2AP6A

X-ray crystal structure of protein atu4242 from agrobacterium tumefaciens. northeast strucutral genomics consortium target atr43.
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
104
structure length
104
Chain Sequence
MFYEIRTYRLKNGAIPAYLKVVEDEGIEIQKSHLGELVGYFFSEIGPINEIVHIWAFSSLDDRAERRARLMADPRWLSFLPKIRDLIEVAENKIMKPARFSPLM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein Atu4242
publication title Crystal structure of a Hypothetical protein Atu4242 from Agrobacterium tumefaciens (strain C58 / ATCC 3 NESG Target ATR43.
rcsb
source organism Agrobacterium tumefaciens str.
molecule tags Unknown function
total genus 26
structure length 104
sequence length 104
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2005-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07978 NIPSNAP NIPSNAP
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ap6A00
4A46A 2BUNA 2CRLA 3TNVA 4OJHA 1JK9B 4HI2A 2ZDOA 1QUPA 2N7YA 3GZ7A 1FE0A 2KYZA 4F67A 1Q53A 1X7VA 2FTRA 1U7LA 2BYCA 3E8OA 3HHLC 4YDXA 5T7LA 2ZDPA 4Y2KA 5B0BA 1CPZA 2OFHX 1OQ6A 5T7LB 1GXUA 2OFGX 2HLUA 5K9FA 2LDIA 3BB5A 5B0GA 3I9ZA 4NPOA 3HHLA 1TZ0A 2HLTA 2AP6A 2RMLA 2RU9A 4Y2MA 1SI9A 4DL0C 1CC7A 3HDSA 1VQYA 3MZIA 4OJ1A 1Y0HA 1FEEA 1S6OA 3UDCA 1YJVA 2RILA 4OIXA 5B09A 3LO3A 1YRXA 1N5QA 2ASYA 2BBEA 2ROGA 2W4DA 2XMUA 1TL4A 2K1RA 1GXTA 2QLWA 2VH7A 2XMVA 3HHLB 1RJJA 3IWXA 1YJUA 2LQ9A 3LGMA 1X8DA 3BN7A 3MCSA 2N4CA 3LGNA 4DN9A 4U9RA 1SB6A 2FHMA 3FRYA 3QGPA 3VTIA 3DCAA 1OPZA 4FNIA 1MWYA 1WD6A 2K1RB 2VV5A 5A6PA 1ULRA 1R6YA 2BJDA 2IYIA 4HH1A 2G9OA 1X0PA 2OMOA 1JWWA 3BR8A 2N4DA 3BDEA 1Q8BA 2HFNA 2FIUA 1FD8A 2XMTA 2OP5A 3CJKA 1V3ZA 5KAKA 2IYGA 1FVQA 2PD1A 1VQSA 3KG0A 2RSQA 3BGUA 3F44A 1TUVA 2XMKA 1FESA 2KT2A 2XMMA 3TRGA 2K7JA 5F0WA 3CJKB 2XMWA 5B08A 1FVSA 2GV1A 5B0FA 2ROPA 1N5VA 2OD4A 2IFXA 1KVIA 3FGVA 2QYCA 2LQBA 1TR0A 4OJGA 2FB0A 3T9NA 2K2PA 3HFKA 2HIQA 5B0CA 2GO8A 1Q4RA 2OAUA 1N5TA 1Q8LA 1YG0A 4HI1A 1K0VA 4HL9A 2GA7A 1Y3JA 1Y3KA 2GGPB 3FMBA 1P8GA 2OKQA 4Q2LA 2BJEA 4ZA1A 1N5SA 1TL5A 2KKHA 4A48A 1IUJA 3IWLA 2HFOA 4HH0A 4NL5A 1OSDA 4A47A 1OQ3A 5B0AA 4Y2IA 1KQKA 1LQ9A 3KG1A 2QLXA 5A6WA 1URRA 1CC8A 2JDJA 3BM7A 4Q2MA 2W4PA 1AW0A 2GFFA 3K7RA 1SQEA 3KKFA 1AFJA 2HQIA 2AJ1A 2OD6A 1YJTA 2XMJA 4DPOA 5B0DA 1AFIA 2GGPA 2L3MA 1APSA 3HX9A 3TOQA 4EFAC 1KVJA 2W4CA 3WDOA 1Y9OA 2PGCA 4QOTA 4FNHA 1P6TA 2EW9A 3QMQA 2K7KA 5B0EA 2GCFA 2QIFA 5F0UA 3KNGA 2KT3A 2Q3PA 1XBWA 3HHLD 1W2IA 1S6UA 2AW0A 1YJRA 4OJ3A 2ROEA 3DXSX 4A4JA 3BF4A 1MWZA 1FE4A 2LXFA 2AJ0A 5IXUA 3HF5A 4ZOSA 2ACYA 4YEAA
chains in the Genus database with same CATH superfamily
3M8SA 1U47A 2H5JB 4DV5F 1M5OC 1H7XA 1RAHB 1IM6A 4IFVA 1T9WA 2D74B 3M2VA 2U1AA 4Y2MA 4DL7A 3A8JA 3KOAA 2KM8B 2LVWA 2B9WA 3U02A 2PFFB 2R2TA 3I5AA 4UOCA 1RAAB 1RGVA 4Q0BB 3MECA 4ZITA 2DR7A 4F8RA 4L72B 3C3LA 5E3CA 3LGHA 1QUVA 1WG1A 2C3PA 2CNOB 2UP1A 3CULA 3EJMA 4DR3J 1PCAA 2YNGB 5KG0A 2R2RA 4DR2F 2Z8QA 5J2QB 2EFVA 1OMSA 4CO4A 2CQIA 1TKZB 3HFKA 1S9GB 2GO8A 1Q4RA 1NB7A 1HNXF 1TFWA 1HQEA 5KOWA 4DR2J 4KO0B 3R2DJ 4TU8A 3E51A 1X5TA 4ERDA 2EG2A 5HVGA 2CPJA 4X4PA 2W9BB 3PYFA 3TAPA 3QO9A 1O0PA 2V4JB 3U7JA 3PIPQ 3TJ8A 2N7CA 4DSEA 2EEYA 4QCLA 3HHLC 3SSRA 4MJKA 1RZMA 2BE7D 3MGJA 4KGZB 3PYDA 4F3MA 1RHUB 3KLEB 4P2MA 1UKUA 1SH0A 3KJVA 1HWUA 1T0TV 1N6QB 4FVCA 4MKVA 2CJYB 4PUOB 3SMZA 3JQMA 4N77A 5CD4H 2CQBA 1EETB 2YNFB 4OYXA 4QR1A 2MZSA 1RUSA 3ZNUA 3VR1A 1KDNA 1Q8LA 3O8WA 2HNDA 5D8HB 2GGPB 5IWAJ 2DYAA 4EUVA 1B3TA 2BKOA 3JYTB 2YX7A 3T1HJ 3TYTA 3VAMA 2KG0A 3AFGA 2JRSA 1YBUA 2W7AA 3AQPA 2WB4A 1C2PA 1GNKA 2C3UA 4KT0C 4DI6A 3SEOA 3G8SA 2ZBRA 2B4OA 2V2VA 4AUKA 1KOOA 3MAAA 4EYHB 4QIFA 4KGMA 4B9NA 4URGA 3BQ1A 1ROFA 3PKMA 3GILA 3UDLA 1R7IA 3T1YF 4MMOA 3D28A 5DM6Q 2IDLA 4UZBA 5DRKA 4FKXA 3W9HA 8AT1B 3IRXA 1BGXT 3SCLE 3QGPA 1RWPB 4FPIA 2LA6A 1GFWB 4LFBF 3M2UA 1EP4B 2OTJS 1TKTB 3GIJA 2P8IA 2HKEA 2VQEJ 1HIYA 3B4DA 4HHJA 3CJKB 2MQLA 5F8LA 1WEXA 3W9JA 2FVCA 2AGPA 3MFHA 3HJVA 2CAJA 3OT9A 3WC2A 2RF2B 2FJDB 2BW2A 2WBRA 2Z2YB 3IA0A 1IBLJ 3LP2A 1QM9A 1TL7A 4ANDA 1KQFB 4NLVA 3H40A 3MAQA 5BR8J 1A7GE 3RB3A 1C0TB 4X4NA 1WKJA 2ZNZA 2LQ5A 5F8NA 4CO1A 1X4AA 4DR4F 3GV5B 3HHLD 2O3DA 3QT8A 1X4GA 2HNZB 4GC7A 5T7LA 1U49A 4EEYA 1UZHA 5IZHA 2BACA 4X4TA 3DOMB 1FE0A 3DOLB 2VG5B 2ZBQA 5I3UB 3I82A 2W2QP 3H2LA 1I5OB 4DR4J 2UUBF 2BM1A 1TL4A 2RAQA 3PO5A 3OUYB 3I0SA 4UUWA 4U67Q 4JI3F 3QJPA 2G9OA 3LH2S 5KFJA 1B7YB 1WC0A 4H54A 2DHGA 1ZZFA 4CTAA 5CCLA 4NLUA 1YTYA 2WTFA 1X4DA 5HQ8A 4FYXB 5CYQB 4F0HA 3KLIA 1N5TA 4JI3J 5C42A 4ILRA 4ZPWR 2IM0A 3BZQA 5CYMB 2HMIA 3VZHA 4QYRA 5GAHI 2V94A 5CAAA 4WTYA 4ZVHA 3WC0A 5FD1A 1W2BR 5A2QY 4NCBA 2GZOA 3SFGA 2GS8A 4ZCMA 4X4SA 2MY8A 1U24A 3I9V9 3OVSA 2VOPA 1SH2A 1U7LA 4I69A 1Y0HA 4MK8A 1XR5A 3SBMA 2HQ3A 4AYBD 3Q89A 3MD1A 2OELA 1VQ8S 4OYAA 1ZZNA 1VR6A 3U1MA 2RQMA 1VQSA 2JVOA 2ZJRQ 4H4KA 5C25B 3W5YA 1UW9A 4IQMA 3KLFB 3I31A 1U2CA 2HVZA 4ZK7M 1QD1A 4KKOA 4DOZA 3PRBA 4F25A 2RRNA 2BVZA 2ERRA 5C7PA 2AYBA 1TKXB 3M30A 3D4JA 2GIRA 4FNHA 4HHUA 2QX0A 3MEEA 2EW9A 1HNWJ 3CMQA 4XO0A 1FT8A 1YBTA 3LPEA 2A18A 1BQNB 4PABA 2EK1A 2VQFJ 2RDIA 2MSTA 1U26A 3FKBA 4DPUA 1RADB 1RTIA 4RU2A 2WONB 3Q2TC 9ATCB 2QA4G 4QR0A 1JLGB 4YOEA 2WVBA 2D7SA 4O0IA 2GQQA 5F3ZA 1MWYA 1FERA 3KHHA 3MTJA 3OFGA 3DU6A 2DNKA 3FCWA 3SQGA 4YP3A 2WVFA 3BGUA 2FVQA 4O3NA 1HPZB 4FYWB 4FZVA 3BSCA 1RWVB 4JI7J 3J7A1 3HD1A 2XY6A 4BLGA 3JSMB 1YG0A 4FF2A 3G87A 3VZIA 4W98A 2B3TB 5T41A 1N0VC 4J9NA 4ZPCA 1C4AA 1SC1B 4B9SA 4UUXA 3WIVA 2ZNYA 1RWXB 4MYTA 2M70A 3BO3A 3B4MA 3VF0B 1RT4B 1SKUB 4PPDA 4WTOB 3TAQA 1N33F 4RBVA 1JX4A 2KT3A 1RE1B 3HXMA 4DPXA 1BWVA 2HAIA 3OSPA 4UZCA 1NH7A 4DSLA 3DMJB 3I96A 4F4XA 1C4CA 1YZ6A 2LKZA 1H7WA 3C6TB 4DL0C 3OR2B 1UVLA 3G6ES 2W4DA 1CJKA 3GFYA 4MT1A 3HT0A 3C2PA 2UUTA 2CQDA 3PTWA 2RKIA 5D6GA 2FVRA 4RNHA 4WBFA 4OZNA 3HK2A 2VFRA 2G2OA 4I6WA 3EGZA 4USJC 1O51A 1JNZB 4OJGA 4B3RJ 2FVPA 1JLEA 4NA3A 1WC1A 1KONA 1Y3KA 2AGOA 3JTPA 4GMKA 2KO1A 3L9ZA 1VBXA 4TYBA 4KH0B 4OX8A 5HLFB 2WVEA 3TAMA 4K50A 2P9GA 4JB8B 3U27A 4WFYA 4PPZA 4FKYA 4F7VA 2EBGA 1HKAA 1FK9B 3M6XA 1NJYA 4N41A 2C2DA 4B3SJ 1FNMA 3BF4A 1ZETA 1XR6A 2MZRA 2C2RA 5C5JA 2GVZA 3Q8RB 2QSFA 4K2XA 3UN3A 4F4KA 2NREA 3C6UB 3AODA 4B3OB 3RB6A 3VAHA 1RLDA 1LWEB 5EN1A 3C46A 2BOAA 4M5HA 4DFPA 4ZDNA 4JYAJ 3W66A 3V2UC 2JX2A 2KM8C 1UJ4A 4KHRA 3IR7B 5DQHA 1QJHA 2NXUA 3SV3A 2MQOA 1BD6A 2J9DA 4LR9A 3MXHP 4DR1J 5LSOA 1REGX 3H2UB 3DLLQ 5GVQA 4TKTA 4ED8A 4PWDB 5E3RA 3D5MA 4C8NA 1JLQB 4WFNQ 4DV1J 3GP9A 4NCAA 2QA4S 3FGVA 4NYPA 3Q8PB 4NCGB 5K14A 3PX4A 4O3SA 3FUYA 1GX6A 3G96A 1XMQJ 3VVTA 2HQFA 5D0RA 2UVRA 1S57A 1KQKA 4ZN3A 1RT1A 4JI1F 1IBCB 2ZH4A 3Q8QB 2RE1A 1TK5A 2DH9A 4LFCF 3H5SA 4RNFA 1T11A 1QSYA 2ZZTA 2M9KA 2ASLA 3OHBA 2RDJA 3RBZA 2KTQA 4ITSA 1H0HB 1HNZF 1LW2B 2BABA 1M90T 3QT7A 4Z37A 2MZ1A 3KLHB 2VG7A 4M5JA 4P74A 1IKXB 2APOA 1YJVA 1UL3A 1M1KT 2V69A 5F41A 3CC2S 1M0SA 1YJNS 5IT0A 2UXDJ 3GLJA 1BQMB 2HEKA 4ICLA 4FXVA 2BKPA 5G0RB 5DDRC 2X51A 2ZHBA 3O6QA 1QE1B 1T03B 2JFKA 3A13A 1WF1A 1AUSL 4F2SA 1RAJA 3ZZOA 2YKPA 5ETKA 1R8CA 3DC2A 1EQMA 4AE5A 3N28A 2F4VJ 5CYJA 1ZTTA 2UXBJ 1AFJA 2MKSA 4WK1A 4RLEA 2A3JA 4MYUA 3N5BA 4EZ6A 5KOXA 2ZEJA 1S0NA 3FZ2A 3HHDA 4AL5A 1FWKA 4CH0S 1U02A 1K47A 3W60A 1DTQB 4PQUB 1P27B 4P52A 1T9UA 5EWEA 3N0VA 4LF1A 3RJMB 1Q0NA 1WEZA 2XLKA 5DO2A 1U6ZA 2IPOB 2EK6A 1U2FA 5GMDA 4R5PB 3DRPA 1B4SA 1GAOA 1U1RA 1S59A 4O0NA 2FVSA 2IIHA 4YDDB 1KTVA 3AH6A 2KJVA 2PEBA 3SDEB 2ZH7A 4LSZB 2NZCA 3GONA 3N6NA 2B9EA 1CULB 2R7SA 4KY3A 1X9MA 4HH0A 2RQCA 5KT7A 2NUUG 2BJ8A 1LK7A 4JV0A 5DGAA 4DBQA 5A8KA 2GO9A 1OSCA 1IBKF 1TQLA 2BDPA 1UP1A 4IOBA 3HULA 2P9EA 3FQLA 3M9NB 3HO1A 1FRXA 4NI2A 1FRIA 1TKDA 3FEXB 3EGNA 2KRRA 3C15B 1PBAA 2ZWPA 4CLFA 3IS9A 1UVKA 3H7HB 5LMNJ 4N7TA 1JMTA 1DLOB 4K2JA 5F3TA 2WZ1A 5A0YA 2D9PA 4AXIA 1IR2A 1FEHA 2XWXA 3F44A 2MKHA 3F0NA 3ET6A 4OZJA 4DUZJ 3H42A 2LU1A 1SKSA 2VC1A 1O5JA 3D9BA 4V19X 1JLCA 1U1QA 2IA6A 3AT1B 1Y3JA 3F73A 3D3CJ 2KXFA 1S6QA 5IT9Y 4IUFA 4KGVB 3M8PB 4LRDA 7FDRA 3GR1A 1T9TA 2IJRA 2OUGA 3W65A 2NPIA 2XYGB 3FSIA 1DURA 1F5CA 3LA0A 4XK8C 1S1VA 2X1FA 5DZ6A 2H1YA 2ROEA 1FE4A 4ELTA 2FUG9 3NEKA 3BBCA 3D7SB 4RUCA 4OJHA 4DCOB 1T02A 3D1QA 1HW8A 2NYIA 2B9YA 3HDSA 1RB0A 4S0MA 3J7YI 2GQCA 1Q8KA 1QAXA 1K1SA 2CQ3A 3PEJA 2OSRA 3IGVA 5EHHA 1XN9A 4NZ7A 4XPCA 2WCXA 3OSNA 3DRRB 1J5EF 4Q7AA 3GCWP 3G9CA 3H98A 4Q8FA 2I5JA 2DCLA 2DH7A 5E3AA 2VPWB 2ACMA 2VHGA 5F8JA 3OQ2A 2XG8A 4DV2J 1XNQF 1RT7B 4ZVOB 4L73A 1O6XA 3CDAA 5DLFA 2MKYA 1N88A 4PG6A 2ZHOA 2PDAA 1FRJA 1F2GA 2CQ1A 2ZH1A 1K0TA 4IG0A 1XQIA 3CW2C 1N4LA 4DV4J 2ZHAA 4C11B 2W9CB 3RAXA 1YIJS 2NZ4A 2ROGA 3QLHB 3LP1A 1RHKB 2VG6A 3MUTP 1GQEA 2E1PA 4RW4B 4CYUB 3P5BP 4DV6F 4DSIA 1F9HA 4NOHA 4OZ3A 4OZ0A 5KFNA 1AA1B 1FESA 2HZAA 3I87A 3V81A 3X1LB 1F9FA 5DS7A 1YI2S 3DYAB 2QFJA 1FI4A 2OJ3A 2GVDB 1OSDA 2UU9J 3DRSA 1AW0A 1KSPA 1RT6B 1S1TA 2QZ8A 4X62J 3V6DB 4YR0A 3CCSS 3TEGA 2IRXA 4QIGA 3OTEA 4DQPA 4DUYF 4DN0A 1JJ2R 2V2KA 5KFBA 3GTYX 2W1BA 2HYIB 4F26A 3CUNA 1SC6A 5J1EA 1C1BA 4QPTA 4ZKAA 3KTQA 4KAIA 1SJ3P 1WTBA 1HHTP 3LP0B 2IBOA 4CLZA 2L9WA 4PYAA 3JSYA 2KDOA 1SL1A 4M5DA 3LWLA 1N32F 1WI8A 4ZPDA 2AJ2A 1IKYA 2J7UA 2RH3A 2W7OA 1UVJA 3PV8A 5M2PA 5K5MA 5DJBA 1IKVB 4K4TA 4MAKA 1NDCA 4M5MA 3DOKA 5JXSA 5L38A 4X66J 5HQMA 1DY3A 1BMQB 2CNKB 4WU2A 4CP5A 1C1CA 3W1YC 2QMXA 1DTTB 3R1LA 1VQ9S 2WOMB 3C14B 4NXNJ 1PC4A 2G13A 4PCQA 3HF5A 3MMCB 3LW5C 5DDOC 4DR6F 2JOQA 4AT1B 4MIBA 5AT1B 4IOCQ 2M3DA 2MMYA 4YDXA 1HYSB 2E9ZA 3BB5A 5IS2A 2E5IA 1U1MA 4ZCIA 3R6GB 4LBHA 2M5YA 1NK5A 4CO3A 5GMEA 2YXLA 1VQ6S 3QRRA 2JVRA 1I94J 2CQ0A 1RTZA 2UVWA 5DETA 2YNGA 1LFWA 2KXHA 1Y7PA 5J2QA 2OPRA 1TKZA 2C2ZB 1NSAA 1YK9A 1S9GA 4WXOA 3KJFB 2B7BB 3AY0A 2QYCA 2CWXA 1RP5A 5L1LA 3IMQJ 2DD8S 3L09A 3TZYA 2HVHA 3R5DA 5CHCB 4HL9A 4KFBB 2XZDB 4K8RA 1QAYA 3TI0A 5A6WA 2DHSA 3IO1A 5KFMA 2CQ2A 2W9BA 2XB2D 3A8IA 1PJ7A 2V4JA 2B8QA 3R5GA 3KNGA 3HT3A 1N34F 2DXEA 1WWHA 4OYBA 3G82B 1YSJA 5LM7E 2XZWA 5KFKA 3ZZYA 1RDRA 4WIQA 3KLEA 4ED4A 4ZP8A 2CQGA 1RA6A 3M2UB 1U25A 4DV7F 4IQXA 2FJBB 1IM4A 4RW7B 2LXUA 1N6QA 3DRXA 2VBYA 4PUOA 3D2WA 1RU1A 1H38A 4URSA 2MGZB 3NNAA 1EETA 2YNFA 1WDTA 2I8EA 2ZM6J 1VOMA 4I6YA 1FVSA 2MHNA 2JEGA 3OTDA 4NMLA 4LF4J 2O67A 1XMOJ 3KK2B 3GFHA 4HI1A 5E33A 2F40A 2RS2A 2F63A 2HFVA 3IR6B 4HACB 1Y00A 3K89A 4Y2IA 1FXRA 2QLXA 1OY8A 4H4MB 3KHLA 3HVRA 4TLRA 3R1HA 1NUEA 1Q8IA 2BW7A 4X84A 3TVZA 3CD6S 4JI8F 4RJVA 4X4OA 1U45A 4ED6A 2BQ3A 3HM9A 4CLLA 1DARA 4GO7X 2YY3A 4X4VA 1S7IA 2QLWA 5KFUA 1Z2ZA 3W5ZA 4CTAB 1IR0A 3ZXWA 1EP4A 1TKTA 3PR5B 4PR6A 3ZTSA 2RQKA 3NS5A 3NBPB 4ECRA 4M5LA 3KNAA 3CJKA 2OP5A 1OJ4A 3B8HA 1WJ9A 1NK8A 1TUVA 2EG1A 4HDGA 4CQ1A 1X0FA 4QIVA 2D3O1 2RF2A 2HMIB 4ZN1A 2DPIA 2EVZA 2FJAB 3D6FB 3EZOA 1VYAA 2ZUAA 4KQZA 4ECWA 4DSKA 4C8KA 4ZA1A 2VA3A 1X9WA 4NZ0A 1TUWA 1C0TA 3OTOJ 4DFMA 1NK7A 3CC4S 4ILLA 3KKFA 1X5OA 3GIRA 5E2QA 4BCAA 2W4CA 5EX3A 2BM0A 2PGCA 3TQEA 2Q43A 2RIJA 3DKDA 4JI0J 3DOMA 1RA7A 3DOLA 1NM2A 3UO0A 5I3UA 5B0DA 3KUEA 2ZVSA 1XNRF 5KFPA 3NXZA 3UI3A 3HP6A 1VC0A 3QT5A 4U6PA 3OUYA 4DZ6A 3NG8A 2J76E 2XHWA 2KVQE 3S7RA 2DJWA 4C3MA 4JBCA 4F0MA 2VV5A 3B6BA 2GJ2A 1BC6A 1HBUA 4BWJA 4Q43A 3JXOA 4HT7A 5CYQA 4LJMA 3I32A 5BYQA 1MNEA 4DS5A 1KP6A 2OIHA 3MCOA 2XM3A 3W8GA 2V34A 4QQBA 4TXSA 5CYMA 3SSSA 3MR3A 3MEEB 4OYWA 2DTJA 5AJ3F 4XTTA 4CLKA 5L1KA 2UXCJ 1GEHA 2DIUA 4G1QB 2CIMA 4DG1B 1B7FA 5L8RC 1RTJB 5GAEU 2HVDA 4Y34A 3M6WA 1YJ9S 2I1RA 5HBMB 2IAJB 3ENVA 2AIRB 2VJUA 1XK8A 3QBCA 3G8TA 1Q53A 1X7VA 3NCPA 3OLBA 3EGVA 1CSJA 4DEZA 4FP9A 3PHEA 2OPSB 1FWPA 3L7UA 5AE2A 5JVHQ 2DHAA 4KIAA 1GH8A 3I6PA 3WHIA 5F8MA 3SV4A 5DQIA 4DV0F 1X4HA 2D1CA 2JFDA 2RQ4A 2LXIA 3QJLA 2FC9A 4QJVA 4HTIA 5C25A 4U95A 5ETVA 3KLFA 2E5GA 3THTA 5AE1A 4Y00A 5EDWA 2QC3A 3O2IA 2I9SA 3J80Y 1V3SA 5B0CA 2HPUA 2QA2A 8RUCA 2CG4A 4V19J 3FMBA 2IVMA 4I2PB 4WU3A 2VFUA 1TKXA 2VONA 4ZIWA 3J7ZT 2FJEB 1FKPB 4NLWA 2DR9A 1H6KX 2V9WA 5LXYA 1WF2A 2M7SA 3NKYA 3TUIC 2VKZG 1TK0A 4P7VA 1HD1A 2B6AA 1S6PB 4J9RA 3MPVA 4QWCA 1SUQB 2N82B 5KFAA 3KFWX 2WONA 2ZDPA 5B0GA 3G86A 5KT4A 2AQ4A 1JLGA 1S72S 5KFTA 2XMVA 2CYYA 4YHHJ 3K8VA 3R6LB 1IWGA 1SB6A 2YWHA 1WG4A 2CPDA 4RWWA 1HPZA 1EX8A 4CLUA 4TU9A 3JSMA 5JVGQ 3B54A 3CT9A 3QPIA 3KDOA 3GWCA 4EU0A 5CA5A 2HS4A 5K8OA 3QZ7A 2XC9A 1YZ7A 2HHHJ 3LTOA 1ZA1B 2DR8A 1K73T 2DEIA 2DPJA 1NZAA 4EBDA 4NXMF 2HIYA 3T5KA 2ZZNA 1KR4A 4LFAJ 4B9TA 2GVZB 2HK3A 4N5SA 2Q66A 5B0EA 4QWDA 1VISA 5ETNA 2J6UA 3DMJA 3GIIA 2HS3A 2BUNA 3GQCA 1WSVA 1CS4B 4NWBA 4WP8A 4GKJF 3C6TA 1FDAA 3OR2A 4J9KA 4GVLA 3H25A 2DNPA 1B99A 3KK3B 4KB7A 4CWBA 2F9DA 4FN5A 4ZPTR 4TLQA 1SCJB 4OX9J 3S6EA 3IBFB 4KGXB 1G6BA 2KL8A 4ZVSB 4W90B 2BRKA 5KAKA 3GB0A 5K14B 4J7CA 3VVUA 3H5UA 4AQYJ 3GJTB 5F9NA 4DX8H 3QGGA 1RWWB 5LL6d 3PYGA 1GTHA 2BJEA 5HLFA 5IV3A 1CC8A 1RHQB 3NGUA 2L08A 1FK9A 2H5IB 3TZZA 1HLWA 4KBIA 4F50A 1QAIA 1PC5A 1IBMJ 3IGNA 5F8GA 3KJQB 1RT5A 1L3TA 4CNZA 5FLXY 1Q16B 1URNA 3C6UA 4B3OA 4Y2CA 2J6SA 4ED0A 4IKAA 3AXMA 1EARA 3V6HA 2WW4A 2IY5B 3GG1A 3NCQA 1X4BA 3H90A 1RQ0A 1CC7A 2RS8A 2QJ3A 2JLGA 5C2GA 2BMBA 3L7OA 3PY8A 2XO6A 2QO3A 3CE8A 4WP9A 2HRYA 2HBQB 3P8BB 4PWDA 1JLQA 4N56A 2IVYA 3EZ5A 4NCGA 4ZCKA 1NKBA 1DFDA 4X65F 4WZQA 1NHKL 4DF8A 1GMWA 5B7WA 2EFOA 2XLJA 2GHPA 3CCJS 2MQNA 2XLIA 2DXFA 2HFOA 2PMHA 5IT4A 3M32A 3GV8B 5HVHA 1AFIA 3NAIA 3PW4A 2AYMA 3DN9A 3LALA 3UPFA 2CG8A 3R5CA 1HR0J 3S01A 4OMFG 2BRLA 1KNZA 2ALYB 1LW2A 2KFYA 2JC0A 4A8MP 1OIAA 3DHWC 3E8OA 1IKXA 4OI4A 2VIHA 1F5AA 1DBDA 1SI9A 2C3MA 2IM1A 3O3LA 4F4AA 3NGSA 1BQMA 2RU3A 5G0RA 4O4RA 2B7CB 1HA1A 1NHVA 2BOPA 4HYKA 1QE1A 1T03A 3ISNC 2GHWA 2AYEA 2R8HA 3IAM9 2DGUA 2KT2A 1PO6A 4USHA 3IG1A 2NQPA 3D0HE 3RBDA 5EWFA 4A8XA 1HI0P 2C2KB 3PRDA 2KN4A 1UMJA 3MCMA 1SQFA 2BZ2A 5LOQA 3WDOA 2MB0B 4KC5A 1QAJA 3D0GE 2XYHB 4M63A 4P72A 2HZVA 2VF3A 1DTQA 4PQUA 1L3KA 1V9OA 1DQ9A 1C0UB 3DM2B 1W26A 1JIHA 3NAHA 3UW1A 2HLUA 1TFYA 2ZKTA 1S1UB 1Z4UA 4QR2A 3JAMU 3CWJA 4R5PA 3QIPB 1SKRA 1YDLA 2Z0GA 2FLPA 2LFVA 1H73A 4NEYA 2OMLA 1F1BB 2K1RB 4ZLLA 4GO5X 3BR8A 3BREA 3TQ1A 1FD8A 4JI5J 1L3UA 1TTHB 2I2YA 3MPDA 3SDEA 4JI4J 1J27A 1WOSA 1H2TZ 2R7WA 5LMUJ 3DLEB 4OYZA 3GV7B 1CULA 1S10A 3KHRA 3MD3A 3T6BA 1N36F 2POKA 4K4WA 2G4BA 2R2SA 1LFPA 3PZPA 2DITA 4LF9J 4LIRA 2MKKA 2DR5A 5KFDA 4QIEA 1UFWA 4IFYB 4NLPA 1HQ2A 3PG9A 2ZFHA 1J5OA 4I2QA 1KRPA 4IH7A 3H2VE 5KFIA 4Q44A 3NOGA 4F3QA 4YB7A 3W7BA 4ELUA 2MSSA 4XPEA 3C15A 2WSEC 4C8YA 4J37A 2IVFB 3U1NA 3TA1A 1S0OA 4EGLA 3RW7A 2GHVC 3NGRA 4DR5J 4OI0A 4LR8A 5ETSA 1L5UA 1DLOA 3ISND 4B3MJ 5JJBA 1YRXA 3ETMA 5BYSA 3H8YA 3BEGB 4DSJA 4TY9A 4QBUA 3LANA 2MQ8A 3BGRA 1HD0A 5J2PB 2ZC3A 1HWIA 2GX8A 2G1DA 2NSBA 4B02A 2J9DE 5D4PA 3UD5A 1YKWA 2HAFA 3M9OB 2KI2A 4QYZK 2QMWA 3UR0A 3NGDA 1CBKA 3PACA 2DRAA 2OH2A 4RUAA 2DR6A 2LECA 1LOUA 2VZ9A 5CABA 4I7FB 2DNLA 2L9DA 2XZTB 4RW6B 3P49B 3NS7B 1M5HA 4W92B 1P1LA 2Q79A 3MUMP 2NXCA 4DFKA 1QVGR 4K4UA 3Q24A 3EPIA 4GKKJ 4OIXA 4MIWA 1F2HA 1RJJA 2AJFE 2DBBA 4ES1A 1OPZA 3RRGA 5HVFA 3DRRA 3PM9A 5GADI 3M9MB 2J8AA 4PYDA 3BH7B 2MPUA 1VC5A 1U0HB 3I4HX 5M2RA 2AWZA 2R2UA 1AT1B 3DRSB 4QWEA 3CJ4A 1ZM2A 2FY8A 3QSYB 2XI3A 1UA1A 2YWEA 4Q2LA 4DPTA 4V1Ak 1V5IB 1RT7A 3EXCX 4PXCA 4B08A 4ALZA 2ZH2A 4ED3A 1Q86T 4Y2AA 1OYDA 4P2FA 2CZVC 1RAFB 2Z2LA 1S5ZA 3J7Z5 1C1BB 1YITS 1PKUA 2VBWA 5L1IA 2Y1RI 1DZ5A 4C11A 2W9CA 5K8MA 1X60A 4MFBB 1EIYB 1KC8T 1R31A 3IAS9 2RU9A 4RW4A 4CYUA 3UDCA 1HNVB 4USWA 3CJ5A 3EX7B 1R0AB 1HHQA 1YRTA 2G2YA 4FS2A 3P45B 2MZQA 1T95A 1E6YB 1UETA 4IH5A 5JUMA 4C0OC 2YKNA 2FZGB 5IV4A 4ECTA 3ZTOA 3GJQB 2BXJA 3OVAA 3TRGA 3QZ8A 2F5GA 4OHZA 1U6BA 2XYPB 1BWEA 3DYAA 3QFWA 3BGFA 1D09B 2GVDA 2NXNA 1VGYA 2GW8A 3ZTPA 3L95X 4EO8A 2DNHA 3GFXA 3PO4A 5IFMA 2AV5A 1C1CB 2ATLA 1RT6A 3EZUA 2NXEA 2H65B 2YNIB 3V6DA 4NLGA 1RLCL 1W7WA 1S9EB 4C2MA 1IXKA 1FTCA 2ZE2B 5D4OA 4DR3F 1NKEA 4WK3A 4EBEA 3PX0A 3TANA 4B9LA 4JI6J 3EGWB 3MWBA 4B3TJ 3DNCA 3LP0A 5E5NA 3QATA 1HMVA 5K9FA 4CLSA 4J91A 4XDDA 3FDSA 4N8OA 3M7VA 5ETMA 2R7XA 3M8QA 1F3FA 3HPOA 2OPRB 3RGIA 3MCSA 1TVRA 2YQ1A 3BPSP 1NKCA 1FRMA 4UY8T 4KH1B 2PI4A 2B9XA 4M94A 4KE5A 4OI1A 1RISA 1IKVA 2P5VA 1FKOB 2XMAA 4Y3CA 3PEHA 2CJXB 5H1SV 3TZXA 4WKRA 1YJWS 3CJSA 4NA1A 2XHCA 1N5SA 1XWLA 1FFGB 2ZOFA 2HHWA 3NY0A 1DTTA 2GFFA 4LQ3A 2WOMA 1N54B 3C14A 3DLKA 1Y9OA 1RWOB 3EUNA 1N8RT 3MMCA 3VQSA 3SCKE 2K06A 5I3PA 4YS2A 1S99A 2XGPA 1TV6B 1HYSA 2GMLA 1BLUA 2E5LJ 3R27A 1KQGB 4RUBA 1QUPA 2V9KA 5IWAF 3KLVA 2VDHA 3T1HF 1TZ0A 3PW0A 2UUAJ 1KN6A 4OX6A 4DN9A 2ZJPQ 4I64A 2E7VA 2IYIA 5HQLA 3CTRA 5IM0A 4DLEA 3M1VB 4C48A 3DGVA 4YY3J 2XMKA 4JV1A 1WC5A 3SI8A 1XTZA 2DGVA 3BJYA 3MM5B 4KFBA 1XEZA 1F6TA 4YB6A 3OVBA 2BX6A 2OKQA 3OFHA 2PT0A 2CVEA 5HATA 3MAHA 3QWUA 1PG5B 2V8DA 2DGWA 5ETTA 2XMJA 1VRUB 1S77D 1QTNB 5I42B 3MM9B 1NJZA 2VQEF 2Z4PA 3G82A 1RCOB 2ZBCA 3BS9A 4USUA 2GMJA 2L9NA 1V6HA 1HARA 2AJ0A 2LEAA 5I4MA 3W9IA 3CIZA 2EXUA 2N7YA 2D3ZA 3DLGB 2BV3A 4ANCA 1SV5B 1OWXA 1IBLF 4RW7A 4C6AA 4OJ3A 5BR8F 3PCOB 5J2NB 1KLMB 1EB0A 3FSXA 4QYZJ 1ACMB 2LQ8A 4Q5VA 2MGZA 4FNIA 2JEJA 1SH3A 3KUGA 3O1LA 4L3NA 1Q5YA 2VKRA 2FIUA 3TX0A 3K5LA 3OJUA 3KG0A 2J0WA 3A1YG 2F9JA 2HWIA 1Q5VA 5CZVA 2XO7A 2PC6A 2E66A 3PX6A 3AD8C 1R8PA 3KK2A 3TP2A 4ECYA 4TNOA 4FVMA 2ZH8A 1RWNB 1LEOA 1NSKL 3DLJA 4C4WA 4LREA 4X4RA 4HACA 1IWAA 1UVIA 3PJ9A 1A6LA 1XJWB 1VK3A 4H4MA 3OTCA 4A48A 1RI7A 5BJRA 5B0AA 3W63A 1FX2A 3FBBA 1WDDA 3PW5A 4ATNA 3MFIA 4CRJA 4KPYA 2ALZA 4DL2A 2XTJP 4OYIA 3IRWP 4A46A 4BDPA 1RWKB 3HHKA 2Z2MA 5KG4A 3JAMY 2R4FA 1T9YA 4ZIVA 3BKUA 4ZVGA 4LRCA 2IMWP 1AYEA 3Q2SC 4CM0A 1N5QA 1VRTB 1U09A 3TUZC 3AHPA 2UUCJ 2Z30B 3NBPA 1HBUB 2V8VA 4ER8A 1NO8A 2XY5A 4QU7A 4L6V3 4UQGA 1FX4A 2XS2A 1TMMA 3HMJG 2L48A 4LBPA 3G6XA 1OPIA 2ZKUA 2QL9B 1V5VA 2QG9B 3SCIE 1N5YB 2CJQA 1E6VB 1NJIT 3J81j 4XDCA 5FJ4A 4IDKB 3GE9A 5IT9U 2A1BA 2FB0A 4BS2A 2H5EA 3QT6A 3ADAC 1J2VA 1NJXA 3GJRB 3CVKA 1T05B 4M5IA 2HQDA 2FDNA 3CEDA 1KS2A 4QWAA 3THVA 4ILMA 4F04B 3G2XA 4TQSA 3V4IA 4FXDA 3B78A 3K0JA 1PIEA 2MYFA 3N6MA 3VHQA 2BE2B 3VAIA 3H4DA 3IN5A 1U1NA 3ZZZA 2DNMA 5GAHU 2BYCA 1VBKA 3FFIB 3TX8A 2KH9A 2B51A 3EVOA 4LR7A 5KFWA 3HHLB 3PNIA 3T5JA 2QRRA 2JC1A 3QAUA 2RUGA 2KU7A 3DCAA 4LF7J 4CLTA 1JLFA 3T6JA 1HNWF 4YR3A 2CFXA 2DNYA 3Q8SB 1IVZA 2DHHA 2VQFF 4IRDA 4U7UK 2PIIA 1LNQA 3QAEA 2KFNA 2QA1A 2JZ5A 5A8WB 2W7PA 4KHPJ 3CSKA 3M6VA 3RZAA 1U8WA 4QIWD 1K1QA 3MHYA 3UN2A 3MEKA 4ZHRB 3L4BC 3BM7A 4G1QA 4DG1A 4E2FB 1FJGJ 3N4WA 1FA0A 2B6AB 1KVKA 1RTJA 4ED2A 1R0CB 3G71S 4DV3J 2KB2A 3EM1A 5HBMA 1X9SA 1JXVA 2IAJA 4D3HA 2HGMA 5IC4B 4JI7F 5D0EA 2ZH3A 3EVMA 2VDIA 1RT2B 4A8WA 1D9AA 2YQ3A 4DPYA 1LWXA 2VBZA 4CLWA 3CF5Q 3VGTA 1NB2A 2OPSA 3LF0A 4LF5J 1KQSR 4ZVFA 3T9ZA 5KFLA 4URQU 5B09A 2GC8A 2Q6BA 4K5RA 5KFXA 2RRBA 3JQKA 1OS5A 4CO2A 3FBCA 4R0EA 4F3OA 5GAGI 4OL8A 2AEFA 3HZGA 1AXQA 5SUHA 3CDEA 2OHDA 4KGKA 3HSJA 3ENWA 2YPYA 4CH1A 1X4CA 3AD9C 2K2PA 2CQCA 4OI2A 4B17A 4I2PA 4K0KJ 1F5BA 5A8RB 1FKPA 3CPWR 3VAGA 1VC6A 2OGUA 5F9LA 2QYGA 3D6HB 2YKOA 1S6PA 4CCHA 3RYLA 2AW0A 2DNOA 3BKFA 1SUQA 5IXUA 2ACYA 2ILYA 4B3RF 3M8YA 4F67A 2CPFA 1IKWB 1VQNS 4AL7A 2W2PP 3RRHA 2AP6A 1SL0A 4RW9B 1G2EA 1KEKA 2E7XA 6FD1A 2CJBA 3A8KA 3IWXA 2MLXA 3GIKA 3LGNA 2NR0A 2QTWA 1Q81T 1HW9A 3KK1B 4IR9A 4B3SF 5KT5A 4IH6A 2CPYA 2PD1A 3OR1B 2RVJA 3R5JB 1JLBA 1NZ8A 4MIAA 4XIUA 3TEHB 2C2MB 4LRBA 3PJXA 3HJFA 1A0OB 1UJ5A 1KD1T 3MOJB 4LSLB 4YB1P 1MU2B 3UR3C 5L46A 1K44A 3AOCA 3IWLA 4NL5A 4JYAF 3IM9A 3W8PA 3AJ2A 2O01C 1KFSA 1RT5B 3PFOA 4DDFA 4RNNA 3MM8B 2J8SA 3H5YA 1T8EA 4NLXA 3QGIA 4DR1F 3W2WB 4I67A 3LAKA 1CS4A 3EXYA 3TJAA 4DV1F 3BO2A 3HVTB 3OFFA 3KK3A 1JKHB 4Y2KA 1GXLA 4WJBA 4QZVB 1XMQF 2ZOGA 4OYMA 4DQIA 5D0GA 4LRFA 2ASYA 2VH7A 2F3JA 2F8EX 4RBTA 2E7WA 2NS1B 4UT4A 4I0WA 3M05A 2DO0A 2IYGA 2VBXA 5MAOA 5B08A 4P73A 2ROPA 2YQ0A 4PG5A 4UY85 3HHEA 1ITPA 1F9EB 4ZVQB 3M32B 2XS7A 1IQZA 3H0PA 1FXDA 2LP4A 2YKAA 4DFJA 4J5OA 2UXDF 3RB4A 2CPIA 5IC6B 3BV8A 4DPOA 2YH0A 4J90A 1M5KC 2RRAA 4OX7A 2DY9A 2LEBA 4LF8J 1JNRB 1NK9A 4C8MA 3IM8A 2ZJQQ 4YEAA 1VQOS 1R8BA 2UZAA 1FO1A 3ZTRA 4LF6J 3C16A 6FDRA 1NPRA 3SYZA 2FYXA 2Q6CA 2F4VF 2BQUA 3OXGA 4Z7YA 2UXBF 5IQ6A 1SPBP 2FHJA 1RAGB 3IG1B 3V4MA 2QLBB 1A9NB 3VAKA 1FVQA 1FFWB 4YN3B 1NDKA 4G1IA 3PRVA 2QLJB 4IYQA 4X64J 2IC3B 1VK8A 4FF1A 2BJ9A 3KG4A 2W2MP 1Z1ZA 2XBPA 3T1AA 1MROA 4WZMA 1Q7LB 2R8JA 2FJWA 2Q1LA 1IUJA 1XMBA 3RU0A 2D3UA 4A8SA 2E1RA 4PXBA 1U0SA 4JV5J 4ELVA 2B4VA 1ZA2B 2OD6A 2XGQA 4KV8B 4TY8B 4QOTA 2DO4A 2QIFA 1WEYA 3UWTA 2E44A 3LOUA 2XCPA 3KMSA 3THPA 3UCZP 3RR8A 4ZVPB 1JXLA 1YGYA 5AXNA 4HKQA 1QSSA 1CPZA 2OFHX 3L7PA 2VOOA 1R89A 5JMNA 1ZYQA 4N47A 3GPAA 2ASJA 1R3NA 3GJSB 4O4GB 4DQQA 1L3SA 1LWCA 1VQPS 1MG7A 2OPPB 4U7UD 3IC1A 2MQPA 2R7OA 2HHSA 2F1FA 3I0RA 1KTQA 4ZMMA 4PKDB 1PGZA 4DCPB 4C0HA 2XCAA 4JI2J 3OD2A 3GG0A 4UTGA 2ZD1B 4A8KA 3KLGA 3EICA 2KT5A 4A8QA 1VI7A 1XC9A 2WB1D 2YWWA 2V6AA 1KOHA 5LMNF 4P2XA 1Z2LA 4CI0B 3AJ1A 2Z56B 1FXLA 1J5OB 2AHOB 4I2QB 2V50A 3TWZA 4R25A 2AGQA 2VC0A 2EFNA 2HNYA 3MR7A 3EDRB 1XIQA 2J6TA 1C0UA 1YHQS 1EHWA 3DM2A 5CQGA 3UD3P 4DUZF 4N76A 1KHVA 4DR7J 4LVOP 3CDWA 2DH8A 2D3OR 3QRQA 3GZ7A 2E1CA 4MTPA 1VQ7S 1S1UA 4MKAA 2GAGC 2WRMA 5ETOA 3QIPA 2H4YB 1FEEA 5L9NA 2G0CA 1SBRA 2BBEA 2K1RA 3R7NB 3BGRB 2VJVA 4ZCLA 1Y4ZB 3NWRA 5LJ5Y 1LXNA 1G3OA 4ZLNA 4DXLA 2DT9A 2R8GA 3DLEA 4F4ZA 5DLGA 3DDNA 5KFOA 1FDDA 3GU0A 2HFZA 5C24B 1NH8A 4DV5J 3OBIA 1P8GA 3A3NB 4IFYA 4XAKA 2VFVA 4ECQA 2R7QA 4USTA 4CIOA 2AEMA 3IBWA 4K4SA 3CCLS 2FLOA 2UVVA 3TOQA 5HSPA 2X1AA 3NL0A 3R2CJ 3E3XA 2XEXA 1NEEA 1NCLA 3DDIA 3WBZA 2RD5C 4RR5A 3G6YA 5HP1B 2LU2A 2V68A 4EWTA 5ITHA 1WHVA 2HGLA 4ZJLA 4NLRA 3QSIA 3F41A 3WZ0A 1TAUA 1HNXJ 4WP3A 2DK2A 3BSAA 4DV2F 1S1WA 3A8EA 3NMAA 3NRBA 2O5DA 1T7PA 3M2RB 2C1EB 5J2PA 3RG6A 3R7SB 1G4CA 3MR5A 2N3LA 3W5XA 2IRUA 3A12A 3H5XA 3J80U 1WOOA 3RB0A 2F8MA 1NPKA 1TL3B 2Y9HA 3J7YU 4I4BA 4M5KA 5B0FA 3OV7A 3TA2A 2K3IA 3WQPA 1UFKA 1OYEA 4DV4F 2YKMB 1RXOB 2J5AA 3BGLA 2FZKB 1AB8A 1RTHB 2R9LA 3POTB 1SQEA 5KFYA 1HNIA 1MWQA 2VB6A 4OV6A 4DSFA 5ETPA 4I7FA 2M4MA 4PRFA 1TL1A 1YVFA 4RW6A 3MTKA 5AXLA 1Q7YT 1M1GA 1GX5A 2EKNA 2J0QD 1ZPVA 5EUHA 4WKYA 2E5HA 4NPOA 1HBNB 2F8HA 4BBYA 1P9YA 2UU9F 4DL3A 2YKNB 5D15A 4RO0A 4WYWA 4X62F 1RHMB 2HQGA 3ZZ0A 3IFEA 3BDEA 3P96A 1V3ZA 1U0HA 1UWBB 4RNOA 4JOUA 2J7KA 2HBYB 4M1KA 1ZAWA 3JSBA 1F0XA 3D54A 3QJJA 3KMQA 1HQUB 1M5SA 4O44B 2VU5A 2OEKA 4ECXA 3ELHA 2N3OA 2DKOB 1OY6A 3R9LA 2HQCA 1MN7A 3T1YJ 2CVIA 1ZM9A 2A2CA 2MKIA 1LV5A 2C2EA 3E01B 5F0UA 4LFBJ 5LXRA 1HMVB 2VUGA 2QLFB 1W2IA 1WHWA 2M52A 2XNRA 2LXFA 3PYEA 2JNJA 4MFBA 4TVAB 2ABYA 5DDQC 2Y3YA 3M8QB 1GXUA 1HNVA 1TVRB 2PA3A 3ZTQA 3ETOA 5J2MA 2IM2A 2NXJA 4X66F 3IR5B 1R0AA 4F02A 2E5JA 1GXTA 3CXCR 1E6YA 4QPXA 1FRLA 4Y0FA 1ULRA 1R6YA 2H48B 5D4NA 5G4DA 4NXNF 2VD3A 3NGKA 3MMBB 2V8HA 2OLWA 4RBUA 3I5CA 4J9QA 2WBMA 4OYPA 3H4BA 4WFAQ 3R5AA 3N01A 5DDPC 2RJZA 4IG3B 1DRZA 1NK6A 4RPFA 3DLKB 2YNIA 3OXFA 2X1BA 2RNEA 1REVB 2IJNA 1S9EA 1I94F 3ZZPA 3T3FA 2UUBJ 1WORA 2ZE2A 3LWMA 5HROB 5FLXU 4D3GA 2QL7B 3D1OA 2MZJA 4IO9Q 1RTDB 2AT1B 3CCMS 3JTOA 3TO8A 4A8FA 4A4JA 1VIOA 2DNNA 4DX7A 3J81Y 1WC3A 2MEWA 1FRHA 3WIUA 2J0XA 3UNGC 3CJ3A 4H4OB 3BKTA 3MM6B 1R6VA 1NLKL 4NRTA 4X2BA 5E41A 1VHFA 5IM0B 2LEPA 4ZVUB 3LGMA 4LSNB 3GYGA 5H9FJ 4CM2A 4MK7A 1FKOA 4DHVA 4Q45A 4USKA 1WOPA 1FHTA 2WVDA 2FLLA 4P71A 2HIQA 1VRQC 1L3VA 2P6TA 4R0JA 1Q1KA 3ILLA 3HKWA 2Y1IA 1MW7A 4WWSA 1Y5IB 4NLQA 4O3QA 4EFAC 3QRPA 2MJUA 5KG3A 1TV6A 1D8YA 2ZM6F 1U6FA 4X4QA 3BH6B 2PE8A 4LF4F 2FLNA 2EC0A 1XMOF 1F60B 3ZNJ1 4P6QA 1HI8A 3HKZD 4USIA 2UVUA 3B82A 2O66A 3DI6A 5H9EK 4P10A 1RCXB 1RAIB 4NX9A 1SL2A 4E0DA 1CJVB 1WHYA 2FHMA 2KHCA 1WKLA 3M1VA 1JJ4A 4C3KA 4UOHA 5ADZA 4WFXA 1MN9A 2QE5A 1SJQA 3NMRA 3G8QA 3VGUA 1IJFB 3MM5A 1Q82T 4P2SA 3T5LA 4PWUA 1QVFR 3V5RA 3T41A 1GK8A 4ED5A 3D68A 2F7VA 1VHIA 1WC6A 1NSQA 2ZUGA 4K7QA 1LW0A 3MEDB 3TVYA 1VRUA 2CKWA 2JDJA 2IMOA 4Q2MA 4ED1A 5I42A 3EMTA 3MM9A 2XY7A 4JUZA 4ZPAA 1Y10A 4NYOA 1V3RA 4Y65A 1TMJA 2QT7A 4FDFA 1K8AT 4AD6A 3DLGA 4RW8B 1HBMB 1SV5A 1KFDA 4AL6A 3C66A 5K8PA 1Q79A 1R8HA 2BA9A 2HHTA 4FF3A 4B9MA 3ZZRA 4EMDA 1RHRB 1BY9A 5J2NA 1KLMA 3BO4A 1NK4A 3OTOF 3TZWA 5D3GB 3NOCA 2G0JA 4PG8A 3RUBL 2W2OP 2IDEA 1HI1A 2YTCA 4ZJOA 2HWHA 2NLWA 2Y0BB 3TJ9A 2G2ZA 5A6PA 1GMWD 3OHAA 4KSEB 2X3DA 1FNOA 2I38A 4JI0F 2AZ3A 5KFHA 1JJCB 1OY9A 1N33J 3MUVP 1SJ4P 2M2BA 1WTFA 4ENOA 1N5VA 3ITHA 4F0KA 2DGXA 2KYXA 2YVSA 2A6MA 4W4MA 2HRUA 1QLNA 3E2EA 3V4IB 3MF5A 4HTJA 4EO6A 3EDQB 2YX1A 2RT3A 1R8AA 2ZOMA 4G65A 2B4UA 3ZC4A 4KTQA 3Q86A 2M8DB 2XSFA 3J7AN 1CQNA 2KZMA 1TP7A 3ONQA 2OPQA 3ILOA 3MPWA 4J9PA 3Q83A 1NMEB 1NNDA 4FBTA 2OFGX 2UV8G 4ZP6A 2VFTA 1VRTA 4DCJB 2HVEA 2B4PA 4ANEA 2JEIA 5KG1A 1JLFB 2YNHB 1VBYA 3DLBA 2QN6B 2UXCF 1PSDA 3P4UB 1YJUA 3MMAB 4GC6A 4YR2A 1DJ0A 4LVNP 4CNYA 1N5YA 2OEJA 1HWJA 3KXDA 3IXQA 2XNQA 1E6VA 4OFZA 2KVIA 3ICLA 2FJXA 3FSYA 4IDKA 2PA8D 2GQ2A 4ECZA 4CT9A 2JH3A 4E8UA 4DJBA 2HG4A 2XSJB 1AZSB 1T05A 1YJ7A 3MOZA 4NE9C 3M8ZA 3N5FA 4FYVB 4OZ5A 2IHR1 3GYXB 3A4TA 4FBUA 1EZZB 2GIFA 1SIZA 3K7RA 2BJ1A 1SKWA 2E9RX 3PW2A 1U4BA 3SXLA 2YPZA 2BE2A 3T19A 1CJTB 2HZCA 1D3WA 4R8UB 1SXLA 2SXLA 2HFSA 1YWXA 1B70B 1M5PC 4WYLA 3FFIA 1NJWA 1S97A 5BXIA 4ZJQA 2ZC4A 2FTRA 3P6YC 2B5JB 2KRBA 2YWGA 2C3YA 3HHLA 2BJ3A 2HLTA 4PG4A 4TU7A 2P2CB 2J0SD 4I56A 4ID8A 6AT1B 3DHXA 2PI5A 4DX6A 4KYZA 4NZ6A 4CZCA 4JI1J 3OL8A 1U8SA 4ES3A 2J9EA 4LFCJ 3FC9A 5A8WA 2JL9A 3Q23A 5E3PA 2LLZA 1FF2A 2AKWB 3TVKA 2E29A 1VQ4S 2OAUA 2Y1JA 1WG5A 2CXEA 4ZHRA 1SJRA 1HNZJ 3OFEA 3MEGB 2R42A 3FBFA 4YHHF 1NRKA 3DGPA 4WE1B 1RHJB 2AJ4A 2VL1A 5HJYA 1KHWA 2B8PA 3MMJA 4IRKA 1RT2A 3P5TL 2Y0SD 4E98A 1S6UA 2FGOA 1JJHA 2QL5B 3EYZA 2ZBPA 1ZM4A 3Q22A 1JLAA 1Y11A 3R3TA 3CCQS 4FXWA 2XWYA 4I6AA 5B0BA 1SQGA 5FDLB 2HHHF 2FHOB 4WXWA 5LSLA 3MZIA 2VICA 5CCMA 2AMCB 2AEJA 2ILZA 4YB5A 5KT6A 2V0NA 4LFAF 4WIIA 1JLBB 4I68A 3RAQA 3K5MA 3CJQA 5KG6A 4LIWA 1T3NA 2YX4A 3GYNA 2HHXA 4DQRA 3PHTA 4HDHA 5AXMA 2C22A 5A8RA 2V2QA 3UNYA 4KR0B 2GA7A 3CC7S 5H9EJ 3KDNA 3QWPA 1U48A 2KG1A 1AROP 4M5NA 4OX9F 4C98A 8ATCB 1CEZA 4RWXA 3KJNB 3LUYA 2I0XA 1EKRA 1JQGA 4O23A 2KHDA 1NAQA 4OYOA 3R8YA 2DHXA 4LT6A 1H3DA 4BWMA 4AQYF 1H2UX 4ZOSA 1IKWA 4L75A 1HL6A 2Y8WA 4KPCA 2YH1A 1WF0A 4RW9A 1GTEA 2HGNA 5SZTA 1RYSA 2RDDA 2CPZA 1ELOA 1G1XA 4DMZA 2JWNA 4TQRA 2EFGA 1VQYA 4OI3A 1I1GA 5DGBA 3KK1A 4U8VA 5L39A 4UOGA 3W3SA 4OZLA 1IBMF 3OR1A 5DG7A 3RTVA 1IBKJ 1D9FA 2CDQA 2PMZD 5EGYA 2A10A 2GV1A 2MJNA 4LSLA 4NLSA 1MU2A 3HFVA 4YFUA 1PAUB 3Q0AA 3C8YA 3BQ0A 2J7WA 3MDFA 5KTQA 4GVBB 3UN5A 3MM8A 4I1TA 3CGIA 5HO4A 2MY7A 2R8IA 3W2WA 2PN6A 3K58A 2LA4A 5KFRA 5CD4A 5MLCV 3C16B 2C2NA 2HURA 3HVTA 1JKHA 3TNVA 4G6VB 4HHHA 3GFZA 2O1PA 4OZ1A 1N48A 4K59A 1XR7A 4ZLPA 2WK4A 1EKSA 1SC4B 2AX0A 1KVIA 1BHNA 4ID5B 1X8DA 1UJ6A 1S1XB 3MM7B 2U2FA 3ENQA 1LWFB 4DX5A 4C3LA 3NNCA 3UVJA 4L74A 5AXKA 2FY1A 1HR0F 1K9MT 4X4UA 3CCES 1YLXA 1MROB 3EE3A 1WKKA 2HHVA 2B56A 3IWNC 4HLBA 4KRWA 1VLOA 3NS6A 5K8NA 4B9UA 4P9SA 3MI7X 4QW8A 5KFCA 2C3OA 1RT3A 4LRAA 1R27B 1UEKA 4WFBQ 5E7OB 5THWA 2HQIA 5HI7A 2V67A 2BANB 1S4FA 2M0GB 4MH8A 1CJUB 4UF4A 3W2VB 1YJRA 1MWZA 2DEJA 2MZTA 3OL6A 4C97A 1J5EJ 2BQRA 1LWCB 1DAXA 4DL6A 5LT5A 1BUXA 4ETXA 3I0RB 3CNQP 2XI2A 2GMHA 3Q8VA 3TR5A 2WW8A 3W62A 3A3OB 3F56A 4U9RA 3OTBA 5GMKa 5KFQA 3KLGB 2BJDA 1XNQJ 1VBZA 1N52B 2QFIA 2IC3A 4WF9Q 2HS0A 3PIOQ 2XMWA 3FJ2A 5IQQA 2OD4A 3SFUA 4F36A 3H20A 2CZ9A 1H72C 3CDBA 2DGOA 2ZH5A 1I51B 2MXYA 2HNYB 2DGTA 3G6VA 4J9VA 4KV8A 4TY8A 3MCNA 4HEA9 4M8LA 1VQKS 3R7BB 5LJ3Y 3CD0A 1PBUA 3PVXA 5ETRA 3MPYA 1KVJA 4JI5F 3HVAA 4DV6J 4JI4F 1P6TA 3HSDA 3SCJE 2GCFA 5LMUF 2CADA 3N6LA 4ECUA 5KFFA 4QWBA 3CMES 4O4GA 2V4QA 4LF9F 4IFVB 4O3OA 2OPPA 2D41A 3M2VB 2VA2A 1HBOA 2MKCA 2N4CA 3EWGA 3US5A 4CLPA 2W24A 3DLHA 2GIQA 1JWWA 3MECB 2H54B 2ZD1A 2DB1A 4ECVA 2DNGA 3CCVS 2XULA 4DUYJ 3I5BA 2M8HA 2ZITA 3NCRA 3CDUA 4KHMA 4DR5F 3WX4A 3VQTA 3WX8A 4EZ9A 5HJXA 3C19A 4PXEA 4B3MF 3JQJA 7AT1B 2KKHA 2CA9A 5KG5A 1GT8A 2DGQA 2HK2A 1ZAVA 1NSPA 1VLYA 5KFGA 4LBIA 3CCUS 4P7TA 1HQEB 5KFZA 3VGSA 4BHQA 2DRBA 4WFZA 1ZOTA 1N32J 4JV2A 9RUBA 3RRKA 3CJTA 2VASA 1VJQA 2J9CA 3N79A 2QSWA 2V8GA 3D6TB 2GJFA 3QO9B 5ETLA 4EK2A 2HBZB 1S1WB 1OQ6A 4J9OA 2NSCA 3R5BA 1WI6A 2QGFB 4OZ2A 1RAOA 3UDVA 3HHNB 4K5SA 1EJ7L 1TELA 3FK4A 2AX1A 3GR0A 1YQHA 2W25A 3KJVB 4BC9A 1FCAA 1YRUA 4Q0BA 4YUDA 2NYHA 2Z57B 5DG8A 4GRSA 5DG9A 5C24A 2JSXA 3AAWB 2NCKL 2LQBA 4DR6J 1P1TA 3T9NA 2FZCB 1MMDA 1UPMB 2X3GA 4GKKF 3UDEA 1HNIB 3VALA 1OO0B 2AJQA 1TL1B 2HNDB 1XERA 1UFLA 3FZBA 3HVWA 1ZPWX 2BR0A 3QFHA 2ZWOA 4UW2A 3NP5A 5U47A 4RUHA 3TW0A 3SSQA 3CCWA 4KO0A 5HP1A 3S1TA 3BR9A 3RBEA 3MAAB 3VV2B 1Q95G 1BQXA 2MKJA 2CUYA 3AB4B 4NLOA 2WAQD 2EC2A 4AXJA 1VQMS 3DU5A 1RBAA 1G7CB 3M2RA 2ZH9A 3VAFA 3FCVA 5HK4A 4MKYA 4FS1A 3S8SA 5L9XA 3NWGA 4K4ZA 3ZO7A 3O44A 1TL3A 3IRXB 2V5HG 3I4PA 3CCZA 2MQQA 2XMMA 2YKMA 5HMYA 4NLTA 1N34J 2ZZMA 4NA2A 2HHPA 2RHSB 3H59A 2F4FA 2IM3A 2R7RA 4IRCA 1UCNA 1DQAA 4L3KA 1K0VA 2FC8A 3BYRA 1RTHA 3POTA 5GADU 3SIPB 4TN2A 1S0VA 4DV7J 2DCUB 3LP2B 2GGPA 3HSZA 1TL7B 4C0BA 1RWUA 2CQHA 3JYTA 3HFZB 2H9ZA 2MTLA 1XBWA 3FVYA 3BPDA 1RACB 5CH7B 5J2MB 1S76D 2EI5A 4DLGA 1HBNA 2H3EB 3D1HA 1GMVA 5T7LB 2DNZA 2LDIA 4DWIA 1KBRA 1W25A 2ZH6A 3Q8UA 4ZPVR 1Q78A 4CDIA 4KJIA 1UWBA 2CQ4A 3I0SB 4K4YA 2COLA 1X5PA 1UW4A 2FD2A 4K4XA 4JI6F 1WELA 2OEMA 1HQUA 1IN0A 2AZ1A 3UCGA 4O44A 1BE4A 4B3TF 4JI8J 2MLYA 1UPPA 1QSLA 2V2ZA 1U1PA 1UEUA 2CNNB 2CPXA 2K3KA 2AF6A 1B0VA 2DXDA 3KLIB 3VAJA 5C42B 1S48A 3KG1A 3E01A 3M4XA 3NLCA 2LCWA 4RU9A 1T94A 1WNEA 2KXNB 1O8BA 3FEYB 2EPIA 1PJ5A 1RSCA 3JTNA 5J1PA 3AXKA 2EWHA 3G4SS 1JK9B 1NK0A 2HNZA 2RMLA 3IBCB 1SC3B 5K20B 4C7QA 3CJRA 4UOFA 2VG5A 4O3RA 3OXLA 3VTIA 4DUTA 4WPAA 3MMBA 3EVWA 2OMOA 1CG2A 2W01A 3K2YA 3AOBA 5FIIA 1RU2A 3NGTA 2C42A 1QTMA 3W64A 1S7HA 4K4VA 2L41A 4IG3A 2E5LF 3SQOP 3PR4A 4HVZA 5KG7A 2UUAF 2D69A 2IA0A 1REVA 5GAEI 3SZ2A 1ZAXA 2PFDA 2D9OA 1XNRJ 4KKOB 4PQAA 3DXBA 3FMWA 3TUJC 5HROA 3JS9A 5KG2A 2WSFC 1YBAA 3QIDA 5EX0A 2VPYB 2BE9B 2CPHA 5L1JA 4NYZA 1HWKA 1RTDA 2C28A 4PEOA 1KKHA 3ILIA 4YY3F 3DI6B 1UA0A 5T14A 3M30B 3QNWB 2IRYA 1FWLA 4H4OA 2E1MC 3MM6A 2HRTA 3CO0P 1VFJA 1NHUA 1HHSA 3CCTA 1PJ6A 3D67A 3HZEA 4EYIB 2A6OA 4LSNA 4ZP9A 5D77A 1NDLA 5DZ7A 1RTIB 3AD7C 2VODA 1I6JA 5AJ3J 4ZP7A 1FKAF 4G3IA 4HH1A 2HW3A 2Z58B 2ADBA 3BBFA 4CT8A 2HBRB 2EFPA 5F0WA 4CH7A 1PILA 1R0BG 3SQGB 3K17A 3OL7A 1LW0B 2IFXA 5M2UA 3HSGA 1EAYC 2IJFA 2YBVA 1HFEL 4NRUA 3K5PA 4FYYB 1ZTWA 2XQCA 3T5HA 1UZDA 2PEHA 2A0FB 4NASA 5LSRA 4JP8A 2QV6A 2EBEA 3JSRA 4Y28C 4A8YA 3U1LA 4DV0J 1CQMA 3X3UA 3LQVA 4LUBA 4ETZA 4WCEQ 3FRZA 4PWWA 3ZFVA 1VQLS 2FQQB 2R8KA 3FBEA 4OI6A 4HT5A 4P75A 3BYPA 1S4EA 2HHUA 3V6KA 5HMWA 1CJVA 4OHVA 4J9UE 1BQNA 1RKJA 4OJ1A 3GCXP 2VPZB 3KHGA 2B43A 3KWMA 1WD6A 4C8ZA 1CJKB 3AQOA 1X4FA 3LPYA 1VJWA 3ITHB 1PYTA 2FJVA 1S12A 2RKIB 1UEVA 1FJ7A 2JEFA 1D1UA 1RKIA 3BBBA 1JXEA 2A2DA 1UTAA 3MEDA 3V6JA 3CJ8A 3MR6A 1TL5A 4ZVTB 4MK9A 2UUCF 1JLEB 1OQ3A 1D9DA 2RHQB 2UUWA 2W4PA 2OPQB 2MHEA 2CWKA 3GSIA 1QY7A 2AJ1A 5A76A 1YX2A 2LDYA 1H2VZ 4IR1A 5RUBA 4USVA 2K8GA 3RR7A 3TAMB 4B9VA 1P9QC 1M1HA 2HWTA 1HBMA 4RW8A 1U1LA 4LMZA 2NUHA 1RAEB 3KUHA 1NPPA 3HCXA 2FGCA 2W8LA 2CRLA 2LYVA 4Q8EA 1RABB 1NU4A 1RT4A 2KYZA 5D3GA 1I3OB 4OLOA 3P3DA 2FHJD 1IQTA 3I9ZA 2EFQA 2JLFA 5KFSA 1U1KA 2KZZA 3BDPA 3CD7A 3FRYA 3K8WA 4NXMJ 3UQSA 3ULHA 2M88A 4HR2A 3CO9A 2RSQA 2E1AA 2Y1LB 1RBLA 1WC4A 1SIWB 1T3OA 4C8OA 4RL1A 1B0PA 1IR1A 4GKJJ 2MLZA 2DGSA 4PZVA 1WSRA 4U96A 3AA8A 2X1GA 4IO1A 1KLNA 4LF7F 3VGVA 5KT3A 2V63A 4N8NA 1SVDA 3K5NA 4M5GA 4F4WA 1RT1B 2CJAA 1ZS6A 2HFUA 2K7KA 3ZZUA 3RBXA 4CO0A 1VS3A 2RB7A 4C8LA 5EWGA 4KHPF 3DRYA 3PXGa 4HI2A 4QW9A 4ES2A 1X4EA 2YNHA 3CD5A 2G1HA 4DL5A 4FF4A 5IOLA 4OLPA 1S0MA 2PO4A 4UQTA 3MMAA 1FJGF 1CLFA 2VG7B 1JB0C 2ZVIA 2W8KA 3Q8YA 4PAAA 4DV3F 3K5OA 1LWEA 1RWMB 2CPEA 4ICLB 3VWSA 4QU6A 5F8IA 1FJCA 4CO5A 1N0UA 4ZLJA 2XSJA 1AZSA 1NDPA 1NXIA 1U1OA 1VIXA 4LF5F 1H74A 4AFFA 3DGPB 2OI2A 3PDNA 2R7UA 3D3BJ 4J9SA 1URRA 1B64A 3NNHA 2G0IA 2H4WB 5E3QA 1CJTA 2DIVA 3PJWA 4R8UA 2CNLB 4G1PA 3AJDA 3MURP 1JLAB 3UD4P 2Q3PA 4BC7A 4CLYA 2LMIA 3HX9A 2B5JA 4DZDA 4RNMA 1DHMA 3DFEA 1QDUB 2QMUB 4K0KF 2Y8YA 4X65J 3ZZTA 1D8ZA 3BQ2A 3JB9k 2AYGA 3QQCD 2KJWA 4DU7A 2RILA 1IJEB 3KLHA 1MMLA 1UVMA 3ISZA 5HANA 2HVIA 2W2NP 1FTRA 1D0EA 2N4DA 5C2CA 4ZVRB 1FRKA 3DRPB 4Y6IA 3IP0A 2DVIA 1GMUA 1UAWA 5E0OA 2CDRB 1ICEB 3HD2A 3MEGA 1HWLA 3K59A 3FCHA 3I55S 1TUGB 5GAGU 2YKQA 1RYRA 2FHKA 2X7IA 4WE1A 2R3VA 4ZPBA 3OJSA 3D66A 2BJ7A 3GSDA 3OLAA 5A8KB 1X31C 4ED7A 4O3PA 3VCDA 3D0IE 4PXDA 3M8RA 2JHEA 3BGOP 1VMBA 1LK5A 5FDLA 3HI9A 1PYSB 4NI2B 1MSWD 4LQ9A 3UFCX 3AA9A 2HSEB 4RZRA 2PSZA 3CJ2A 1S6OA 2Z2ZA 3IS9B 2YWFA 1NBEB 5KT2A 1H98A 2V4RA 1CVJA 1UWAA 2B0GA 3CB4A 5D0HA 3PW7A 3MPUB 5A0YB 2F65A 3W61A 2JLEA 3HLUA 2LQJA 1TU0B 4OHWA 4YQWA 2WHOA 3CIMA 5DQGA 3ET6B 1AUDA 3EPGA 1FNXH 1S49A 4F2RA 2ATCB 5HMXA 1JLCB 4U8YA 1PYOB 2OO4A 1S6QB 1F3VA 1FFSB 1LXJA 1R43A 1DQ8A 1T9XA 7FD1A 1RBOB 3QYYA 3J81U 3QMQA 3GMGA 4C9DA 1FDBA 5KFEA 5CZXA 5HMZA 4FYDA 3DXSX 1S1VB 5A2QU 2DNQA 4LF2A 4TYAA 3UVJB 5HN0A 1N36J 3UE2A 2XMUA 1S79A 4NEZA 5AE3A 2LQ9A 3RW6A 4U7CA 2C2OB 4J9LA 2VFSA 4RX6A 4LF8F 1TAQA 2DNRA 1ZM3A 3OW2R 4YMEA 1T9VA 1RT3B 3M6UA 3ILJA 4LF6F 2GAHC 2WVCA 4ZS6A 4J9MA 2CJKA 5CXTA 1TR0A 4OQJA 1VQ5S 4GVBA 3M8WA 1X5SA 1SJ1A 1TK8A 4L76A 1MMNA 4H4KC 1WHXA 2UV8A 4DS4A 2I5JB 4A47A 1LQ9A 3PFEA 4OHYA 4DPWA 1FDNA 2ZBIA 4USMA 3BSNA 2KFZA 1YJTA 5BYRA 2IBKA 2ASDA 2OTLS 2CJ9A 3TA0A 4NMXA 3M8PA 2WSCC 2BKNA 5HAOA 2V8PA 4X64F 2AD9A 3AB2B 2CZ4A 2W9AA 1WUUA 2ZDOA 3FEZA 2MQMA 1UVNA 3RAMA 2P9CA 4ID5A 4IG0B 1LKZA 2XS5A 1S1XA 4JV5F 3MM7A 1LWFA 2DY1A 3CJ0A 3LO3A 3TUPA 4NLDA 3BN7A 3DDKA 1BXNA 1ZBTA 4DU8A 3LP1B 2VG6B 1X0PA 1M5VC 2HFNA 2XMTA 3FNNA 3R97A 2DRDA 3OL9A 1Y5NB 2P6SA 3A3PB 3AOAA 3QGHA 5KFVA 4M95A 2DISA 1KWMA 3V81B 2CQPA 3K57A 3BN4A 2VPXB 5I3QA 1SJFA 3MR2A 4DQSA 2R7VA 4Z7CA 5ETQA 3CCRS 2BANA 3KYLA 1CJUA 4NLYA 3TARA 3W2VA 2FPHX 5D78A 4PG7A 1VCTA 4JI2F 3UCUP 4EI2A 1S1TB 3D6MB 1B0TA 3CMAS 4ZVEA 4EBCA 1VDHA 2H51B 4DL4A 1Y5LB 2BEFA 5J1NA 1HBOB 5D4LA 4OHXA 5HL7Q 4OV1A 1S9FA 5F8HA 2GJIA 5J1EB 2JJ4D 3ENAA 1U2RA 1FJEB 4IOAQ 2I6WA 1RK8A 1FD2A 3L3CA 2MDAA 3OPKA 2AU0A 1EQ0A 3N9UC 3GIMA 4MKBA 4M5DB 1Q8BA 2PMWA 3FQKA 3PKYA 1MLAA 3QLHA 4DR7F 4F4YA 3BSOA 5H9FK 2RUSA 2K7JA 1IKYB 2YWKA 2R7TA 1N56A 4ECSA 4Z2XA 4DF4A 4RKUC 2OSQA 3O5TB 3DOKB 2E9TA 1WACA 2ADCA 1PAEX 4FPRA 2L3MA 1APSA 3LAMA 1ZH5A 2EKYA 2HHQA 2GNKA 2QEXS 4A8OA 5DM7Q 2NPFA 3I56S
chains in the Genus database with same CATH topology
3M8SA 2YQ3A 3TNVA 4G6VB 3GFZA 2O1PA 2VBZA 3CF5Q 1U47A 1U45A 4OZ1A 4ED6A 2BQ3A 3HM9A 4DV5F 1N48A 1H7XA 1M5OC 2OPSA 4IFVA 4K59A 1XR7A 3LF0A 1DARA 2D74B 3M2VA 4ZLPA 2U1AA 4GO7X 2YY3A 2WK4A 4Y2MA 4DL7A 1KQSR 4ZVFA 3T9ZA 2KM8B 3KOAA 4X4VA 2LVWA 5KFLA 2B9WA 4URQU 3U02A 2AX0A 2R2TA 3I5AA 2PFFB 5B09A 1KVIA 2GC8A 4ID5B 2QLWA 5KFUA 1Z2ZA 4UOCA 1RGVA 1X8DA 2Q6BA 4K5RA 4CTAB 4Q0BB 1IR0A 1UJ6A 1S1XB 1EP4A 3MECA 1TKTA 3MM7B 3PR5B 2U2FA 3ENQA 1LWFB 5KFXA 4PR6A 4C3LA 2DR7A 2RRBA 4L72B 4F8RA 3NNCA 3C3LA 1OS5A 4CO2A 5E3CA 5AXKA 2FY1A 1HR0F 1QUVA 1K9MT 4R0EA 1WG1A 2RQKA 3NBPB 3NS5A 4ECRA 4F3OA 4X4UA 2C3PA 5GAGI 3KNAA 3CJKA 2OP5A 3CCES 3B8HA 1MROB 2UP1A 3CULA 1NK8A 1TUVA 2YNGB 2HHVA 5KG0A 2R2RA 4OL8A 4DR2F 2EG1A 2Z8QA 4HDGA 4CQ1A 2B56A 3IWNC 3HZGA 4HLBA 4KRWA 5J2QB 1AXQA 2EFVA 5SUHA 3CDEA 1X0FA 4CO4A 4KGKA 4QIVA 3ENWA 2RF2A 2CQIA 2HMIB 3NS6A 1TKZB 4CH1A 1X4CA 2K2PA 3HFKA 2CQCA 5K8NA 4OI2A 1S9GB 2GO8A 4B17A 1Q4RA 1NB7A 2EVZA 2FJAB 2DPIA 4B9UA 1HNXF 4I2PA 1F5BA 3MI7X 4KQZA 4QW8A 5KFCA 2C3OA 5A8RB 4ECWA 4DSKA 4C8KA 1RT3A 1TFWA 4ZA1A 2VA3A 1X9WA 1R27B 1FKPA 4NZ0A 3CPWR 1C0TA 4DFMA 1HQEA 5KOWA 3VAGA 1VC6A 5F9LA 1NK7A 3CC4S 4WFBQ 4ILLA 5E7OB 4KO0B 3KKFA 5THWA 2HQIA 1X5OA 5E2QA 3E51A 4BCAA 4TU8A 1X5TA 4ERDA 5HI7A 2W4CA 5EX3A 2BM0A 2PGCA 2YKOA 2EG2A 2Q43A 1S6PA 2BANB 2CPJA 2RIJA 1S4FA 4CCHA 3RYLA 4X4PA 2W9BB 3TAPA 2M0GB 4MH8A 2AW0A 2DNOA 3DOMA 3QO9A 3W2VB 1RA7A 1O0PA 1YJRA 1SUQA 2V4JB 1MWZA 3U7JA 3DOLA 5IXUA 3PIPQ 2ACYA 2MZTA 3OL6A 4C97A 2ILYA 2N7CA 4DSEA 4B3RF 5I3UA 2BQRA 4F67A 5B0DA 4QCLA 3HHLC 2CPFA 1IKWB 2ZVSA 3SSRA 1VQNS 1LWCB 1DAXA 4AL7A 1XNRF 4MJKA 5KFPA 3RRHA 3UI3A 3HP6A 1VC0A 4DL6A 2AP6A 5LT5A 4U6PA 3MGJA 4ETXA 3OUYA 1SL0A 3I0RB 4RW9B 4F3MA 3NG8A 2J76E 2XI2A 1G2EA 2XHWA 2GMHA 1KEKA 2E7XA 3S7RA 6FD1A 2CJBA 3IWXA 3KLEB 3TR5A 2WW8A 1UKUA 3GIKA 3LGNA 1SH0A 2DJWA 3F56A 4U9RA 4C3MA 3OTBA 3KJVA 2NR0A 4JBCA 1HWUA 1Q81T 5GMKa 5KFQA 2VV5A 3KLGB 1HW9A 3KK1B 2BJDA 4IR9A 1VBZA 4B3SF 1N52B 5KT5A 1N6QB 4IH6A 2CPYA 2IC3A 2PD1A 4FVCA 2GJ2A 1BC6A 3OR1B 4PUOB 3SMZA 4WF9Q 2HS0A 1HBUA 2RVJA 4BWJA 4Q43A 4N77A 4HT7A 5CD4H 1JLBA 3PIOQ 2XMWA 5CYQA 2CQBA 4LJMA 3I32A 5BYQA 1EETB 2YNFB 4MIAA 3FJ2A 1MNEA 5IQQA 4XIUA 2OD4A 3SFUA 4DS5A 3H20A 2OIHA 4QR1A 3PJXA 2MZSA 3CDBA 2DGOA 2ZH5A 3HJFA 1UJ5A 4QQBA 3VR1A 4TXSA 1Q8LA 1KD1T 5CYMA 3O8WA 3MOJB 4LSLB 2HNDA 5D8HB 2GGPB 4YB1P 2MXYA 2HNYB 3SSSA 4EUVA 1MU2B 2DGTA 3JYTB 2YX7A 3UR3C 3MR3A 3TYTA 3IWLA 3VAMA 4NL5A 3G6VA 3MEEB 2KG0A 4JYAF 2DTJA 4KV8A 5AJ3F 3AJ2A 2O01C 4TY8A 1KFSA 1RT5B 4HEA9 4M8LA 5L1KA 2JRSA 1VQKS 5LJ3Y 3CD0A 3PFOA 2W7AA 3AQPA 3PVXA 2WB4A 4DDFA 4RNNA 3MM8B 1C2PA 1GNKA 3MPYA 3H5YA 2C3UA 2DIUA 4KT0C 4JI5F 4G1QB 1T8EA 2CIMA 3QGIA 4NLXA 1KVJA 4DG1B 3HVAA 3SEOA 5L8RC 3G8SA 1B7FA 4JI4F 1P6TA 4DR1F 2B4OA 3SCJE 3W2WB 1RTJB 2GCFA 5GAEU 4AUKA 4Y34A 3M6WA 4I67A 3LAKA 5LMUF 1YJ9S 1KOOA 2I1RA 3EXYA 4DV1F 5HBMB 3N6LA 4EYHB 4QIFA 4ECUA 2IAJB 3ENVA 4KGMA 5KFFA 3BO2A 1XK8A 3HVTB 3OFFA 4QWBA 3G8TA 1Q53A 1X7VA 4B9NA 3KK3A 3NCPA 1JKHB 4Y2KA 1GXLA 3CMES 4O4GA 3OLBA 4WJBA 4QZVB 4URGA 1CSJA 2ZOGA 4FP9A 4DEZA 2V4QA 3BQ1A 1ROFA 1XMQF 4LF9F 3PKMA 3PHEA 3GILA 4DQIA 3UDLA 2OPSB 4IFVB 5AE2A 1R7IA 3T1YF 4O3OA 2OPPA 5JVHQ 2DHAA 4KIAA 4MMOA 1GH8A 2D41A 3M2VB 3I6PA 2ASYA 3D28A 5F8MA 2VH7A 5DM6Q 3SV4A 2VA2A 5DQIA 4DV0F 2F3JA 5DRKA 1X4HA 1HBOA 2D1CA 2JFDA 2MKCA 2N4CA 3US5A 3IRXA 1BGXT 2F8EX 3SCLE 2RQ4A 3QGPA 2LXIA 4RBTA 2W24A 2E7WA 3QJLA 2NS1B 2LA6A 2FC9A 4I0WA 4QJVA 3DLHA 2GIQA 4HTIA 4LFBF 1JWWA 3M2UA 1EP4B 3MECB 1TKTB 5C25A 3GIJA 2OTJS 2ZD1A 3M05A 2DO0A 3KLFA 2IYGA 2VBXA 2E5GA 2DB1A 3THTA 5AE1A 4Y00A 5MAOA 4X4OA 5EDWA 2DNGA 3CCVS 4ECVA 2XULA 3B4DA 4HHJA 3CJKB 3I5BA 2M8HA 2MQLA 5B08A 2ROPA 2ZITA 3NCRA 5F8LA 3CDUA 3O2IA 4KHMA 1WEXA 4DR5F 2I9SA 2FVCA 4PG5A 3J80Y 2AGPA 4UY85 3HHEA 3WX4A 3MFHA 3VQTA 1V3SA 5B0CA 2HPUA 4EZ9A 2QA2A 2CG4A 3M32B 2XS7A 1IQZA 4PXEA 4V19J 4B3MF 3FMBA 3WC2A 2RF2B 2IVMA 1FXDA 2FJDB 2KKHA 2BW2A 2WBRA 3IA0A 5KG5A 4I2PB 1GT8A 2YKAA 4WU3A 2DGQA 4DFJA 3LP2A 1QM9A 4J5OA 1ZAVA 2VFUA 2UXDF 1TKXA 3RB4A 2VONA 2CPIA 1VLYA 1KQFB 4NLVA 3H40A 3MAQA 3J7ZT 5KFGA 2FJEB 1A7GE 1FKPB 4NLWA 3CCUS 4P7TA 4DPOA 3RB3A 1C0TB 2DR9A 1HQEB 5KFZA 4X4NA 4BHQA 2DRBA 4WFZA 2YH0A 2ZNZA 1H6KX 2V9WA 1ZOTA 5LXYA 2LQ5A 2RRAA 1M5KC 1WF2A 2M7SA 5F8NA 4JV2A 3RRKA 4OX7A 4CO1A 1X4AA 2VASA 2LEBA 4DR4F 3NKYA 3TUIC 3GV5B 3HHLD 1JNRB 2VKZG 4P7VA 1TK0A 1NK9A 2J9CA 4C8MA 2O3DA 1HD1A 1X4GA 2B6AA 2HNZB 1S6PB 3N79A 2ZJQQ 4J9RA 4GC7A 3MPVA 5T7LA 4YEAA 2QSWA 1VQOS 1U49A 4EEYA 2V8GA 5IZHA 1R8BA 2UZAA 4QWCA 2BACA 4X4TA 3QO9B 1FO1A 1SUQB 2N82B 1FE0A 5KFAA 3KFWX 3DOLB 2VG5B 2WONA 2ZDPA 1S1WB 1OQ6A 5B0GA 3G86A 6FDRA 5KT4A 4J9OA 5I3UB 2NSCA 3I82A 3SYZA 3R5BA 2AQ4A 1JLGA 1S72S 1WI6A 2Q6CA 2F4VF 3HHNB 3H2LA 2BQUA 5KFTA 4K5SA 3OXGA 2UUBF 2BM1A 2UXBF 1TL4A 2AX1A 2XMVA 3PO5A 3OUYB 2CYYA 3GR0A 5IQ6A 3I0SA 4UUWA 3K8VA 1SB6A 1YQHA 4U67Q 2FHJA 4JI3F 3QJPA 3IG1B 3V4MA 2YWHA 1WG4A 2W25A 2G9OA 1A9NB 3LH2S 2CPDA 5KFJA 3VAKA 4RWWA 3KJVB 4BC9A 1HPZA 1FCAA 4H54A 1FVQA 2DHGA 1ZZFA 1YRUA 4CTAA 5CCLA 4NLUA 4Q0BA 4G1IA 4YUDA 4TU9A 1YTYA 5DG8A 2WTFA 4IYQA 2IC3B 1X4DA 5DG9A 3JSMA 5JVGQ 5HQ8A 1VK8A 5C24A 2JSXA 4FF1A 3AAWB 3CT9A 2LQBA 3KG4A 3QPIA 1P1TA 3GWCA 1Z1ZA 3T9NA 4EU0A 5CA5A 2XBPA 2HS4A 5CYQB 3T1AA 1MROA 3KLIA 1N5TA 1MMDA 5C42A 4WZMA 4ILRA 5K8OA 2X3GA 3QZ7A 4ZPWR 4GKKF 2XC9A 1HNIB 1Q7LB 2R8JA 2FJWA 2IM0A 3VALA 2Q1LA 1IUJA 1XMBA 3RU0A 2D3UA 4A8SA 2E1RA 3BZQA 5CYMB 1OO0B 2DR8A 2AJQA 4PXBA 1TL1B 2HNDB 2HMIA 1XERA 3VZHA 1K73T 1UFLA 4ELVA 2DPJA 2B4VA 1NZAA 4QYRA 3FZBA 5GAHI 2V94A 4EBDA 4NXMF 2OD6A 3HVWA 4WTYA 4ZVHA 2XGQA 3WC0A 3T5KA 2ZZNA 1KR4A 1ZPWX 4KV8B 2BR0A 4TY8B 4B9TA 5FD1A 1W2BR 4QOTA 4UW2A 3NP5A 5U47A 4RUHA 2DO4A 3TW0A 5A2QY 3SSQA 4N5SA 3CCWA 5B0EA 4NCBA 2QIFA 1WEYA 4QWDA 2Q66A 3SFGA 4ZCMA 3UWTA 2E44A 2J6UA 3LOUA 2XCPA 4KO0A 3THPA 3KMSA 3DMJA 3UCZP 5HP1A 3RR8A 3GIIA 4X4SA 3S1TA 2HS3A 1JXLA 3BR9A 1YGYA 2BUNA 5AXNA 3GQCA 3RBEA 4HKQA 2MY8A 1U24A 4NWBA 3I9V9 3OVSA 1QSSA 4GKJF 3C6TA 2VOPA 1FDAA 1SH2A 1U7LA 3OR2A 1BQXA 2MKJA 4J9KA 2OFHX 1CPZA 3L7PA 3AB4B 2VOOA 3H25A 1R89A 2DNPA 4NLOA 1ZYQA 4I69A 2WAQD 4N47A 3KK3B 2ASJA 4AXJA 1R3NA 1VQMS 1Y0HA 3DU5A 4O4GB 4KB7A 4MK8A 1XR5A 1G7CB 2HQ3A 3M2RA 2ZH9A 3VAFA 4DQQA 1L3SA 4AYBD 4MKYA 1LWCA 3MD1A 4FS1A 3S8SA 5L9XA 2F9DA 2OPPB 3NWGA 4FN5A 1VQPS 1VQ8S 4ZPTR 4TLQA 3IC1A 4K4ZA 2MQPA 3S6EA 2R7OA 3O44A 2F1FA 3I0RA 2HHSA 1ZZNA 1KTQA 1G6BA 4ZMMA 1TL3A 3IRXB 2V5HG 4W90B 2BRKA 3I4PA 4PKDB 5KAKA 3GB0A 3U1MA 3CCZA 2RQMA 1VQSA 2JVOA 1PGZA 2MQQA 2ZJRQ 5K14B 4C0HA 2XCAA 2XMMA 4H4KA 5C25B 2YKMA 3GG0A 5HMYA 2ZD1B 4IQMA 4NLTA 4A8KA 3KLFB 3H5UA 2ZZMA 3KLGA 2KT5A 4NA2A 2HHPA 3I31A 3H59A 4A8QA 1VI7A 2IM3A 2R7RA 1XC9A 2WB1D 2HVZA 4DX8H 4ZK7M 5F9NA 4IRCA 3QGGA 4KKOA 1DQAA 4DOZA 1KOHA 3PRBA 5LMNF 5LL6d 4F25A 2RRNA 1K0VA 2FC8A 1Z2LA 2BVZA 4CI0B 3AJ1A 1GTHA 1RTHA 2BJEA 3POTA 2ERRA 5GADU 5HLFA 1FXLA 1J5OB 4I2QB 4TN2A 1S0VA 2AYBA 1CC8A 4R25A 2DCUB 2AGQA 3LP2B 2L08A 1FK9A 2GGPA 2VC0A 2EFNA 2HNYA 1TKXB 4C0BA 1RWUA 2CQHA 3JYTA 3M30A<