5A0YB 4USKA 5KTQA 2DGVA 3GU0A 2K06A 2A0FB 2NUUG 5KFKA 2ATLA 1Q86T 2YKNB 1CQNA 3BM7A 1KD1T 2CJKA 3IAM9 2VB6A 4IQXA 4QZVB 2LQJA 3CNQP 4RW7A 2ZJPQ 3UN3A 4Q2LA 3AY0A 2MLYA 1RAGB 2JH3A 3TJ8A 1IVZA 1JQGA 2UXBJ 4IG3B 4IFYA 3ZZUA 4ZLPA 1B0VA 1PJ5A 1OJ4A 4CYUB 5LMUJ 4DV1J 2BM0A 3GZ7A 4F3QA 3RTVA 3HVTB 5J2NB 2J9DA 3LWMA 1RT7B 3EVWA 2R7VA 2GQ2A 2QLWA 1JLEA 2F1FA 2YH0A 1MMDA 1LEOA 2IBOA 1YIJS 2E1CA 3W2WB 3FSXA 5KOWA 4FPIA 5E3QA 1C1BB 2ZUGA 2XEXA 2PE8A 3DMJB 2IAJB 3HKWA 1UJ4A 3HSDA 4NPOA 2HSEB 1VR6A 4QIWD 3RBZA 5L9XA 3TAQA 1X0PA 4OZJA 3HZGA 2RRBA 1G3OA 3MAHA 3OHBA 4HYKA 1NO8A 2LP4A 3DOMA 3PDNA 4ECTA 1CJKA 2LECA 2D3ZA 4C4WA 2FJBB 2BQ3A 5E3CA 1DARA 5J1EA 5DRKA 1EARA 1S1UA 3ZNUA 4NX9A 3IBCB 1N56A 1NDLA 1LWCA 3A3OB 1XC9A 3S01A 1K1SA 3FSIA 2AYMA 1KR4A 3UD4P 1OMSA 2CQ3A 1JKHA 3K5PA 2DNMA 4DV5J 1YTYA 2F3JA 1UKUA 3G8QA 3JQMA 4WP9A 4DXLA 5KT3A 2JRSA 3SI8A 2BJ8A 1YG0A 4FXWA 2BOPA 1P9YA 4ECYA 2QG9B 3DLKB 2E5GA 2IJRA 3NL0A 2OH2A 1ITPA 2CNOB 2RNEA 2IM3A 1LV5A 4M5NA 4M1KA 1VQ8S 2OSQA 4DSLA 3GQCA 1Q7LB 1WC4A 3TVKA 1B7YB 3W9HA 1NEEA 3KMSA 1NHKL 1OY9A 4DSKA 3M2VB 3M32B 3BGRB 3TQEA 2V9KA 3RYLA 4AQYF 3DC2A 4B9VA 4DV4F 2J0SD 1OSDA 3NOCA 5DG8A 4X4PA 2DY9A 3K89A 1R0AB 1L3TA 3TJAA 1SC6A 1FRKA 2OPPA 3IAS9 5U47A 4CLUA 3J81U 5J2QA 3IC1A 2ZKTA 1TUGB 3E01A 4KBIA 5EWFA 3Q86A 2UXDF 5GAEI 4BDPA 1CPZA 4UZBA 4FF1A 1RACB 1JXVA 3LO3A 3J7AN 1NUEA 1VFJA 3TAMA 2GGPB 5DG9A 2ZVSA 4M5LA 3OVAA 4CLWA 3MECA 5D4LA 6AT1B 3SQGB 4DR2F 1PG5B 2HQ3A 4LF7F 2W9AA 4WFYA 2OEJA 3RB0A 1HNVB 4CLZA 2BW7A 3F56A 1WD6A 3HFVA 1KLMA 1NZAA 1OYDA 2I8EA 3D54A 1VOMA 2EFOA 4NLXA 2JEGA 1WHXA 3K5OA 3R2DJ 1NSPA 2YBVA 3ONQA 4QWBA 3U7JA 1X4DA 1U1QA 1FEHA 2FUG9 4I64A 1EKRA 4LSNB 2XGQA 2AZ1A 3DHWC 3DRPB 9ATCB 5KOXA 2QA2A 1VQPS 2I1RA 4P2MA 3B4DA 2W8KA 1RYRA 1FRIA 3GR0A 1TL5A 2Y0BB 4LFAJ 4BC7A 2JC1A 3TZYA 1AFJA 4P9SA 1U2FA 3ZZPA 1FRXA 2DNHA 3IO1A 3MZIA 3THPA 1IKWA 2BJDA 3GYXB 5B7WA 1VC5A 3UW1A 1WF2A 4Y6IA 2I38A 3ET6B 5CCLA 1QSYA 4C0HA 5L8RC 1KVJA 3DLBA 1SQGA 4DSFA 2EKYA 5C42B 4YB6A 2W9BB 2ADBA 1R27B 2E7XA 2PT0A 2LQ9A 4OHXA 2V4JB 2VG5A 4DFMA 2ZH8A 4PWDA 3W65A 1RAOA 1YQHA 3CJ8A 1MN7A 2V5HG 3T41A 4JBCA 4KYZA 2F5GA 2IJNA 1HMVA 4LF2A 1YJWS 1QTMA 2E7WA 3T5KA 3ILJA 4CZCA 3EDQB 2VIHA 2UVUA 3G6ES 4WFXA 3M9MB 1W2BR 3OXGA 3P6YC 3PR4A 5D3GB 4RBVA 3AD8C 1NMEB 2WRMA 3NGDA 4HH1A 2M88A 3HHDA 1HHTP 1OQ6A 5H9FJ 4FF2A 1U24A 2RE1A 2OPPB 2DR5A 2QL7B 3JSRA 1TK5A 4KSEB 2XG8A 3CE8A 2LLZA 2B4OA 2Y3YA 2E66A 4M5KA 1UETA 5AT1B 3GJSB 3VAHA 4DR7F 1H7XA 2A2DA 1LXJA 1CJTA 1UZDA 1Z2ZA 2PO4A 2WBMA 2EC0A 2FJVA 2DBBA 2ZBQA 2IYIA 1MNEA 2WHOA 4L72B 2ZH6A 3T5HA 3OTCA 3HK2A 4B3OA 5K14A 1B70B 1X4AA 3KHRA 1FK9A 2YNFA 3N0VA 4OI2A 4QIEA 5EGYA 4IG0B 4DMZA 3SFGA 4NLTA 2B9YA 2IPOB 3ILOA 2HWTA 1A7GE 2KL8A 2W2NP 1P8GA 3MR6A 3N6NA 3QNWB 2OMOA 2NXCA 1LWCB 1SXLA 1TL7A 3DRSB 2EBGA 3GG0A 4ZVSB 2ZBPA 3HULA 3T9NA 2WVDA 3CCQS 2OSRA 3H5UA 1YDLA 3J7A1 5ADZA 2RRNA 2G2OA 2LDIA 4F67A 3PHEA 2KFZA 2Y9HA 2V0NA 1HBMB 3K8WA 1R8BA 2YXLA 4NWBA 3O5TB 2PMZD 2DO0A 3H7HB 3EX7B 1HNIB 1O5JA 3I6PA 2RHSB 3ISND 4C8LA 4RW8A 4X64J 4K4TA 1BLUA 4DUTA 1DURA 3WDOA 2CJQA 3X3UA 4C8KA 4CO3A 3BO3A 4CYUA 4NLSA 3HFKA 3HI9A 4PUOA 4DV5F 4QBUA 4OX9J 1VQSA 1WTBA 2BUNA 2HKEA 3NCPA 4MK8A 2OPRA 2M8HA 3R7SB 1TKTA 2CPIA 1MWQA 3NNAA 4YHHJ 4JI3J 3TZXA 2XYPB 2O5DA 4L6V3 1UJ5A 3HHLA 3LTOA 2MJUA 1N6QB 4NCAA 1YSJA 3K0JA 2D9OA 2ZHOA 4DLGA 2E5HA 5HN0A 3I9ZA 3KUEA 4ENOA 3MTKA 2DITA 3MURP 2GMHA 4P72A 3MMBB 1RABB 2MMYA 1MROA 3NMAA 3QWPA 1NAQA 3OXFA 3IR6B 5KFFA 5I42A 4CNYA 5GAHU 5E2QA 3OJUA 1PBUA 3N9UC 4NE9C 3QGHA 3R1HA 1IWAA 2LCWA 4WFZA 5ITHA 3TANA 2AIRB 1S4FA 3QGGA 4PG5A 5LJ3Y 1R0CB 2N4DA 1GMVA 1RT4A 2FC8A 2G0CA 3AODA 3TP2A 1S0OA 2UXBF 4NA1A 2GHPA 2YX4A 1RA7A 3LP0A 1H6KX 3TX8A 3JSMA 3MCNA 2AGPA 3QRQA 2XSJA 1N36F 4ZKAA 2VG7A 4ETZA 3GIIA 1NK8A 3DRYA 1VRTA 2GJFA 2HQGA 3LP1B 3PJ9A 1I5OB 4O4GA 5KFCA 1K9MT 4NXNJ 4QU7A 3CWJA 4ID8A 4DQQA 1W7WA 3DLEA 2VJVA 1NB7A 3DLEB 4IO9Q 3L4BC 4YB5A 1TKXA 1X4HA 2CJXB 5KG5A 4JV2A 4O4GB 1U49A 3MUVP 1UPMB 4NMXA 5KFHA 4WCEQ 4B9MA 1Q7YT 3KKFA 2ZH1A 5B0EA 4RNNA 4NLOA 4K50A 5D4OA 4ALZA 3POTB 4PXBA 2AWZA 1BE4A 2K1RB 2U1AA 1LW0A 1U2RA 3OFGA 3SCJE 3UR3C 2ZEJA 4YB1P 1HNZF 4FBUA 5JVGQ 4RKUC 1FTRA 1L5UA 3JQKA 4WP3A 4A8SA 2JEIA 4OZ0A 3VTIA 3CD7A 3TNVA 5DDOC 1VLYA 1DAXA 1IKXB 2CNKB 3BQ1A 3GE9A 5I3UA 2A6MA 1OYEA 1Q79A 2OEKA 1WSVA 1DLOA 1FE0A 3J7YI 3AQPA 2AGQA 1TAUA 1FRLA 1GX5A 1FDDA 1B0PA 2K7JA 1M1GA 1JKHB 1RLDA 3MPVA 2BANB 5IWAJ 3OTOF 1CULB 3EGNA 3SDEB 4UW2A 4Y28C 2MQQA 4JV5J 4NI2A 4RU9A 3DHXA 1M5KC 2AX0A 3MOZA 1OSCA 2WSEC 3M8SA 2VQEJ 3CCLS 1REGX 1Y3KA 1TL1A 2EKNA 1V5IB 2H5EA 3GLJA 3LP2A 4OZLA 1C4AA 2B5JA 4J37A 4OX6A 2HZCA 3MMCA 5CH7B 3S6EA 3ZTQA 1Y00A 2RUGA 4M94A 4L73A 2FVSA 2VL1A 2IFXA 2GAGC 1EETB 2GVZA 5J2MA 4K0KF 1WG5A 3FCWA 1S1XA 2APOA 2A1BA 2XC9A 2HFUA 1WC1A 1VQNS 4LREA 4DUZF 3TUPA 1CSJA 3C6TB 1GXTA 2ILZA 2EWHA 3C14B 1ZOTA 2BABA 1N54B 2WOMA 3CJ2A 2Z4PA 3FBFA 1VQOS 3FEYB 3H40A 1URRA 3PACA 4LF9F 3BGUA 2DHSA 2RDJA 2LQ5A 2VFTA 2J0XA 4YOEA 2WK4A 2PFDA 1Z2LA 8AT1B 2W4PA 1DBDA 5F8HA 4TU7A 4QR0A 2UVRA 5DDPC 1U1NA 2Q43A 4JOUA 4MJKA 3EVOA 5L9NA 3VR1A 1UWBA 1X60A 1WACA 5E0OA 4DL3A 2C2DA 2XHWA 4WBFA 4UT4A 1UFWA 3I87A 5ETNA 4ICLA 1TMMA 2YWWA 1HKAA 3GYNA 4URGA 4B9LA 2GAHC 1UEUA 2PN6A 3AAWB 3BSAA 1TKTB 5SZTA 3TA1A 3PX6A 3I4PA 1S7HA 3HO1A 2E9RX 4QQBA 1RTHB 2GMJA 2YPZA 4JV1A 2VFVA 1FXLA 2NPIA 5L1LA 4LF8F 4WJBA 3GONA 4G1QB 1NH8A 2C2ZB 3LOUA 3PFOA 4MIAA 1HBOA 1T94A 3DGPA 3FBCA 5KT7A 1RE1B 3MAAB 1SBRA 3M8WA 1YITS 1R89A 3ENAA 1R43A 2ASYA 3I55S 4K2JA 3H98A 1BWEA 1FNOA 3HSZA 4ZVRB 4OHYA 4KGMA 1NCLA 5A76A 1WJ9A 4X65J 5KFXA 1HQEA 1OQ3A 1OS5A 2QA1A 3BH7B 3DRRA 3DYAB 4WIQA 2V8GA 4J9SA 4XPEA 1JXEA 2KO1A 3IBWA 3MEEA 1SH0A 2B43A 2H51B 3T6BA 3VAMA 2FLNA 4JI7J 2P5VA 1RBAA 1RWWB 5IQ6A 4HT7A 3QATA 2K7KA 5G4DA 2LQ8A 1IXKA 1LNQA 2DK2A 3FEXB 3GFHA 2AZ3A 4WKRA 5F9NA 1PAEX 4LSZB 2VFSA 1O6XA 4C11B 5C24B 3S8SA 5HROB 1R6VA 3CJKB 4J9LA 3K7RA 3VVUA 3ZZ0A 4CLKA 4K4UA 1JLCB 2QC3A 2SXLA 2ZZNA 4C3MA 3OTBA 1X4CA 3UDVA 2OPSB 3DLGB 3BKUA 3LPYA 3U02A 2OO4A 2BA9A 3AHPA 4LT6A 3OUYB 3OUYA 2HWIA 4LF5J 1Y0HA 3FSYA 1TQLA 1Q5YA 2JLEA 2QL9B 2J6TA 1FJGF 4M5DB 3N01A 2E7VA 1TTHB 1YZ6A 4U8YA 1VQKS 1RT6A 2A2CA 2HQDA 1T11A 4JYAF 1RSCA 1HD0A 2ZOFA 3PG9A 3T6JA 3WIVA 2X51A 3EICA 4C2MA 2YNGA 2V9WA 1IKYA 4X4SA 4DV0F 4DFKA 5ETOA 1FA0A 2GO9A 3VVTA 1Q4RA 2RU3A 3OSPA 2JL9A 2YKQA 3CIZA 3W2VB 1BUXA 2HIQA 3U27A 3PW0A 4FYDA 2F9JA 4PEOA 4ED1A 4AYBD 2RRAA 1RWPB 4M5DA 5B09A 2XYHB 3PW4A 1NKEA 4AD6A 4LF6F 1KKHA 1UVLA 4V1Ak 2Q66A 4K5RA 1U1RA 1E6YA 3AD7C 2HGMA 1GX6A 2CVEA 2OFHX 2RKIB 3AB4B 3HX9A 2IC3A 3PYGA 3EMTA 1U0HB 2B4PA 3QGPA 1XTZA 2BX6A 5THWA 1HA1A 4OX8A 3TJ9A 1G2EA 2CJ9A 3KK2B 1HBOB 3DGPB 1LXNA 1GQEA 3I0RB 3MCOA 3NWRA 3R5JB 4G1QA 8RUCA 3CC7S 2BJ7A 2H5JB 2MKCA 2V4JA 2VG5B 2YKAA 2DH8A 3QLHB 1YZ7A 4ER8A 2ERRA 3NS5A 1LOUA 1N52B 1AUDA 1RTZA 4LQ3A 2XHCA 2Q79A 1S59A 1FFWB 1K1QA 4O23A 2HMIB 4O3RA 3OL9A 3UCZP 3ET6A 4FXDA 1FJGJ 2G2YA 2C28A 2NSBA 5EUHA 2X1GA 2EG1A 3MEEB 5AE3A 5IXUA 2ZD1A 1FNXH 4UZCA 4OZ2A 4X64F 4DFJA 1SB6A 4PQUB 5J2QB 1HQEB 3DYAA 2D3O1 3TI0A 2RAQA 2C3YA 1NH7A 2JHEA 3EZUA 1CJUA 1QUPA 4QR2A 3B54A 3EZOA 3UNYA 2MQMA 1GT8A 2KT2A 1RT3A 1QE1B 2IIHA 3HD1A 3FZ2A 4HHUA 5KT6A 1P27B 3W5XA 5HLFA 3TO8A 1KBRA 5DLGA 1S0VA 2J76E 1O51A 3BV8A 1UW9A 4PPZA 2VG6B 1VRUB 2XZDB 4YR2A 2BQUA 1RTHA 2OGUA 3OVSA 2R2UA 1DZ5A 4RNHA 3MECB 3JAMU 1RUSA 1S1TB 2EC2A 4USJC 3KJVB 1NDKA 4K4ZA 2M0GB 1ROFA 4OI1A 3HHLD 1HNXJ 2AV5A 3QT6A 5K8OA 1S0NA 3RR8A 4MYTA 2FGOA 5DG7A 1HNWJ 2FLOA 2VBWA 4MK7A 1T8EA 2BKPA 1Q8KA 2GVDB 1NU4A 2M2BA 1S4EA 2XMJA 4OI3A 4R25A 3IFEA 1NK6A 5C25A 3V6KA 4I2PB 4NCBA 2H54B 3LH2S 3R1LA 3RZAA 3UDCA 4B17A 4RUHA 2KXNB 2BJEA 1RLCL 2HHVA 4TY8A 1UEVA 4W98A 2DD8S 2V2QA 5ETMA 3PO5A 2P9EA 2UV8A 1JLFA 2OFGX 1WORA 2ZOMA 3AXMA 2HEKA 1XBWA 2VONA 2ZH9A 3KLFB 3LUYA 3DM2A 1TKDA 1G6BA 2XQCA 2HRUA 4XIUA 5F41A 2MZRA 3W2WA 2GQQA 5HATA 3PV8A 2N7CA 3EGVA 2KJVA 3S7RA 4TQSA 3I56S 1PSDA 4EMDA 2RDDA 3H0PA 3C15A 4J9UE 3UD5A 2HZAA 3QAUA 3GIJA 3BR8A 1OWXA 3W60A 3QO9B 1RAHB 4ZVEA 4PYDA 1YLXA 4KFBA 4PABA 3TEHB 4GC6A 4JI4J 3TZWA 1S9GB 4XK8C 1V3SA 4C3LA 2ILYA 2QLJB 3GTYX 2C1EB 3CDWA 2FLLA 1TK8A 2ROGA 3IR7B 4X65F 1MWYA 1YHQS 1SC1B 3KMQA 4XDCA 1WSRA 4KGXB 4Y2KA 2WTFA 1KC8T 2AJ4A 2H9ZA 2DISA 2FVCA 1C1BA 2V2KA 3HKZD 3QZ8A 2VG6A 4YUDA 2DVIA 2ASDA 3BN4A 1U09A 3HHEA 2ZNZA 4IFVB 4KB7A 4NYPA 4ZN3A 1L3UA 4NLGA 4P2XA 4QIFA 3M8ZA 3O44A 3THTA 2KG1A 2W2PP 3D5MA 4KV8A 2V2VA 5LSRA 5HJXA 1F5BA 1RT1B 3ISZA 3UDLA 2R7TA 2VUGA 1SKWA 5DQHA 1NDCA 3NKYA 3M6UA 2ZH7A 3MEGA 3P45B 2GFFA 1Q82T 2KDOA 5J2PA 4B3SJ 1S6UA 4PXDA 2C3OA 3N4WA 1M5OC 1EJ7L 1AA1B 3LALA 2IM2A 5KT5A 4HHJA 5D4NA 4ZVUB 5HVFA 3MM7A 4F4AA 3OXLA 4RW9B 3CSKA 4QOTA 3KLGA 1UL3A 2VG7B 4NCGB 3UPFA 4NCGA 4L75A 1LQ9A 3JYTB 1SL1A 3D6FB 1D1UA 1PKUA 1VLOA 4O3NA 4JI4F 2WVFA 3AT1B 4NLUA 3CULA 1SJ4P 4JP8A 3T19A 3OFEA 2MQNA 5ETTA 4AUKA 4AFFA 4EUVA 1NJYA 1NDPA 3MEGB 2HRYA 4PXCA 2LEBA 4OV6A 2M8DB 1WEZA 1KWMA 1DTQB 2HG4A 4ZVPB 2XMWA 1CEZA 2BE7D 5C2GA 1ZBTA 4JI8J 1F3VA 4HKQA 2RT3A 1JLQA 2AJFE 3L7PA 3UE2A 1D9DA 5D77A 1JB0C 1FF2A 4DQPA 2P6SA 4A8WA 4DPOA 3M8PB 1T05B 1RHJB 1N34J 4XDDA 3CXCR 1KRPA 1VBYA 1D9FA 5A8WA 3Q8YA 5H1SV 2YNGB 1FE4A 4F0MA 5IQQA 4ELVA 4WYWA 2OJ3A 4J9QA 2RSQA 4RUBA 2CJAA 5KFYA 4G1IA 2MTLA 1FX2A 2XLIA 4ED2A 2F7VA 5L38A 4WZQA 2ZWOA 3HXMA 2EW9A 4HACB 1ZM9A 3LW5C 3VAJA 2FHJA 2KRBA 3IP0A 2AKWB 2B9EA 3W63A 2ZBIA 4Q44A 4ZP7A 4RUAA 4RU2A 2EBEA 4F02A 3GB0A 1VI7A 1KP6A 1VQ7S 1UCNA 2Y8WA 4W90B 2GIFA 2DIUA 1TL7B 3DRSA 2QSFA 1R0BG 2EFQA 3OR1A 2YH1A 1NK4A 1KQSR 3SYZA 3TRGA 4Y2IA 2XGPA 5IV3A 2B4VA 4CO1A 1KHWA 1KEKA 4DLEA 2ATCB 4X4VA 2ABYA 2IRUA 3HM9A 4YDXA 3KLHA 4IRCA 3GFYA 5D0HA 1KDNA 2ZZTA 3JSBA 4ED3A 4MIBA 4RBTA 4A8XA 1S76D 4HDGA 4N8OA 5L1KA 5HI7A 3GIMA 4HHHA 3VGUA 4FS1A 1S6OA 1FO1A 1UVJA 1CJTB 1JLFB 3CCES 2WCXA 4X4RA 1IBKJ 2V8HA 3GCWP 4UF4A 3KLHB 4DR6J 2ACYA 4J5OA 3OD2A 3CDAA 1H74A 4IO1A 3EPGA 3M7VA 1N5SA 4DL0C 4LBPA 1ICEB 4DV7F 5H9FK 1YJVA 4C6AA 2NYHA 2UXCF 1R31A 3ZFVA 1FJ7A 1N8RT 1F5AA 4QPTA 4URQU 2JVRA 4F4WA 3H5SA 2KRRA 2OTJS 3CDUA 2G0JA 3IGVA 4FZVA 1ZPVA 4OLOA 3QYYA 2VC0A 2F4FA 4A47A 4K2XA 4UOGA 2PMWA 3FDSA 4DX6A 2RVJA 3R3TA 3EE3A 3M4XA 4FVMA 4DQSA 4KH1B 1RU1A 5DGAA 3I31A 4OZ5A 5F8JA 1FCAA 1H38A 4DCOB 2O01C 1X5OA 2H65B 2GA7A 3Q2SC 4EO8A 2V8DA 4TN2A 4F0HA 2V67A 2VD3A 1T9TA 3AA9A 3HZEA 4DR5F 4IRKA 4IDKA 1TZ0A 1AZSA 1IKWB 3NOGA 5HQ8A 2HK2A 1VQYA 3O3LA 4OYMA 2XMTA 3UDEA 2HQFA 1ZTWA 5F8IA 1RP5A 2AEJA 1UJ6A 2HBRB 3CD5A 3TVZA 1JX4A 3H2LA 2BRKA 1VQ4S 3M6WA 3R5AA 4QCLA 4ZPAA 2VQFF 1J5EJ 1VJQA 2UUTA 4DS5A 2F40A 4WFBQ 3ZNJ1 2OKQA 1TL1B 4EBEA 2XBPA 4PG8A 4WP8A 1BD6A 1UWAA 3VALA 3OW2R 1U1LA 4EO6A 1FWKA 1HBUA 1C2PA 1AT1B 2R42A 3DDIA 3OFHA 4GVBB 4KGZB 3R7NB 4TLQA 2FIUA 3R97A 5E41A 2MGZB 1APSA 1RA6A 3AJ2A 4X4UA 4KH0B 2KHDA 3HCXA 3TAMB 5ETKA 1LWEA 4ED6A 4L76A 4K5SA 2CIMA 4TXSA 1RKIA 2R2RA 4P2FA 3T1YJ 1WI6A 4PCQA 1U48A 4ED5A 4OYOA 4CWBA 2E1MC 3E01B 2DYAA 3NAHA 1WHVA 4AT1B 3H20A 4ZCLA 1U1MA 1N0UA 4B9TA 3RAQA 1S6PA 2B6AA 1IR1A 1TUVA 2OP5A 4B3RJ 3B4MA 3IA0A 3I5CA 1N32F 4ED4A 2KT5A 4ZPBA 1UVIA 4I6YA 4H54A 1KLMB 1N88A 3JQJA 4M63A 1B7FA 1PBAA 2DXFA 3FQKA 2DGQA 2R7XA 1RT6B 3V4MA 2BZ2A 1NSQA 2R7UA 3M9OB 4ECXA 2WVCA 4B3SF 3BF4A 3D28A 1HI0P 3KG1A 4N77A 1F9FA 1H0HB 1ZA2B 2B8QA 3HT0A 5M2RA 3RW7A 3SCLE 5KFMA 2L9WA 1T9WA 3Q8VA 4H4KA 1AUSL 5IT0A 2KVIA 1XNQJ 1ZH5A 1HWIA 1XR6A 2O67A 5HBMB 4A8YA 1J5OB 5IT9Y 2QIFA 4DPYA 1CQMA 3DU6A 2BJ1A 4KT0C 2UUAJ 1OO0B 3V6DA 2VPZB 5A6PA 1T0TV 3HVWA 3B6BA 1C0UA 5J1EB 1U8SA 5GMKa 3MPDA 5L46A 4J9PA 4OI0A 4ILRA 1J2VA 4ZCKA 2MSSA 3MMJA 5H9EK 1NPKA 5MLCV 2HNYB 5FIIA 2V94A 5JMNA 2J7KA 2H5IB 1BXNA 1S12A 2YKOA 1T02A 1VGYA 3MM9B 5I3PA 3QFHA 4P2SA 2QGFB 5HP1B 3DLKA 1R7IA 4OJHA 4N7TA 1CVJA 1QAXA 4YEAA 5F3TA 4Z7YA 1CBKA 5T7LB 4BBYA 3K58A 1T03B 4JI8F 4FKXA 2KJWA 3ETMA 4LF1A 3DXSX 4DV3F 1WEYA 4GKKF 5E3RA 2LEAA 4CH7A 2HNZA 2G1HA 3H2VE 4WYLA 3A8KA 2ZH2A 3HHLB 1O8BA 3GSDA 1RU2A 1YBAA 2N3LA 3BEGB 3BO2A 1GXLA 3OFFA 1GTHA 3SSQA 3ILLA 2W2QP 4PWWA 4ANDA 1XIQA 2ZNYA 2ZHAA 4WTYA 1NK7A 1PCAA 2UZAA 4FNHA 1KFDA 4DV2F 2YPYA 1RTJA 2FJEB 4YY3F 1KS2A 3AH6A 4NASA 5A8WB 4IRDA 1MLAA 2Z2MA 3UO0A 4LRAA 3H4BA 1LKZA 5HMYA 2VQEF 4K4YA 1T05A 2ASJA 2IY5B 2YX7A 2YNIB 4LVNP 3GV7B 2NS1B 2M3DA 4O4RA 2Z2ZA 3TX0A 2BDPA 2XS7A 5RUBA 2CADA 3FKBA 2G9OA 2XY6A 1F0XA 1RI7A 2FJDB 4EYHB 1R8HA 2F8HA 1ZS6A 4NRTA 4TYBA 3VZHA 2H1YA 3HHKA 3PYFA 2IHR1 1VIOA 4Q7AA 3UVJB 4DPXA 3G6XA 2D7SA 4G3IA 2F4VJ 4DL2A 1OY8A 4A8KA 2YKNA 2BE2B 5E3PA 4A8FA 4RW4A 2X1BA 2MQ8A 3JYTA 2AP6A 2D74B 2RQKA 5DM6Q 2LU2A 2MZJA 3MGJA 3BH6B 3QLHA 5BYRA 4BCAA 2VJUA 2XNQA 2P6TA 1NHVA 1KFSA 3ENVA 4F4XA 2GCFA 2XWYA 3M30B 4KE5A 3ITHB 4USTA 1RGVA 2XZWA 2RS8A 1YJRA 1X5SA 1SJ1A 3KUHA 2EFVA 3I96A 5F8NA 2R7RA 4KGVB 1KVIA 2CZ9A 3MM9A 4MKVA 1UAWA 1T95A 3QRPA 3LAKA 1GK8A 4F0KA 1RCXB 3GYGA 4NLWA 2CPDA 1KONA 1JLGA 1ZYQA 1RTIB 3BS9A 1IBKF 2ZE2A 4DN0A 4B3MJ 4QYRA 3TA2A 4J9RA 4CQ1A 1PC5A 2E5LF 4JI5J 2BYCA 1GNKA 3POTA 2FJWA 1IKYB 1JJ4A 2QEXS 4OZNA 4KQZA 4R8UB 5DGBA 4Q5VA 1GMWA 5DQIA 4R5PA 1FDBA 3GCXP 1XR5A 2HZVA 5G0RA 5K8MA 3D7SB 1R3NA 5B0CA 4USWA 1SV5A 1GFWB 1YRTA 1MMLA 5EN1A 2D69A 1IKVA 4KPCA 4BC9A 5LT5A 2W7PA 1TP7A 1KQFB 5IFMA 1X4FA 4DSJA 2DRAA 3G6YA 4CLYA 1HD1A 1M1HA 2UU9J 2AQ4A 2Z58B 4GVBA 3ZTOA 2E5JA 2LXFA 5IZHA 1UVKA 5B0BA 4ZCIA 1MWZA 1KTQA 3KNAA 1QUVA 3L7OA 1M5HA 2CXEA 5HAOA 2AEMA 4OHVA 1IJEB 1DQAA 4U6PA 4J9KA 5KFJA 1L3VA 5HO4A 4DZ6A 1WKKA 4CT8A 9RUBA 1D09B 2MKKA 5LL6d 4H4MB 1FKPA 3W5ZA 4LF5F 3HFZB 3R5BA 4DBQA 3E3XA 3M8YA 3FZBA 4O44B 4ZVTB 4CLFA 1S72S 1S1VB 2BJ9A 2PSZA 1UZHA 1YJTA 2W9CB 4DV2J 3D1OA 2COLA 4LSNA 2R8KA 1H72C 2Q6BA 2UUWA 1L3KA 3Q8QB 3FNNA 1A6LA 4YR3A 2ASLA 3QQCD 2G4BA 3MR3A 2EFPA 1HBUB 2HURA 1XEZA 3FMBA 4ZCMA 2FVRA 3BGLA 1YJ7A 1REVA 3C2PA 1RCOB 2G0IA 2DNPA 2IJFA 4ZPCA 3J7Z5 4F7VA 4ZJQA 1Z1ZA 2XS2A 3TZZA 1XMOJ 2VDIA 4JV0A 2CFXA 3MM8A 5BXIA 3GMGA 5HMZA 2M70A 2ALZA 2VODA 1SL0A 1S1TA 1WF0A 2AYGA 3E2EA 1WOSA 2CQ0A 2EVZA 2B9XA 2LMIA 3MPUB 2V69A 4NRUA 2VKRA 4Y3CA 3V5RA 4N47A 4DL4A 2BVZA 1WDTA 3D4JA 4OL8A 3D67A 5JVHQ 1SH2A 3G4SS 2F4VF 2Z8QA 3H5XA 1UVNA 3QPIA 4ECWA 2RS2A 3I82A 4OQJA 3G9CA 2CDRB 3DOLA 2MZSA 4DX7A 5GAGI 3K57A 1S1VA 2ZC4A 4NLRA 4PKDB 4X4QA 3KHLA 4UOFA 4AL6A 5DM7Q 3T3FA 2KZZA 4I69A 3M05A 4L74A 2ZD1B 4B9UA 3OL7A 1HBMA 2R3VA 4H4MA 2GVZB 4TY9A 5K9FA 5IS2A 2QA4G 1CJVB 3BKTA 2AJ1A 3GJRB 1XNRJ 2Q1LA 1D9AA 3MMCB 1V9OA 2HMIA 3I9V9 3JB9k 2HLTA 1U1KA 4PWUA 2ZM6J 2C3UA 3KHGA 2P8IA 3G6VA 3FBEA 1F60B 2VFRA 2J9CA 3ENWA 4QWCA 1SIZA 2PEHA 3CIMA 3DOKB 2MPUA 4WE1B 4LF9J 2HVIA 3VAKA 4DR3F 3CEDA 2ZOGA 1KQGB 3P5BP 4FS2A 3EVMA 3Q0AA 5SUHA 3Q22A 2A3JA 1RHRB 1I1GA 5K14B 2F8EX 2IVYA 4QPXA 4U7CA 1D3WA 2XI2A 2E9TA 4BWJA 1S7IA 3IBFB 2HVEA 2J8AA 3MUTP 1PGZA 5LSOA 3IM8A 1FKPB 2RQ4A 4XTTA 2CQPA 3OHAA 3Q2TC 3CO9A 2V6AA 2W8LA 3UCUP 5AXNA 3RRKA 1XMQJ 4X4NA 1YJ9S 2AHOB 5DJBA 2HYIB 1NBEB 2FDNA 3O6QA 4DOZA 4DV3J 4EZ9A 6FDRA 1U6BA 2JDJA 1IBLJ 2AW0A 3FFIA 3OTEA 2CPXA 1AYEA 2CQHA 4OYIA 3OR1B 2F65A 4CO4A 2EXUA 2IVFB 1MN9A 3C16B 3U1MA 2E9ZA 5KFGA 3A3NB 4CP5A 1YJUA 2WVBA 3OL8A 3O1LA 3CF5Q 4DF4A 3HHLC 5GAGU 2BRLA 2UV8G 3MDFA 5KFVA 1RT2A 5IWAF 3OTOJ 1XERA 3EM1A 4Y00A 1HQUB 4ECQA 3CJQA 2R7WA 4P6QA 3GILA 1CS4A 1U2CA 2DR6A 2QTWA 2BJ3A 2W7AA 3SSSA 4LF7J 4NXMF 5G0RB 2CWXA 5A0YA 2V50A 2XO6A 1VISA 2C2NA 1OPZA 2YWHA 4RW4B 2W9BA 4NEYA 2EI5A 3UD3P 4A4JA 1RAAB 2I2YA 3NG8A 2IMOA 1VQ5S 1U6ZA 2DY1A 4X84A 4JUZA 1RTDB 3UN2A 3VQSA 4NLDA 4DWIA 1QJHA 3ZZRA 1JLQB 3PTWA 2LXUA 2HHQA 1ZA1B 2HFVA 3NLCA 5KFOA 3G71S 1G1XA 5BYSA 1G4CA 3MM5A 1RADB 1TVRB 1WC3A 3DRXA 2HBZB 4GVLA 3PKMA 1TVRA 2AT1B 2C42A 1T3OA 2HLUA 4ZPWR 3BSOA 4KV8B 2FB0A 3JXOA 3DI6B 1ZZFA 4OYWA 4DX8H 5FLXU 3DDNA 4C9DA 1GXUA 4DUZJ 5LOQA 2O1PA 4MKAA 1TKZB 1RAJA 3U1NA 3PIOQ 3AQOA 4CLLA 4Y2MA 3VGSA 1VHFA 2RQCA 3QBCA 5LMNF 2JJ4D 1HNVA 4OHZA 5T14A 1BC6A 3W66A 4CLPA 2VPYB 3SV4A 3TWZA 2C2RA 2Z0GA 3D1HA 4RW9A 4Q43A 4DUYF 3OVBA 1HFEL 2I5JB 2GGPA 4LF4F 2MXYA 3Q83A 4JI1J 4ZVHA 1HI8A 2NZCA 3V6HA 4ZS6A 2W4DA 3GJTB 2OPQA 3LF0A 4RL1A 5AE1A 2KT3A 3V81A 2NXEA 3GPAA 2IM1A 1GEHA 1Q78A 4ZOSA 1ZAXA 1X8DA 2BEFA 3ILIA 1BHNA 3QMQA 5EHHA 2CAJA 2I6WA 2ZVIA 4ZLLA 1FKOA 1HI1A 4NLPA 2R7OA 1Q81T 4ZPTR 2QO3A 1PC4A 1E6VB 4HL9A 1KTVA 4FYXB 2GX8A 2MY8A 1F1BB 1RB0A 1RWVB 4PQAA 3KLFA 1RWMB 5HP1A 4TYAA 3D9BA 4K4WA 4DV1F 1EQ0A 1TU0B 2ZITA 4QJVA 4WIIA 2GC8A 1S9GA 1LFWA 1KQKA 2ALYB 3NY0A 2DNQA 3CPWR 2NREA 1FFSB 1HR0F 4WKYA 1QVGR 3AJDA 2RDIA 4GMKA 4I2PA 3WX8A 2KM8B 1X4BA 1NSKL 2G2ZA 4NYZA 4QW9A 2B3TB 2XM3A 3KTQA 4RUCA 1N48A 1IUJA 2F63A 3NRBA 4K7QA 1QAYA 4YP3A 4GC7A 1FX4A 3GIRA 3PRDA 5T7LA 1S10A 4FN5A 3PYDA 1Q8IA 3VF0B 2HS4A 2HHUA 2HFSA 4F2SA 2YTCA 4C7QA 1NPRA 3DMJA 4OYZA 3HSGA 4I56A 3PKYA 4DL5A 1XMQF 4MKYA 2JFKA 1EB0A 1FI4A 1PIEA 3WQPA 1Y10A 4LRCA 2N7YA 4DR1F 1TL3A 4I6AA 2LVWA 3U1LA 1Q1KA 2E5IA 1JLEB 2HFZA 3C66A 3N5FA 3QIPA 3EDRB 3PW7A 2GJ2A 5EX0A 5CD4A 4DR4F 5LSLA 4P71A 3R9LA 2HFNA 1NK5A 5F8GA 2CRLA 2J6SA 1H98A 2XI3A 4H4KC 2V4QA 2V68A 2DEIA 4RR5A 4I2QA 2CQIA 1M5SA 2AMCB 3NGSA 2ZM6F 2AD9A 2CYYA 5CA5A 1FT8A 4YR0A 4B02A 2RH3A 3SCIE 2DHHA 1XNRF 2FHMA 2LEPA 4LRFA 4KC5A 3NGRA 4ZPVR 2XSJB 5K5MA 2HFOA 3CDEA 2IA0A 3VV2B 2FY1A 4OIXA 4PWDB 3GG1A 4HTJA 4MAKA 3GSIA 2OTLS 4OHWA 3VHQA 5C42A 3D66A 2XMUA 3ZZZA 3M2UA 3D1QA 3BQ0A 2YNHA 5ETVA 1SJRA 1ZM3A 2IDEA 1QAIA 4LFCJ 2CNNB 4QYZK 2MZQA 4F4KA 3T5JA 3SV3A 3CCJS 4EEYA 5CQGA 1U0SA 3PW2A 2DPJA 4LMZA 2FPHX 3IG1B 2RUSA 4M5MA 3TARA 3MM5B 2H3EB 2KYXA 2L9NA 2QYCA 4O0NA 1ZM4A 2HHSA 2UP1A 1K47A 4PG7A 5I42B 4GKJF 1FRHA 1TELA 1XJWB 1TAQA 2L08A 3DRPA 2V34A 3QT5A 3K5LA 1I94J 4IOBA 4DV7J 1IBLF 3ENQA 3MD1A 4ILMA 1N34F 2L48A 1Y4ZB 4GKKJ 2R8HA 3FK4A 1FXDA 1SKRA 2Q6CA 2DXEA 4B3TJ 2DCLA 2H48B 1I6JA 1UW4A 2XMAA 2BQRA 3GJQB 4JI0J 1UVMA 3HHNB 3HJFA 4OYBA 4I67A 2O66A 1IN0A 4X62F 1X5PA 4I0WA 3ETOA 1OPIA 5J1NA 4EU0A 4DL6A 1TFYA 2ZC3A 3A8JA 1SV5B 2HBQB 2CPFA 2MQOA 4N56A 3DN9A 3PR5B 1P1LA 2Z2YB 3EZ5A 2HAIA 3AD9C 4GKJJ 2RB7A 2FHJD 3VAFA 3T5LA 5KFEA 3M6XA 4MK9A 3LGMA 4HI1A 3RRHA 1R0AA 3QSYB 4I7FA 2DR7A 5KAKA 3MEDA 1U1OA 1MW7A 3A13A 2HS0A 4DPWA 3P3DA 3M32A 1YKWA 5KG2A 1FESA 3MR5A 3WHIA 1EQMA 3QFWA 7AT1B 2YVSA 3CMES 2GHVC 2M52A 2Y1LB 1HPZB 1HNXF 4ITSA 3BKFA 4PPDA 3G8TA 4DF8A 1N5YA 3PFEA 2OMLA 4HTIA 3H5YA 1FKAF 4E98A 3MEKA 4L3NA 4OZ3A 4DR2J 4TLRA 2KZMA 2VV5A 4KHPF 2WW4A 1EHWA 3NGTA 3WC0A 1HHSA 2Z2LA 3PCOB 4ANEA 2RIJA 3GWCA 1U1PA 2JWNA 5HROA 4FF4A 2B7CB 5AXMA 3KLEB 1RHUB 1FTCA 3KLEA 3QT7A 4KY3A 1Q8BA 4LR8A 2LFVA 2R7QA 2WSCC 4JB8B 2VOOA 2WB4A 5GADI 4G65A 5HMXA 2V8VA 3R2CJ 1PILA 4ZJOA 2BE2A 4TNOA 1RWKB 1AB8A 4NXNF 3QAEA 4ECSA 4NA3A 3FVYA 1N5YB 2M5YA 1W2IA 3A12A 4M5HA 1VK3A 3R5CA 2FVQA 2CQDA 2OUGA 2XLKA 3PJXA 2AX1A 4RBUA 4K0KJ 3JTPA 4UTGA 1M0SA 2AJ0A 1UWBB 4WFNQ 4PR6A 1T9YA 3J81Y 2CNLB 2J9EA 1FWPA 3M2RB 5H9EJ 3QJLA 3US5A 3NMRA 4UOHA 4KAIA 1E6VA 2DGWA 5IV4A 4NZ6A 1FFGB 3Q8PB 3HT3A 2DNKA 5BR8F 1WKLA 1S9FA 2NLWA 2QMUB 4OYPA 3G2XA 2U2FA 5KFIA 3NCRA 2VICA 3N79A 3MHYA 1FJEB 2UVVA 2HS3A 3PRVA 3W1YC 1FRMA 6FD1A 2KG0A 4LFCF 3V2UC 2AJ2A 5D3GA 4ELTA 1B64A 1HBNB 1TV6B 3MM8B 3BREA 3TA0A 2JSXA 4GRSA 1SH3A 3KK3B 1JLBB 2N4CA 1HMVB 5KFTA 2XMMA 1X31C 2R8JA 3RBXA 5DQGA 2OHDA 3I5AA 2MHEA 3N6MA 3WC2A 2E44A 3E8OA 1CULA 3SDEA 2MKHA 1ZZNA 4G1PA 1FVSA 3KG0A 1FDNA 4P7TA 4A48A 2B9WA 4UY85 1F3FA 1F5CA 2FTRA 4CT9A 4WTOB 5JJBA 5F8MA 1T03A 3M6VA 2R4FA 3W8PA 2ZDPA 4J7CA 4R0JA 4J9OA 2PI5A 1XMBA 3PRBA 4ZP9A 3TQ1A 1DTQA 2X7IA 2XYGB 1QY7A 1X5TA 4XAKA 4CH0S 2QLFB 3Q8SB 2MYFA 3MM6B 5AXLA 2Y1JA 1NNDA 1FD2A 2WONB 3B78A 3C6UA 3IMQJ 5GAHI 1YI2S 1HYSB 2K1RA 3Q8RB 1R8PA 4ETXA 3KDOA 1QVFR 1RT5A 1LWFA 3BJYA 3ULHA 4LF4J 3D68A 4P10A 2YKMA 4WPAA 5A6WA 3KLGB 2BANA 3RGIA 3A4TA 4OV1A 5HBMA 3K17A 2YKPA 4FF3A 3CD6S 4I68A 3PXGa 4DQRA 5J2PB 4LVOP 3PEHA 5CXTA 4CO2A 5GMEA 3TUZC 4OFZA 3NWGA 4NLQA 3CCRS 3NP5A 1EX8A 4GO5X 3DNCA 4EGLA 2IDLA 2FYXA 4ECVA 1K0TA 4X66F 4CCHA 5F3ZA 4Q45A 2HVDA 1CC7A 3C15B 1UPPA 1FNMA 4DU7A 4OI6A 4Y34A 4DJBA 4EZ6A 2QV6A 2GV1A 3M2VA 1CC8A 1NPPA 3BQ2A 3KG4A 3D2WA 2R2SA 4HDHA 1SI9A 4E8UA 3DM2B 3BB5A 3D3CJ 2DR9A 4JI6F 3HLUA 3JTOA 2CG8A 2R8IA 2DCUB 2WVEA 3K8VA 3SQOP 2CJYB 3B82A 2NPFA 3EGWB 1H2VZ 3RAMA 4W92B 1JWWA 2CZVC 1N5TA 3KWMA 1RKJA 2UUCJ 1RAEB 2FHOB 2FD2A 4M5JA 1VRTB 1DQ9A 1ZPWX 3LP1A 2MGZA 2ZDOA 1WOOA 2BKOA 3GV8B 1K73T 3OJSA 3KJQB 4F3MA 2CQ4A 5GADU 2V8PA 3D3BJ 1Q0NA 2DEJA 5KT4A 5CHCB 2R2TA 2DGXA 3DOMB 4F2RA 1GMWD 2DRBA 3ZXWA 2AU0A 2W1BA 2EPIA 2NXUA 4KR0B 4U7UD 4HLBA 4D3HA 3V6JA 3KJVA 2XCAA 1G7CB 5E7OB 4DHVA 5A2QY 2EFNA 2FQQB 5ETLA 2VA2A 4WXOA 2ZBCA 4JI2J 4NL5A 2GJIA 4RW6B 4J91A 3EXYA 3MMAA 4LBIA 4F04B 4RZRA 3CUNA 3IR5B 3IWXA 2VC1A 1X9SA 1IBMJ 1RWOB 1KOOA 4DCPB 5AJ3J 4DQIA 3G86A 3L7UA 1HW8A 3MOJB 2DH7A 1Y5IB 2NXJA 4LFBJ 5EWEA 3HD2A 4YN3B 1S1WB 2CVIA 3V81B 1ZETA 1BQNB 1VBKA 2BM1A 2POKA 3CCTA 1P9QC 1FHTA 4Z37A 2J8SA 3KFWX 4M5GA 3DLJA 2DT9A 4RW7B 2J5AA 1PYOB 5CZVA 4ZP6A 3NBPA 1TV6A 2EEYA 1LK5A 4DV6F 2B56A 2XMVA 5D0GA 2VH7A 4NXMJ 2JOQA 1BWVA 5KFBA 4RLEA 2YWGA 4ATNA 3OBIA 4OZ1A 5KT2A 1RAFB 2DHAA 3P4UB 2OD4A 1GTEA 1JNRB 3RU0A 3OPKA 3VCDA 3SZ2A 3G82B 1UFLA 4HH0A 1NJZA 5GVQA 2J7UA 2LA4A 1T9VA 4QU6A 4RO0A 3HVAA 3MXHP 4OJ3A 2WAQD 5L39A 1FK9B 1S9EA 2YNFB 4MIWA 3KLIB 5FDLA 4F25A 2UUBJ 2X3GA 2HWHA 3M8RA 2VF3A 4HI2A 3SSRA 3BSNA 1ELOA 2V63A 4EI2A 1SCJB 4ECRA 1V3RA 3L95X 4CLSA 1X9WA 1VS3A 4LBHA 4MYUA 4S0MA 4URSA 2K3IA 4CRJA 1M1KT 3THVA 3TUJC 5A8RA 2P2CB 2QL5B 4F3OA 4RPFA 4DDFA 4RNOA 1C0UB 2MKSA 4HT5A 1NJXA 5IC6B 3V6DB 2KU7A 3MCMA 3ZTPA 3F73A 2KXHA 2KXFA 3W64A 4J9MA 4K8RA 3SCKE 4KGKA 1VK8A 4AQYJ 2CA9A 3KK2A 2XTJP 3T1HJ 1QAJA 2ZUAA 2VBXA 3ZZOA 5EDWA 3MFHA 1RT2B 1VRQC 2YQ1A 4NZ7A 1BQXA 2DIVA 3CW2C 4HACA 3KLVA 1IR0A 1IM6A 4PG4A 4ZA1A 2AF6A 3UWTA 4B3OB 3C16A 1LK7A 2KB2A 1XN9A 4ANCA 5E5NA 4Q0BB 3NGKA 1S5ZA 2MKYA 5HMWA 4ZVOB 2VQFJ 5EX3A 3TW0A 2DTJA 1H7WA 2NSCA 2PI4A 3QJPA 1CLFA 2VASA 4UUWA 5EWGA 1P6TA 1YK9A 4USVA 5LM7E 3IS9A 1SUQA 3LWLA 2VA3A 3MD3A 4JI6J 4F26A 2BE9B 1SKSA 2QLXA 3CJTA 3DDKA 3BGOP 4C0BA 4B9NA 4DG1B 1EIYB 4EK2A 2C2MB 4N5SA 4N76A 3IG1A 1XK8A 4ED8A 1AFIA 2HVZA 2DGSA 3OQ2A 5C5JA 5LMUF 2FJAB 1S49A 2D1CA 3I4HX 1SIWB 1BY9A 2OPSA 1N5VA 2VBYA 4PAAA 2I9SA 5CZXA 4ECUA 5KFUA 5D15A 2VKZG 3CJKA 3G82A 1D8YA 3B8HA 4PXEA 4F36A 2DH9A 3AXKA 4NLYA 5L1IA 4J90A 1XMOF 2C2EA 1F6TA 2YX1A 5KFZA 1T9XA 3MM7B 4DUYJ 2RILA 1HIYA 3LGHA 5IM0B 1N36J 3ADAC 2FGCA 4HR2A 4ZLNA 1X7VA 3UVJA 4J9NA 1CG2A 1RBLA 2BMBA 4A46A 3HJVA 1BQNA 2ZH3A 4FDFA 1RT1A 1X4GA 1AZSB 1S1WA 3MPYA 1XQIA 2ZFHA 5JUMA 4FXVA 2KH9A 4F4ZA 1RBOB 3DOLB 2PA3A 2JLFA 2IBKA 1S48A 5KFSA 3P96A 1A9NB 4K4XA 4CTAA 4I6WA 4AXIA 4DI6A 3IXQA 3PVXA 4C8YA 3C14A 4OYAA 4M5IA 4ZK7M 4RW6A 2HHXA 2MDAA 3MI7X 2GIRA 2VDHA 4WU2A 1UFKA 1HWJA 5KG3A 2XLJA 3FMWA 3W9IA 2H4WB 3SQGA 3UN5A 5J2MB 1HHQA 2BXJA 2HQIA 3IM9A 2HGNA 5HANA 2P9GA 4ZHRB 1K8AT 1D8ZA 5HVGA 2B5JB 4U67Q 3QT8A 4ICLB 2CPJA 1MU2A 2ROPA 2VBZA 2W2MP 4H4OB 1YBUA 4LUBA 2VHGA 4KHPJ 1VJWA 5LJ5Y 4JI3F 2C2KB 3QO9A 4Q2MA 3WX4A 2DHXA 2NCKL 4LF6J 4C8NA 4ZVFA 3N28A 2DNLA 3GP9A 2HQCA 1DQ8A 2DNYA 2ZBRA 3W3SA 4OX9F 3BGRA 5KFNA 2W9CA 3ISNC 2GW8A 5DLFA 2WOMB 1N33F 4MKBA 3KYLA 2G1DA 3EYZA 5MAOA 3J80U 2JX2A 3Q89A 1KHVA 2OD6A 3R6GB 2RF2A 5I3UB 3RB4A 1FD8A 3FRYA 2RF2B 1WNEA 1IKXA 3DGVA 2NQPA 1BMQB 1EP4B 2L3MA 4Z2XA 2EK1A 3J81j 3MWBA 1JNZB 2HNDA 1RT7A 3X1LB 1AROP 1HWLA 1NJWA 2DO4A 2CKWA 3CO0P 4P52A 4U9RA 1FJCA 1K0VA 4MH8A 3IGNA 1TUWA 3UQSA 3R5DA 2BKNA 4IH5A 2MHNA 2XS5A 1IBMF 1WG1A 2F9DA 3C46A 4L3KA 1Y11A 3KOAA 3NAIA 2QN6B 1WI8A 5C25B 4DZDA 3HPOA 1HQ2A 1X9MA 2BV3A 4JI0F 1IQTA 1ZTTA 3OT9A 4H4OA 4LR7A 4N8NA 3RB3A 3AOAA 1S99A 2EK6A 5D0EA 3PX4A 1VC0A 2XULA 1Y5LB 3VGTA 5KFWA 1PAUB 2FJXA 2RJZA 2MB0B 4MT1A 4AL7A 5BJRA 1NSAA 3RUBL 5CAAA 1I94F 2ACMA 2K3KA 4EBCA 2M9KA 4A8QA 1QTNB 1H3DA 1H73A 1RWNB 4QIVA 4O3SA 4J9VA 1UP1A 1LWFB 4WU3A 2E1RA 2PIIA 2QMXA 3JSMB 2Y8YA 4FYYB 2DNZA 3IRXB 4WK3A 4CTAB 5C2CA 1KOHA 1WF1A 2WBRA 3QSIA 3I0SB 1FKOB 2AYEA 4IKAA 3VGVA 2ZE2B 5M2UA 1KNZA 1QE1A 1KN6A 3BYPA 4KO0A 4WF9Q 5HQLA 3DI6A 1CJUB 2YWEA 4W4MA 4K59A 1VC6A 2YWFA 3P5TL 4IFYB 4IG3A 2IA6A 2VU5A 3P49B 1DY3A 4DR7J 2IVMA 3PO4A 3QIDA 5ETPA 2KFYA 3BDPA 1TKXB 3GR1A 4PRFA 4ES1A 1KLNA 3RG6A 2HVHA 3VQTA 5IM0A 3N6LA 5D6GA 1RTDA 2HW3A 2LU1A 2ROEA 2RQMA 2FZGB 1R8CA 2QZ8A 1FRJA 1LWXA 3BBFA 4FYVB 5DO2A 2YKMB 4Y0FA 5KG4A 3VAGA 4ELUA 4HVZA 1N32J 1N6QA 4E2FB 2X1AA 4KRWA 1S6QB 2VPXB 3FC9A 2MSTA 2FLPA 5DETA 1Y9OA 2KKHA 4ZJLA 2W4CA 3I5BA 5DS7A 2FC9A 4QR1A 3CCWA 3A1YG 4MTPA 1IM4A 5AXKA 4DN9A 2J6UA 1EZZB 5KFDA 1FERA 5HJYA 1NKBA 1GAOA 1Q53A 1UTAA 3BDEA 2D41A 4Q0BA 4IDKB 1PYSB 1JK9B 4FPRA 3SXLA 4Y2CA 1JJHA 2ZZMA 4TKTA 1A0OB 3PYEA 1SUQB 3Q8UA 2Z57B 3LGNA 4ZPDA 5F0UA 1Q16B 5IC4B 3HMJG 2AEFA 2B0GA 1HWUA 3CJ0A 4DU8A 3GFZA 4YMEA 4LFAF 2R7SA 4LRDA 3M2RA 3OV7A 1HNIA 1ACMB 3IRWP 1QSLA 4DSIA 3LANA 5ETQA 4LSLB 1VMBA 4USHA 4ZMMA 3BPSP 3GFXA 3AOCA 1JLBA 2HRTA 4RNMA 4B9SA 2L9DA 1DJ0A 2DB1A 1HARA 3TOQA 4CO0A 3OLBA 2B51A 1GMUA 3BN7A 1QDUB 1FVQA 2OPRB 3DLGA 1B0TA 4C98A 2MZ1A 4TVAB 2UUCF 5DDRC 2QE5A 3DOKA 4WE1A 3D6TB 1WC0A 2XMKA 4LQ9A 3PX0A 2RD5C 4MFBB 2VOPA 3CCZA 1RHKB 1HNZJ 2CPZA 5LXRA 3UR0A 2XNRA 1B4SA 3OR2B 1NZ8A 5HSPA 4QWAA 2XB2D 1MG7A 2KTQA 2HGLA 1FEEA 2HNDB 3DKDA 4OJ1A 5A8RB 3MR2A 3MFIA 4DR5J 3PZPA 4YHHF 1WTFA 2W2OP 3D6MB 3KUGA 3H25A 5A8KB 1S97A 5M2PA 2KYZA 1M5VC 4WZMA 1DTTB 4FVCA 4B08A 3D0GE 3CJRA 2LKZA 1AW0A 2MLZA 3CTRA 3KLIA 5FDLB 4X66J 1F2HA 1U02A 4DCJB 4QWDA 2KM8C 1ZAVA 1PJ7A 3MR7A 4PG6A 4N41A 1TMJA 2OAUA 3VZIA 2N82B 1JXLA 1VQ9S 1H2UX 1SJQA 3OR2A 1IJFB 2WB1D 2IMWP 1C1CB 2E5LJ 3T9ZA 3T1YF 3W5YA 2YQ0A 2J0QD 3W9JA 3KK1A 1RDRA 1GH8A 2GVDA 1RYSA 2GQCA 2FZKB 4QW8A 1J5OA 4ES2A 2DNNA 2IRYA 3C8YA 3DU5A 5E3AA 4U95A 1S0MA 4I4BA 4CM2A 4YB7A 2HK3A 1NK9A 3W61A 1QM9A 5HL7Q 2D9PA 2MQPA 1DFDA 3IN5A 1VYAA 2EG2A 3EUNA 4LSLA 2AGOA 4Y2AA 1J5EF 2HHWA 2J9DE 2WZ1A 2E1PA 4TU8A 5KG7A 1F9HA 2QFIA 2DGTA 2Y1IA 1RT3B 1HR0J 2AJQA 4CI0B 4KPYA 1JMTA 5D78A 3DCAA 3J7ZT 3EXCX 3V4IA 3IWNC 2HIYA 3E51A 2QSWA 3KJFB 3W8GA 3DXBA 1S1XB 1JJ2R 4AE5A 2XCPA 1OIAA 2H4YB 1EETA 3P8BB 1LWEB 4ZN1A 1IBCB 4DS4A 4NLVA 2YNHB 1R8AA 1SC3B 5CD4H 3RBDA 1S6QA 1V5VA 2B8PA 5AJ3F 3LP2B 3KNGA 4NZ0A 2JLGA 3A3PB 1REVB 3MPWA 3RJMB 3Q24A 4DV6J 5DZ7A 2PDAA 3TUIC 1VBZA 2ZKUA 4JI5F 1JLAB 3D0IE 3JTNA 1RAIB 3MAQA 1XR7A 4ERDA 2XY5A 2JEJA 1RJJA 1IR2A 1V3ZA 4C8ZA 2FHKA 4P74A 2CQCA 2QYGA 1F9EB 1RWUA 2RKIA 3A8IA 4ZDNA 4CH1A 3T1HF 2DPIA 1RHQB 2HPUA 5FLXY 1Q95G 3BZQA 1ZAWA 4UQTA 2OEMA 4I2QB 4NA2A 1DLOB 3K2YA 5FD1A 1XNQF 1V6HA 4OJGA 4C8OA 2JZ5A 4U96A 3ZC4A 4ZITA 1NLKL 1QSSA 1RQ0A 2DJWA 2ZWPA 4DEZA 3V4IB 4DR6F 3SFUA 1N4LA 1WUUA 4KO0B 4LJMA 5KG1A 4AXJA 3FQLA 3TVYA 3I0SA 2MQLA 4IFVA 1LW0B 4KIAA 3QZ7A 4A8OA 1Y7PA 4DFPA 4ILLA 4KHRA 3H8YA 1N5QA 1BGXT 1Q8LA 2YWKA 3NS6A 4BHQA 4E0DA 2K8GA 5IOLA 3W62A 3FEZA 2PD1A 2CQ1A 4F50A 2R8GA 3S1TA 2MZTA 1W25A 4NEZA 3BO4A 2BACA 3CJ4A 1JLCA 2RHQB 4USIA 1TK0A 3M30A 3R7BB 3JAMY 1NHUA 1BQMB 3CVKA 3M8QB 4LIRA 3NCQA 4RJVA 4DPUA 3AOBA 1QD1A 3KJNB 5CYJA 2KI2A 3M1VB 1WELA 3NEKA 2VZ9A 3CJSA 4IH6A 5F0WA 1VBXA 2LYVA 1KSPA 3TYTA 2W24A 4LF8J 1WOPA 1X4EA 3FCVA 1WHWA 3LP0B 3R27A 4G6VB 2GS8A 1CJKB 1HLWA 3J7YU 3RAXA 4FYWB 2RU9A 3PHTA 1NB2A 1U26A 1YBTA 3QIPB 3ZZYA 4ZIVA 1JLGB 3OL6A 2CZ4A 2J7WA 1TL3B 4UY8T 1EP4A 3HSJA 2IAJA 3NNHA 1YRXA 1NXIA 2IYGA 2KHCA 2Y0SD 3BPDA 4USUA 5B0GA 7FD1A 4ID5B 3FGVA 5A2QU 3PNIA 2ZH4A 4I1TA 3FRZA 1B99A 2V4RA 2OLWA 4EFAC 2YNIA 2NXNA 2Y1RI 1LW2B 3CT9A 3QJJA 4B3TF 3JSYA 3BGFA 4YFUA 4F4YA 4LFBF 1H2TZ 2NYIA 3NGUA 2HHPA 3DLHA 2CG4A 4DPTA 2CPEA 3ELHA 1OY6A 1SC4B 1T7PA 4DR4J 4EBDA 1Z4UA 2JC0A 4FP9A 3UNGC 4BWMA 4JI2F 3DLLQ 1F2GA 3MF5A 4HEA9 2HHHF 4KJIA 4WWSA 1TL4A 3CC2S 1YGYA 2A18A 4ZHRA 3BR9A 3UFCX 5E33A 2RMLA 3BBBA 4KKOB 4CIOA 4ED7A 3PEJA 2HNZB 4OYXA 1RWXB 1U6FA 2XWXA 3CJ3A 3ZO7A 2JNJA 4K4VA 3BBCA 2E1AA 2ZJQQ 2Q3PA 4V19X 3M8PA 2CUYA 4MMOA 4O0IA 5HLFB 1TKZA 2BR0A 4O3OA 2QLBB 2DNGA 3R8YA 4ECZA 3O8WA 1I51B 4RW8B 1C4CA 3MMAB 3PM9A 4X4OA 3C6TA 4IUFA 2CPHA 1RTJB 3ZZTA 1YJNS 2HAFA 3EJMA 4C48A 2MJNA 3NXZA 2PFFB 4KKOA 2OPQB 2LXIA 4D3GA 2A6OA 2GO8A 3HP6A 3LA0A 5CABA 2KN4A 3SMZA 4CNZA 4ZP8A 3D6HB 1VCTA 5B0FA 1WDDA 5HK4A 4DSEA 2UU9F 1WC5A 4YS2A 1VQMS 3GIKA 2DNOA 1TR0A 3RB6A 5K8PA 1FDAA 2AYBA 3M1VA 4NI2B 3PIPQ 1PJ6A 4DV4J 1YWXA 3EWGA 2YY3A 3K5NA 1FWLA 3H2UB 1O0PA 3I0RA 3H59A 1CS4B 5CYMB 5IT9U 2C2OB 4AL5A 1JJCB 3MTJA 1LW2A 1U0HA 3MUMP 1YX2A 4C97A 2DRDA 5I3QA 4IG0A 2GNKA 1YRUA 4DR1J 1URNA 2CPYA 1E6YB 1MMNA 1Y5NB 4WFAQ 1AXQA 1MSWD 2WW8A 1HW9A 3FUYA 2OIHA 4ID5A 1U45A 1SJFA 2G13A 2HNYA 1RZMA 1NRKA 2QRRA 1S77D 2MLXA 4O3PA 2FY8A 4RWWA 4TQRA 5LMNJ 5KFLA 4LR9A 2L41A 2W7OA 4Q8EA 5ETRA 5K8NA 2NUHA 3MEDB 4USMA 3CCMS 1VIXA 1S6PB 1R6YA 2B6AB 1UA0A 2VFUA 3AB2B 1WG4A 3G87A 3CJ5A 1BQMA 3M8QA 5DDQC 1Y3JA 1HWKA 1HQUA 4EWTA 4QWEA 2N3OA 1XWLA 3VAIA 4UUXA 2ZJRQ 4P75A 2XZTB 3OSNA 4KFBB 5D8HB 1NM2A 4NOHA 3TAPA 1IQZA 4YDDB 1UA1A 2E29A 5C24A 4C11A 3EGZA 2B4UA 4IH7A 4UOCA 1HNWF 3FFIB 5KFQA 4QYZJ 2K2PA 7FDRA 4DV0J 1IWGA 2NR0A 3C6UB 1HYSA 3SEOA 2MKJA 4FBTA 1U47A 3MM6A 4LRBA 3SIPB 5I4MA 1WHYA 2M4MA 2GHWA 4BLGA 3WIUA 4ZLJA 2QX0A 3LPEA 3RBEA 2FVPA 5C7PA 1N0VC 3DFEA 1SQFA 4EYIB 2UXCJ 2JVOA 2DHGA 3AA8A 5IT4A 1EKSA 4ED0A 4OMFG 4K4SA 2DGUA 3OTDA 5KFRA 2LDYA 3BYRA 3D0HE 1MROB 4RNFA 3M2UB 5BYQA 4TY8B 3CCUS 4IOAQ 2KFNA 1UMJA 3MMBA 2ZH5A 2GMLA 4LIWA 4OX7A 4JI1F 5LXYA 1JLAA 5BR8J 5KG6A 2MEWA 4CM0A 2I0XA 4TU9A 1U4BA 2Z56B 2QJ3A 3MCSA 1B3TA 1MU2B 2DXDA 3KK3A 4IYQA 2D3UA 1QLNA 2M7SA 2VPWB 4PYAA 3VWSA 4ZVGA 3H4DA 4IR1A 3CDBA 4O3QA 2JEFA 3NBPB 1HBNA 3BSCA 2MKIA 2DNRA 1CJVA 2QT7A 1U8WA 1M90T 1I3OB 2EFGA 4P7VA 5F8LA 3OLAA 1WEXA 2LA6A 1S79A 4QIGA 3L3CA 3CCVS 1VRUA 4PUOB 4CDIA 3G8SA 1C0TA 2O3DA 4U7UK 4C0OC 2UVWA 1C1CA 4U8VA 8ATCB 1T3NA 2QFJA 4ZVQB 1VQ6S 4RWXA 3H90A 3LQVA 3F44A 5KFPA 3M9NB 4OI4A 3RRGA 3FBBA 3TR5A 1SQEA 2C3PA 5B0AA 4R0EA 5AE2A 2XO7A 3HVRA 2UUBF 1C0TB 4NMLA 3NS7B 1U7LA 2Z30B 1DTTA 3CMAS 4PQUA 1VDHA 3UI3A 5HQMA 1W26A 2PA8D 5A8KA 4XPCA 1L3SA 3ZTRA
chains in the Genus database with same CATH topology
5GAEU 3C3LA 2C22A 2LQBA 2DGOA 2R9LA 3WZ0A 3CGIA 4V19J 5KG0A 1ZM2A 1RISA 5D4PA 1HL6A 3KK1B 1JIHA 3AJ1A 3W7BA 4Q8FA 1PO6A 3QGIA 5JXSA 1S1UB 2YQ3A 4WK1A 1LFPA 2IC3B 3O2IA 3I32A 2X1FA 1IKVB 4O44A 2ADCA 1HPZA 1NKCA 1DRZA 4DG1A 4B3RF 3Q23A 3T1AA 3PW5A 3FCHA 3J80Y 4R5PB 1ULRA 4NYOA 3W2VA 4DL7A 2QA4S 4JI7F 4F8RA 2CQBA 4OLPA 3CB4A 3IS9B 3WBZA 3UCGA 4I7FB 4Y65A 3HVTA 5J2NA 2DR8A 4JV5F 5J1PA 1RTIA 4X4TA 3RR7A 2F8MA 5KFAA 2IM0A 4MFBA 4A8MP 1NK0A 3FJ2A 5T41A 4M8LA 1TFWA 3L09A 1P1TA 2P9CA 2JFDA 2WSFC 4GO7X 4BS2A 2BBEA 4WXWA 5F9LA 4ES3A 2PMHA 3GV5B 1WWHA 4FNIA 2C3MA 2CJBA 3KHHA 3PJWA 3IWLA 2MY7A 2W25A 3CD0A 2B7BB 2I5JA 2PGCA 2ZHBA 4C8MA 2NZ4A 1VQLS 2BW2A 3N5BA 2XSFA 5L1JA 3LAMA 3NNCA 2J0WA 4R8UA 1RT5B 4XO0A 2CQ2A 3HF5A 2CDQA 3J7YI 1M5PC 1U25A 4C3KA 3HDSA 1NJIT 2UUAF 3CC4S 4KTQA 2KZMA 2HHTA 2WONA 3RW6A 5FJ4A 1RK8A 1RT4B 5CYQA 1X0FA 3CCSS 4X2BA 4IOCQ 3QWUA 1SJ3P 3DRRB 1FXRA 3A8EA 3ICLA 2XY7A 4YQWA 3K59A 3PY8A 5CYQB 1S9EB 1DHMA 5B0DA 2GIQA 4IQMA 3K5MA 2D3OR 1SL2A 1D0EA 4IR9A 1YVFA 4KHMA 5CCMA 2A10A 3ITHA 4M95A 2QMWA 2CQGA 3F41A 3IRXA 5CYMA 2PC6A 5B08A 4CO5A 4RX6A 2IRXA 4B3MF 3G96A 4UQGA 5A0YB 5KTQA 5KFKA 2DGVA 2ATLA 1Q86T 2NUUG 2YKNB 1CQNA 3BM7A 1KD1T 2CJKA 3IAM9 2VB6A 4IQXA 4QZVB 2LQJA 4RW7A 2ZJPQ 4Q2LA 3AY0A 2JH3A 4IG3B 4IFYA 3ZZUA 4ZLPA 1B0VA 3RTVA 2BM0A 3GZ7A 4F3QA 3HVTB 5J2NB 2J9DA 3LWMA 1RT7B 2R7VA 2GQ2A 2QLWA 1JLEA 2F1FA 2YH0A 1MMDA 2IBOA 2E1CA 3W2WB 3FSXA 5KOWA 5E3QA 1C1BB 2ZUGA 2XEXA 2PE8A 3DMJB 2IAJB 3HKWA 1UJ4A 4NPOA 4QIWD 5L9XA 3TAQA 1X0PA 4OZJA 3HZGA 2RRBA 1G3OA 3MAHA 3OHBA 4HYKA 1NO8A 3DOMA 3PDNA 4ECTA 2LECA 2D3ZA 4C4WA 2FJBB 2BQ3A 5E3CA 1DARA 5J1EA 5DRKA 1S1UA 4NX9A 1N56A 1LWCA 1XC9A 3S01A 1K1SA 3FSIA 2AYMA 1KR4A 3UD4P 2CQ3A 1JKHA 3K5PA 2DNMA 1YTYA 2F3JA 1UKUA 3G8QA 5KT3A 2JRSA 3SI8A 1YG0A 4FXWA 2BOPA 4ECYA 3NL0A 3DLKB 2E5GA 2OH2A 2RNEA 2IM3A 1LV5A 4M1KA 1VQ8S 4DSLA 2OSQA 3GQCA 1Q7LB 3TVKA 3KMSA 1NEEA 3M2VB 3M32B 3BGRB 4AQYF 2V9KA 3RYLA 3DC2A 4B9VA 4DV4F 2J0SD 1OSDA 5DG8A 1R0AB 4X4PA 1L3TA 1SC6A 1FRKA 2OPPA 3IAS9 5U47A 5J2QA 3IC1A 2ZKTA 3E01A 4KBIA 5EWFA 2UXDF 5GAEI 4BDPA 1CPZA 4FF1A 3LO3A 1VFJA 3TAMA 2GGPB 5DG9A 2ZVSA 3OVAA 3MECA 5D4LA 3SQGB 4DR2F 2HQ3A 4LF7F 2W9AA 4WFYA 3RB0A 1HNVB 3F56A 1WD6A 2JEGA 1KLMA 1NZAA 2I8EA 3D54A 1VOMA 2EFOA 4NLXA 1WHXA 3K5OA 4QWBA 3ONQA 3U7JA 1X4DA 1U1QA 1FEHA 2FUG9 4I64A 4LSNB 2XGQA 3DHWC 3DRPB 5KOXA 2QA2A 1VQPS 2I1RA 3B4DA 2W8KA 1RYRA 1FRIA 3GR0A 1TL5A 4BC7A 1AFJA 2JC1A 1U2FA 3ZZPA 1FRXA 2DNHA 3IO1A 3MZIA 3THPA 1IKWA 2BJDA 3GYXB 5B7WA 1VC5A 3UW1A 1WF2A 4Y6IA 2I38A 5CCLA 1QSYA 4C0HA 5L8RC 1KVJA 3DLBA 4DSFA 2EKYA 5C42B 4YB6A 2W9BB 2ADBA 1R27B 2E7XA 2PT0A 2LQ9A 4OHXA 2V4JB 2VG5A 4DFMA 2ZH8A 4PWDA 1YQHA 2V5HG 1YJWS 4JBCA 2IJNA 1HMVA 1QTMA 2E7WA 3T5KA 4CZCA 2UVUA 3G6ES 4WFXA 3M9MB 1W2BR 3OXGA 3P6YC 3PR4A 5D3GB 4RBVA 3NGDA 2WRMA 4HH1A 2M88A 3HHDA 1HHTP 1OQ6A 5H9FJ 4FF2A 1U24A 2RE1A 2OPPB 3JSRA 1TK5A 4KSEB 2XG8A 3CE8A 2LLZA 2B4OA 2E66A 1UETA 3VAHA 4DR7F 1H7XA 2A2DA 1LXJA 1Z2ZA 2PO4A 2WBMA 2EC0A 2FJVA 2DBBA 2IYIA 1MNEA 2WHOA 4L72B 2ZH6A 3T5HA 3OTCA 3HK2A 4B3OA 5K14A 1X4AA 3KHRA 1FK9A 2YNFA 3N0VA 4OI2A 4QIEA 5EGYA 4IG0B 4DMZA 3SFGA 4NLTA 2B9YA 2HWTA 1A7GE 1P8GA 3MR6A 3N6NA 2OMOA 1LWCB 1SXLA 3DRSB 3GG0A 2EBGA 5AJ3F 3T9NA 3CCQS 2OSRA 3H5UA 3J7A1 5ADZA 2RRNA 2LDIA 4F67A 3PHEA 2KFZA 2V0NA 1HBMB 3K8WA 1R8BA 4NWBA 3O5TB 2PMZD 2DO0A 3EX7B 1HNIB 1O5JA 3I6PA 3ISND 4C8LA 4RW8A 4K4TA 1BLUA 1DURA 3WDOA 2CJQA 3X3UA 4C8KA 4CO3A 3BO3A 4NLSA 3HFKA 3HI9A 4PUOA 4DV5F 4QBUA 1VQSA 1WTBA 2BUNA 3NCPA 4MK8A 2OPRA 2M8HA 1TKTA 2CPIA 3NNAA 4L6V3 2O5DA 1UJ5A 3HHLA 4NCAA 2MJUA 1N6QB 3K0JA 1YSJA 2D9OA 2ZHOA 4DLGA 2E5HA 5HN0A 3I9ZA 3MTKA 2DITA 3MURP 2GMHA 3MMBB 2MMYA 1MROA 3NMAA 3QWPA 1NAQA 3OXFA 3IR6B 5KFFA 5I42A 4CNYA 5GAHU 5E2QA 3OJUA 3N9UC 3QGHA 3R1HA 2LCWA 4WFZA 5ITHA 3TANA 1S4FA 3QGGA 4PG5A 5LJ3Y 2N4DA 2FC8A 1RT4A 2G0CA 3TP2A 1S0OA 2UXBF 4NA1A 2GHPA 2YX4A 1RA7A 3LP0A 1H6KX 3TX8A 3JSMA 2AGPA 2XSJA 1N36F 4ZKAA 2VG7A 4ETZA 3GIIA 1NK8A 3DRYA 1VRTA 3LP1B 4O4GA 5KFCA 4QU7A 1K9MT 3CWJA 4ID8A 4DQQA 3DLEA 1NB7A 3DLEB 4IO9Q 4YB5A 1TKXA 1X4HA 4JV2A 4O4GB 1U49A 3MUVP 5KFHA 4WCEQ 4B9MA 1Q7YT 3KKFA 2ZH1A 5B0EA 4RNNA 4NLOA 4K50A 5D4OA 4ALZA 3POTB 4PXBA 2AWZA 3SCJE 2K1RB 2U1AA 1LW0A 1U2RA 3OFGA 3UR3C 4FBUA 4YB1P 1HNZF 5JVGQ 4RKUC 1FTRA 1L5UA 4A8SA 2JEIA 4OZ0A 3VTIA 3CD7A 3TNVA 5DDOC 1VLYA 1DAXA 1IKXB 3BQ1A 3GE9A 5I3UA 1Q79A 1DLOA 1FE0A 3AQPA 2AGQA 1TAUA 1FRLA 1GX5A 1FDDA 1B0PA 2K7JA 1JKHB 3MPVA 2BANB 3OTOF 3SDEB 3EGNA 4UW2A 4Y28C 2MQQA 4RU9A 3DHXA 2AX0A 3MOZA 1OSCA 2WSEC 3M8SA 3CCLS 1Y3KA 1TL1A 4OZLA 4OX6A 2H5EA 3LP2A 5CH7B 1C4AA 2B5JA 4J37A 3S6EA 2HZCA 3MMCA 4M94A 1Y00A 2RUGA 2FVSA 2VL1A 2IFXA 1EETB 5J2MA 4K0KF 1WG5A 2XC9A 1S1XA 2APOA 2A1BA 1VQNS 4DUZF 1CSJA 3C6TB 1GXTA 2ILZA 2EWHA 1ZOTA 2BABA 1N54B 2WOMA 3CJ2A 2Z4PA 1VQOS 4LF9F 3FEYB 3H40A 1URRA 3PACA 3BGUA 2DHSA 2RDJA 2LQ5A 2VFTA 2J0XA 4YOEA 2WK4A 1Z2LA 2W4PA 1DBDA 5F8HA 4TU7A 4QR0A 2UVRA 5DDPC 1U1NA 2Q43A 4JOUA 4MJKA 5L9NA 3VR1A 1UWBA 2C2DA 1WACA 5E0OA 4DL3A 2XHWA 1UFWA 3I87A 4ICLA 4B9LA 3GYNA 4URGA 2PN6A 1UEUA 3AAWB 3BSAA 1TKTB 5SZTA 3TA1A 3PX6A 3I4PA 1S7HA 3HO1A 2E9RX 4QQBA 1RTHB 2GMJA 4JV1A 2VFVA 1FXLA 2NPIA 5L1LA 4LF8F 4WJBA 4G1QB 1NH8A 3LOUA 3PFOA 4MIAA 1HBOA 1T94A 3DGPA 5KT7A 1SBRA 1YITS 1R89A 1R43A 2ASYA 3I55S 3H98A 1BWEA 1FNOA 4OHYA 4KGMA 5KFXA 1HQEA 1OQ3A 1OS5A 2QA1A 3DRRA 3DYAB 3EPIA 4J9SA 2V8GA 4XPEA 1JXEA 2KO1A 3IBWA 3MEEA 1SH0A 2B43A 3T6BA 3VAMA 2FLNA 2P5VA 5IQ6A 4HT7A 2K7KA 5G4DA 1IXKA 2DK2A 3FEXB 3GFHA 4WKRA 5F9NA 2VFSA 4C11B 5C24B 3S8SA 5HROB 4J9LA 3CJKB 4DV7F 4Q0BA 3K7RA 3ZZ0A 4K4UA 1JLCB 2SXLA 2ZZNA 4C3MA 3OTBA 1X4CA 2OPSB 3DLGB 3U02A 3LPYA 3OUYA 2OO4A 2BA9A 3AHPA 4LT6A 3OUYB 2HWIA 1Y0HA 3FSYA 1TQLA 2JLEA 1FJGF 4M5DB 3N01A 1VQKS 1RT6A 2A2CA 4JYAF 2ZOFA 1HD0A 3T6JA 4C2MA 2X51A 2YNGA 2V9WA 1IKYA 4X4SA 4DV0F 4DFKA 3OSPA 1FA0A 2GO9A 1Q4RA 2RU3A 2JL9A 2YKQA 3CIZA 3W2VB 2HIQA 3U27A 3PW0A 4FYDA 2F9JA 4ED1A 4AYBD 2RRAA 4M5DA 5B09A 3PW4A 1NKEA 4LF6F 1UVLA 2Q66A 4K5RA 1U1RA 1E6YA 2HGMA 1GX6A 2CVEA 2RKIB 3AB4B 2OFHX 3HX9A 2IC3A 3QGPA 5THWA 5KFSA 2B4PA 1XTZA 1G2EA 1HA1A 4OX8A 2CJ9A 3KK2B 1HBOB 1LXNA 1GQEA 3I0RB 4G1QA 3CC7S 2MKCA 2V4JA 2VG5B 2YKAA 3QLHB 2DH8A 2ERRA 1AUDA 1UVJA 3NS5A 1LOUA 1N52B 4LQ3A 2Q79A 4O23A 1K1QA 2HMIB 4O3RA 3OL9A 3UCZP 4FXDA 2C28A 2NSBA 5EUHA 2X1GA 2EG1A 3MEEB 5AE3A 5IXUA 2ZD1A 1FNXH 4X64F 4DFJA 1SB6A 4PQUB 5J2QB 1HQEB 3DYAA 3TI0A 2C3YA 1NH7A 2JHEA 3EZUA 1QUPA 4QR2A 2ZJRQ 2MQMA 1GT8A 2KT2A 1RT3A 1QE1B 5KT6A 3FZ2A 1P27B 5HLFA 3TO8A 5DLGA 1S0VA 2J76E 1O51A 4PPZA 2VG6B 1VRUB 4YR2A 2BQUA 1RTHA 3OVSA 2R2UA 1DZ5A 4RNHA 3MECB 3KJVB 1S1TB 4USJC 4K4ZA 2M0GB 1ROFA 4OI1A 3HHLD 2AV5A 5K8OA 1S0NA 3RR8A 4MYTA 2FGOA 5DG7A 2FLOA 2VBWA 4MK7A 1T8EA 2M2BA 4R25A 4E0DA 1NU4A 2XMJA 4OI3A 3IFEA 1NK6A 5C25A 3V6KA 4I2PB 4NCBA 3LH2S 3R1LA 3RZAA 3UDCA 4B17A 4RUHA 2KXNB 2BJEA 2HHVA 4TY8A 1UEVA 2DD8S 3PO5A 2P9EA 2UV8A 1JLFA 2OFGX 2ZOMA 1XBWA 2VONA 2ZH9A 3KLFB 3LUYA 3DM2A 1TKDA 1G6BA 2HRUA 4XIUA 5F41A 2MZRA 3W2WA 2GQQA 3PV8A