2AP9A

Crystal structure of acetylglutamate kinase from mycobacterium tuberculosis cdc1551
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
299
structure length
299
Chain Sequence
IEALPTHIKAQVLAEALPWLKQLHGKVVVVKYGGNAMTDDTLRRAFAADMAFLRNCGIHPVVVHGGGPQITAMLRRLGIEGDFKGGFRVTTPEVLDVARMVLFGQVGRELVNLINAHGPYAVGITGEDAQLFTAVRRSVTVDGVATDIGLVGDVDQVNTAAMLDLVAAGRIPVVSTLAPDADGVVHNINADTAAAAVAEALGAEKLLMLTDIDGLYTRWPDRDSLVSEIDTGTLAQLLPTLELGMVPKVEACLRAVIGGVPSAHIIDGRVTHCVLVELFTDAGTGTKVVRGEGHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of acetylglutamate kinase from Mycobacterium tuberculosis CDC1551
rcsb
source organism Mycobacterium tuberculosis
molecule tags Signaling protein,transferase
molecule keywords acetylglutamate kinase
total genus 74
structure length 299
sequence length 299
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.2.8: Acetylglutamate kinase.
pdb deposition date 2005-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00696 AA_kinase Amino acid kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1160.10 Alpha Beta 3-Layer(aba) Sandwich Carbamate kinase Acetylglutamate kinase-like 2ap9A00
2BUFA 3K56A 3C1NA 2E9YA 1E19A 3S6GA 4NDOA 4KZTA 2IJ9A 2BNFA 3B8GA 2WE4A 3K52A 2BRIA 3C1MA 4NDOB 1GS5A 4JZ7A 3K4YA 4NDRA 3S6KA 3AB2A 3QURA 4OLCA 3ZZGA 4F6TB 4A7XA 2JJ4A 2BNDA 3NWYA 2A1FA 4USJA 1OHAA 3WWNA 4Q1TA 2R8VA 3KZFA 1Z9DA 3T7BA 2HMFA 3D40A 3C20A 2BRXA 1B7BA 2J4KA 4AB7A 3D41A 2BNEA 2V5HA 3LL5A 3WWMA 3QUNA 2RD5A 4JZ8A 3S6HA 2VA1A 2J0WA 2J4LA 4I49A 1OH9A 4AXSA 3ZZIA 4NDRB 3EK5A 2AP9A 2J4JA 3EK6A 3QUOA 3TVIA 3QVFA 3K4OA 3L86A 3ZZFA 2BTYA 2WXBA 3L76A 4JZ9A 3AAWA 4NDPB 2R98A 2V4YA 1GSJA 2WE5A 1OHBA 3D2PA 2W21A 3AB4A 2AKOA 3D2MA 2J5VA 1YBDA 3ZZHA 2OGXA 4NDQB 2JI5A 2JJXA 2J0XA 4NDQA 2X2WA 4F6TA 4A7WA 2CDQA 3U6UA 2OGXB 2J5TA 3LKKA 4NDPA 3LL9A 3QVHA 2BMUA
chains in the Genus database with same CATH superfamily
2BUFA 3K56A 3C1NA 2E9YA 1E19A 3S6GA 4NDOA 4KZTA 2IJ9A 2BNFA 3B8GA 2WE4A 3K52A 2BRIA 3C1MA 4NDOB 1GS5A 4JZ7A 3K4YA 4NDRA 3S6KA 3AB2A 3QURA 4OLCA 3ZZGA 4F6TB 4A7XA 2JJ4A 2BNDA 3NWYA 2A1FA 4USJA 1OHAA 3WWNA 4Q1TA 2R8VA 3KZFA 1Z9DA 3T7BA 2HMFA 3D40A 3C20A 2BRXA 1B7BA 2J4KA 4AB7A 3D41A 2BNEA 2V5HA 3LL5A 3WWMA 3QUNA 2RD5A 4JZ8A 3S6HA 2VA1A 2J0WA 2J4LA 4I49A 1OH9A 4AXSA 3ZZIA 4NDRB 3EK5A 2AP9A 2J4JA 3EK6A 3QUOA 3TVIA 3QVFA 3K4OA 3L86A 3ZZFA 2BTYA 2WXBA 3L76A 4JZ9A 3AAWA 4NDPB 2R98A 2V4YA 1GSJA 2WE5A 1OHBA 3D2PA 2W21A 3AB4A 2AKOA 3D2MA 2J5VA 1YBDA 3ZZHA 2OGXA 4NDQB 2JI5A 2JJXA 2J0XA 4NDQA 2X2WA 4F6TA 4A7WA 2CDQA 3U6UA 2OGXB 2J5TA 3LKKA 4NDPA 3LL9A 3QVHA 2BMUA
chains in the Genus database with same CATH topology
2BUFA 3K56A 3C1NA 2E9YA 1E19A 3S6GA 4NDOA 4KZTA 2IJ9A 2BNFA 3B8GA 2WE4A 3K52A 2BRIA 3C1MA 4NDOB 1GS5A 4JZ7A 3K4YA 4NDRA 3S6KA 3AB2A 3QURA 4OLCA 3ZZGA 4F6TB 4A7XA 2JJ4A 2BNDA 3NWYA 2A1FA 4USJA 1OHAA 3WWNA 4Q1TA 2R8VA 3KZFA 1Z9DA 3T7BA 2HMFA 3D40A 3C20A 2BRXA 1B7BA 2J4KA 4AB7A 3D41A 2BNEA 2V5HA 3LL5A 3WWMA 3QUNA 2RD5A 4JZ8A 3S6HA 2VA1A 2J0WA 2J4LA 4I49A 1OH9A 4AXSA 3ZZIA 4NDRB 3EK5A 2AP9A 2J4JA 3EK6A 3QUOA 3TVIA 3QVFA 3K4OA 3L86A 3ZZFA 2BTYA 2WXBA 3L76A 4JZ9A 3AAWA 4NDPB 2R98A 2V4YA 1GSJA 2WE5A 1OHBA 3D2PA 2W21A 3AB4A 2AKOA 3D2MA 2J5VA 1YBDA 3ZZHA 2OGXA 4NDQB 2JI5A 2JJXA 2J0XA 4NDQA 2X2WA 4F6TA 4A7WA 2CDQA 3U6UA 2OGXB 2J5TA 3LKKA 4NDPA 3LL9A 3QVHA 2BMUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BUF A;  3K56 A;  3C1N A;  2E9Y A;  1E19 A;  3S6G A;  4NDO A;  4KZT A;  2IJ9 A;  2BNF A;  3B8G A;  2WE4 A;  3K52 A;  2BRI A;  3C1M A;  4NDO B;  1GS5 A;  4JZ7 A;  3K4Y A;  4NDR A;  3S6K A;  3AB2 A;  3QUR A;  4OLC A;  3ZZG A;  4F6T B;  4A7X A;  2JJ4 A;  2BND A;  3NWY A;  2A1F A;  4USJ A;  1OHA A;  3WWN A;  4Q1T A;  2R8V A;  3KZF A;  1Z9D A;  3T7B A;  2HMF A;  3D40 A;  3C20 A;  2BRX A;  1B7B A;  2J4K A;  4AB7 A;  3D41 A;  2BNE A;  2V5H A;  3LL5 A;  3WWM A;  3QUN A;  2RD5 A;  4JZ8 A;  3S6H A;  2VA1 A;  2J0W A;  2J4L A;  4I49 A;  1OH9 A;  4AXS A;  3ZZI A;  4NDR B;  3EK5 A;  2AP9 A;  2J4J A;  3EK6 A;  3QUO A;  3TVI A;  3QVF A;  3K4O A;  3L86 A;  3ZZF A;  2BTY A;  2WXB A;  3L76 A;  4JZ9 A;  3AAW A;  4NDP B;  2R98 A;  2V4Y A;  1GSJ A;  2WE5 A;  1OHB A;  3D2P A;  2W21 A;  3AB4 A;  2AKO A;  3D2M A;  2J5V A;  1YBD A;  3ZZH A;  2OGX A;  4NDQ B;  2JI5 A;  2JJX A;  2J0X A;  4NDQ A;  2X2W A;  4F6T A;  4A7W A;  2CDQ A;  3U6U A;  2OGX B;  2J5T A;  3LKK A;  4NDP A;  3LL9 A;  3QVH A;  2BMU A; 
#chains in the Genus database with same CATH topology
 2BUF A;  3K56 A;  3C1N A;  2E9Y A;  1E19 A;  3S6G A;  4NDO A;  4KZT A;  2IJ9 A;  2BNF A;  3B8G A;  2WE4 A;  3K52 A;  2BRI A;  3C1M A;  4NDO B;  1GS5 A;  4JZ7 A;  3K4Y A;  4NDR A;  3S6K A;  3AB2 A;  3QUR A;  4OLC A;  3ZZG A;  4F6T B;  4A7X A;  2JJ4 A;  2BND A;  3NWY A;  2A1F A;  4USJ A;  1OHA A;  3WWN A;  4Q1T A;  2R8V A;  3KZF A;  1Z9D A;  3T7B A;  2HMF A;  3D40 A;  3C20 A;  2BRX A;  1B7B A;  2J4K A;  4AB7 A;  3D41 A;  2BNE A;  2V5H A;  3LL5 A;  3WWM A;  3QUN A;  2RD5 A;  4JZ8 A;  3S6H A;  2VA1 A;  2J0W A;  2J4L A;  4I49 A;  1OH9 A;  4AXS A;  3ZZI A;  4NDR B;  3EK5 A;  2AP9 A;  2J4J A;  3EK6 A;  3QUO A;  3TVI A;  3QVF A;  3K4O A;  3L86 A;  3ZZF A;  2BTY A;  2WXB A;  3L76 A;  4JZ9 A;  3AAW A;  4NDP B;  2R98 A;  2V4Y A;  1GSJ A;  2WE5 A;  1OHB A;  3D2P A;  2W21 A;  3AB4 A;  2AKO A;  3D2M A;  2J5V A;  1YBD A;  3ZZH A;  2OGX A;  4NDQ B;  2JI5 A;  2JJX A;  2J0X A;  4NDQ A;  2X2W A;  4F6T A;  4A7W A;  2CDQ A;  3U6U A;  2OGX B;  2J5T A;  3LKK A;  4NDP A;  3LL9 A;  3QVH A;  2BMU A; 
#chains in the Genus database with same CATH homology
 2BUF A;  3K56 A;  3C1N A;  2E9Y A;  1E19 A;  3S6G A;  4NDO A;  4KZT A;  2IJ9 A;  2BNF A;  3B8G A;  2WE4 A;  3K52 A;  2BRI A;  3C1M A;  4NDO B;  1GS5 A;  4JZ7 A;  3K4Y A;  4NDR A;  3S6K A;  3AB2 A;  3QUR A;  4OLC A;  3ZZG A;  4F6T B;  4A7X A;  2JJ4 A;  2BND A;  3NWY A;  2A1F A;  4USJ A;  1OHA A;  3WWN A;  4Q1T A;  2R8V A;  3KZF A;  1Z9D A;  3T7B A;  2HMF A;  3D40 A;  3C20 A;  2BRX A;  1B7B A;  2J4K A;  4AB7 A;  3D41 A;  2BNE A;  2V5H A;  3LL5 A;  3WWM A;  3QUN A;  2RD5 A;  4JZ8 A;  3S6H A;  2VA1 A;  2J0W A;  2J4L A;  4I49 A;  1OH9 A;  4AXS A;  3ZZI A;  4NDR B;  3EK5 A;  2AP9 A;  2J4J A;  3EK6 A;  3QUO A;  3TVI A;  3QVF A;  3K4O A;  3L86 A;  3ZZF A;  2BTY A;  2WXB A;  3L76 A;  4JZ9 A;  3AAW A;  4NDP B;  2R98 A;  2V4Y A;  1GSJ A;  2WE5 A;  1OHB A;  3D2P A;  2W21 A;  3AB4 A;  2AKO A;  3D2M A;  2J5V A;  1YBD A;  3ZZH A;  2OGX A;  4NDQ B;  2JI5 A;  2JJX A;  2J0X A;  4NDQ A;  2X2W A;  4F6T A;  4A7W A;  2CDQ A;  3U6U A;  2OGX B;  2J5T A;  3LKK A;  4NDP A;  3LL9 A;  3QVH A;  2BMU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...