2AP9A

Crystal structure of acetylglutamate kinase from mycobacterium tuberculosis cdc1551
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
299
structure length
299
Chain Sequence
IEALPTHIKAQVLAEALPWLKQLHGKVVVVKYGGNAMTDDTLRRAFAADMAFLRNCGIHPVVVHGGGPQITAMLRRLGIEGDFKGGFRVTTPEVLDVARMVLFGQVGRELVNLINAHGPYAVGITGEDAQLFTAVRRSVTVDGVATDIGLVGDVDQVNTAAMLDLVAAGRIPVVSTLAPDADGVVHNINADTAAAAVAEALGAEKLLMLTDIDGLYTRWPDRDSLVSEIDTGTLAQLLPTLELGMVPKVEACLRAVIGGVPSAHIIDGRVTHCVLVELFTDAGTGTKVVRGEGHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of acetylglutamate kinase from Mycobacterium tuberculosis CDC1551
rcsb
source organism Mycobacterium tuberculosis
molecule tags Signaling protein,transferase
molecule keywords acetylglutamate kinase
total genus 74
structure length 299
sequence length 299
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.2.8: Acetylglutamate kinase.
pdb deposition date 2005-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00696 AA_kinase Amino acid kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1160.10 Alpha Beta 3-Layer(aba) Sandwich Carbamate kinase Acetylglutamate kinase-like 2ap9A00
1B7BA 1YBDA 4OLCA 3LL5A 3K4YA 2BRIA 3ZZIA 3QVHA 2JJXA 3LL9A 1OHBA 4NDOB 3WWNA 2R8VA 4F6TA 1Z9DA 2WXBA 4JZ9A 3B8GA 2BTYA 3QUNA 1GSJA 3EK5A 4JZ7A 1GS5A 2V4YA 2X2WA 2R98A 2RD5A 2JJ4A 4A7XA 1E19A 3WWMA 2VA1A 4AB7A 2JI5A 4F6TB 4Q1TA 3L76A 3QURA 2BNFA 3ZZHA 2BNDA 3K56A 2IJ9A 3NWYA 3QVFA 4JZ8A 4I49A 3U6UA 3C1NA 3ZZFA 4AXSA 2E9YA 2BRXA 2J5VA 2A1FA 2J5TA 3QUOA 4KZTA 2BUFA 2WE4A 3AB4A 3S6GA 3D40A 3T7BA 4NDOA 3D2MA 2HMFA 3TVIA 2J4JA 2BNEA 3AAWA 2J0XA 2J4LA 3AB2A 3K52A 2AP9A 2V5HA 3C1MA 2OGXA 2CDQA 3LKKA 3S6HA 4NDQB 4NDPB 3D41A 4NDPA 3K4OA 4NDQA 2BMUA 3D2PA 3S6KA 2W21A 3KZFA 3EK6A 4NDRA 1OHAA 2AKOA 4NDRB 4USJA 2J0WA 2OGXB 2J4KA 2WE5A 1OH9A 3ZZGA 3L86A 3C20A 4A7WA
chains in the Genus database with same CATH superfamily
1B7BA 1YBDA 4OLCA 3LL5A 3K4YA 2BRIA 3ZZIA 3QVHA 2JJXA 3LL9A 1OHBA 4NDOB 3WWNA 2R8VA 4F6TA 1Z9DA 2WXBA 4JZ9A 3B8GA 2BTYA 3QUNA 1GSJA 3EK5A 4JZ7A 1GS5A 2V4YA 2X2WA 2R98A 2RD5A 2JJ4A 4A7XA 1E19A 3WWMA 2VA1A 4AB7A 2JI5A 4F6TB 4Q1TA 3L76A 3QURA 2BNFA 3ZZHA 2BNDA 3K56A 2IJ9A 3NWYA 3QVFA 4JZ8A 4I49A 3U6UA 3C1NA 3ZZFA 4AXSA 2E9YA 2BRXA 2J5VA 2A1FA 2J5TA 3QUOA 4KZTA 2BUFA 2WE4A 3AB4A 3S6GA 3D40A 3T7BA 4NDOA 3D2MA 2HMFA 3TVIA 2J4JA 2BNEA 3AAWA 2J0XA 2J4LA 3AB2A 3K52A 2AP9A 2V5HA 3C1MA 2OGXA 2CDQA 3LKKA 3S6HA 4NDQB 4NDPB 3D41A 4NDPA 3K4OA 4NDQA 2BMUA 3D2PA 3S6KA 2W21A 3KZFA 3EK6A 4NDRA 1OHAA 2AKOA 4NDRB 4USJA 2J0WA 2OGXB 2J4KA 2WE5A 1OH9A 3ZZGA 3L86A 3C20A 4A7WA
chains in the Genus database with same CATH topology
1B7BA 1YBDA 4OLCA 3LL5A 3K4YA 2BRIA 3ZZIA 3QVHA 2JJXA 3LL9A 1OHBA 4NDOB 3WWNA 2R8VA 4F6TA 1Z9DA 2WXBA 4JZ9A 3B8GA 2BTYA 3QUNA 1GSJA 3EK5A 4JZ7A 1GS5A 2V4YA 2X2WA 2R98A 2RD5A 2JJ4A 4A7XA 1E19A 3WWMA 2VA1A 4AB7A 2JI5A 4F6TB 4Q1TA 3L76A 3QURA 2BNFA 3ZZHA 2BNDA 3K56A 2IJ9A 3NWYA 3QVFA 4JZ8A 4I49A 3U6UA 3C1NA 3ZZFA 4AXSA 2E9YA 2BRXA 2J5VA 2A1FA 2J5TA 3QUOA 4KZTA 2BUFA 2WE4A 3AB4A 3S6GA 3D40A 3T7BA 4NDOA 3D2MA 2HMFA 3TVIA 2J4JA 2BNEA 3AAWA 2J0XA 2J4LA 3AB2A 3K52A 2AP9A 2V5HA 3C1MA 2OGXA 2CDQA 3LKKA 3S6HA 4NDQB 4NDPB 3D41A 4NDPA 3K4OA 4NDQA 2BMUA 3D2PA 3S6KA 2W21A 3KZFA 3EK6A 4NDRA 1OHAA 2AKOA 4NDRB 4USJA 2J0WA 2OGXB 2J4KA 2WE5A 1OH9A 3ZZGA 3L86A 3C20A 4A7WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B7B A;  1YBD A;  4OLC A;  3LL5 A;  3K4Y A;  2BRI A;  3ZZI A;  3QVH A;  2JJX A;  3LL9 A;  1OHB A;  4NDO B;  3WWN A;  2R8V A;  4F6T A;  1Z9D A;  2WXB A;  4JZ9 A;  3B8G A;  2BTY A;  3QUN A;  1GSJ A;  3EK5 A;  4JZ7 A;  1GS5 A;  2V4Y A;  2X2W A;  2R98 A;  2RD5 A;  2JJ4 A;  4A7X A;  1E19 A;  3WWM A;  2VA1 A;  4AB7 A;  2JI5 A;  4F6T B;  4Q1T A;  3L76 A;  3QUR A;  2BNF A;  3ZZH A;  2BND A;  3K56 A;  2IJ9 A;  3NWY A;  3QVF A;  4JZ8 A;  4I49 A;  3U6U A;  3C1N A;  3ZZF A;  4AXS A;  2E9Y A;  2BRX A;  2J5V A;  2A1F A;  2J5T A;  3QUO A;  4KZT A;  2BUF A;  2WE4 A;  3AB4 A;  3S6G A;  3D40 A;  3T7B A;  4NDO A;  3D2M A;  2HMF A;  3TVI A;  2J4J A;  2BNE A;  3AAW A;  2J0X A;  2J4L A;  3AB2 A;  3K52 A;  2AP9 A;  2V5H A;  3C1M A;  2OGX A;  2CDQ A;  3LKK A;  3S6H A;  4NDQ B;  4NDP B;  3D41 A;  4NDP A;  3K4O A;  4NDQ A;  2BMU A;  3D2P A;  3S6K A;  2W21 A;  3KZF A;  3EK6 A;  4NDR A;  1OHA A;  2AKO A;  4NDR B;  4USJ A;  2J0W A;  2OGX B;  2J4K A;  2WE5 A;  1OH9 A;  3ZZG A;  3L86 A;  3C20 A;  4A7W A; 
#chains in the Genus database with same CATH topology
 1B7B A;  1YBD A;  4OLC A;  3LL5 A;  3K4Y A;  2BRI A;  3ZZI A;  3QVH A;  2JJX A;  3LL9 A;  1OHB A;  4NDO B;  3WWN A;  2R8V A;  4F6T A;  1Z9D A;  2WXB A;  4JZ9 A;  3B8G A;  2BTY A;  3QUN A;  1GSJ A;  3EK5 A;  4JZ7 A;  1GS5 A;  2V4Y A;  2X2W A;  2R98 A;  2RD5 A;  2JJ4 A;  4A7X A;  1E19 A;  3WWM A;  2VA1 A;  4AB7 A;  2JI5 A;  4F6T B;  4Q1T A;  3L76 A;  3QUR A;  2BNF A;  3ZZH A;  2BND A;  3K56 A;  2IJ9 A;  3NWY A;  3QVF A;  4JZ8 A;  4I49 A;  3U6U A;  3C1N A;  3ZZF A;  4AXS A;  2E9Y A;  2BRX A;  2J5V A;  2A1F A;  2J5T A;  3QUO A;  4KZT A;  2BUF A;  2WE4 A;  3AB4 A;  3S6G A;  3D40 A;  3T7B A;  4NDO A;  3D2M A;  2HMF A;  3TVI A;  2J4J A;  2BNE A;  3AAW A;  2J0X A;  2J4L A;  3AB2 A;  3K52 A;  2AP9 A;  2V5H A;  3C1M A;  2OGX A;  2CDQ A;  3LKK A;  3S6H A;  4NDQ B;  4NDP B;  3D41 A;  4NDP A;  3K4O A;  4NDQ A;  2BMU A;  3D2P A;  3S6K A;  2W21 A;  3KZF A;  3EK6 A;  4NDR A;  1OHA A;  2AKO A;  4NDR B;  4USJ A;  2J0W A;  2OGX B;  2J4K A;  2WE5 A;  1OH9 A;  3ZZG A;  3L86 A;  3C20 A;  4A7W A; 
#chains in the Genus database with same CATH homology
 1B7B A;  1YBD A;  4OLC A;  3LL5 A;  3K4Y A;  2BRI A;  3ZZI A;  3QVH A;  2JJX A;  3LL9 A;  1OHB A;  4NDO B;  3WWN A;  2R8V A;  4F6T A;  1Z9D A;  2WXB A;  4JZ9 A;  3B8G A;  2BTY A;  3QUN A;  1GSJ A;  3EK5 A;  4JZ7 A;  1GS5 A;  2V4Y A;  2X2W A;  2R98 A;  2RD5 A;  2JJ4 A;  4A7X A;  1E19 A;  3WWM A;  2VA1 A;  4AB7 A;  2JI5 A;  4F6T B;  4Q1T A;  3L76 A;  3QUR A;  2BNF A;  3ZZH A;  2BND A;  3K56 A;  2IJ9 A;  3NWY A;  3QVF A;  4JZ8 A;  4I49 A;  3U6U A;  3C1N A;  3ZZF A;  4AXS A;  2E9Y A;  2BRX A;  2J5V A;  2A1F A;  2J5T A;  3QUO A;  4KZT A;  2BUF A;  2WE4 A;  3AB4 A;  3S6G A;  3D40 A;  3T7B A;  4NDO A;  3D2M A;  2HMF A;  3TVI A;  2J4J A;  2BNE A;  3AAW A;  2J0X A;  2J4L A;  3AB2 A;  3K52 A;  2AP9 A;  2V5H A;  3C1M A;  2OGX A;  2CDQ A;  3LKK A;  3S6H A;  4NDQ B;  4NDP B;  3D41 A;  4NDP A;  3K4O A;  4NDQ A;  2BMU A;  3D2P A;  3S6K A;  2W21 A;  3KZF A;  3EK6 A;  4NDR A;  1OHA A;  2AKO A;  4NDR B;  4USJ A;  2J0W A;  2OGX B;  2J4K A;  2WE5 A;  1OH9 A;  3ZZG A;  3L86 A;  3C20 A;  4A7W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...