2APFA

Crystal structure of the a52v/s54n/k66e variant of the murine t cell receptor v beta 8.2 domain
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
112
structure length
112
Chain Sequence
ILEAAVTQSPRNKVAVTGEKVTLSCQQTNNHNNMYWYRQDTGHGLRLIHYSYGVGNTEKGDIPDGYEASRPSQEQFSLILELATPSQTTVYFCASGGGGTLYFGAGTRLSVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords T cell receptor beta chain V
publication title Structural basis of affinity maturation and intramolecular cooperativity in a protein-protein interaction.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Immune system
total genus 30
structure length 112
sequence length 112
ec nomenclature
pdb deposition date 2005-08-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2apfA00
2IQAA 2XQBL 2CLVA 5DRNB 2VUOA 1MCPH 4JCLA 4LEXL 2Y7QB 1CGWA 3CC5A 5C0AD 3VMOA 5IEKB 3ARWA 4XPGL 1KXQE 5TDPB 4X0KA 3QUYB 4AH2B 1LK2B 5DUPL 1CL7L 5D93C 4P57A 1KOAA 1F45A 2W9EL 4BH7A 3MLZL 4NQCB 3T08A 4AEIL 3MGOB 1TZIA 1FIGH 2HWZL 5BQ7A 4I3RH 4IRZL 4JCMA 1GZPA 1FAKT 5BV7B 2BNRE 4DEPB 4HIHA 4DKFH 2XRAH 2YC1A 1KIRA 4LSQH 5IGXL 1N64L 1YPZF 4C56E 2EIZA 3VH8A 3NFSH 1ACYH 2VDOH 4ELKB 1INEL 5AYQA 2IPTH 5GS0L 5T3ZD 3ZDYE 4G7YH 3ULSA 5HDQH 1I8LA 1SY6H 4WJ5A 4LCWB 2CIKA 4XP5H 2HJKB 3K2UL 3QNXA 1JZ2A 2YPKA 3MNVA 4OGYH 4Z7VE 4YO0B 3UCRA 2Q3AA 1HXYB 2VDQL 4H25B 3VXRB 4N8VG 4LLDA 4DK3A 2DWDA 4POZD 4ZS7L 1ZOXA 3QG6B 3FB6A 4MDIB 4D3CL 3RI5F 3P77B 3UZVB 3VD3A 4KZEL 2VB5A 1FL3A 4HMCA 4NZRL 1OHQA 5CCKH 2BY1A 5MEPA 3MRLB 4B5EA 2BNRA 1IGTA 2XZAL 4P4KB 3U0PA 2GCYB 4Z76A 1YNTA 2EYTB 4A6YB 4X6CB 2DBLL 5DURD 3SKUD 4C56A 2NLJB 3DUSB 4WWKC 2BVPA 3I75B 4UILL 5HVHB 4M8VA 3RI5K 2VXVL 3K1DA 4RBPK 3MROA 4Z5RA 4XNZC 1LEIA 1F02I 1MPAL 1ND0B 4BZYA 3CUPA 3LN5B 4XH2B 4PS4L 1NDGA 1PSKH 1QVOA 2NR6C 2V9TA 4Z7VA 4I1NB 4UT9H 4S1QL 1YQVL 4P5TD 1LO2H 4IOFC 5H2BA 3TYFB 3V9FA 3WO3B 3L3IB 3HC3H 3ZYJA 2OL3A 4M8QB 5E5MA 1IEHA 1WZLA 2IFFL 4OFYD 3ULUL 1RVFH 5D70H 1UB5B 3TYGL 3ARSA 5MP6L 3K74B 2BSRA 2W65B 5I6XC 3I2CH 1V7MH 1OPGL 4TULH 2BCKA 2YPVH 2VDRL 3PDDA 4H8WH 3TGXA 1XR8A 2ADJB 4YDJB 5JHDE 4JLRB 8FABA 3SCMC 4FFVC 5GIRA 4WUKL 1RUPL 5HI4C 2H2SC 1JBJA 3IFPB 3WDHA 4L3EE 1BREA 3GMLA 3IJHA 3TZVA 1JF1A 3TC9A 5BS0A 1I3UA 3NGBB 4DK6A 5IROA 1YEEL 5HHOB 2Q7NA 2WAHA 5L6YL 5ADOL 3LKSB 3B6SA 4KTDL 1VACA 3MXWL 1FO0A 4QXTB 4PJXF 1I1YA 3GKWL 1GZQA 2VLKD 3GJFK 1EFXD 1YYMH 4OI8A 3Q5OA 5C07D 4BUHA 3NCMA 1G7LB 3SDDA 3NZ8A 3WJLA 4JM2C 4Q6IA 5JHDA 1NC4D 5DFVC 1J0IA 1WEJL 4LU5H 4CN4A 3MJ6A 2A73A 4JDTH 2FHCA 1AO7D 3HUJE 4HJ0D 3ZL4L 4L8BB 2DI7A 4XAKE 5C0AE 5C0FB 1BQLL 3QNYA 4JFZL 3OZ9L 4L3EA 3VXUD 1U8OB 1JTTA 2EE6A 3ALWA 3KPTA 3RJQB 3RWGA 5KVFH 5A16A 4OCSH 4ODVL 3P4MA 2AKRA 5F7EL 2DQTL 3WFEL 4MQXC 2GAZA 3BEVA 4QYOA 4ZTPH 1S7QB 1IAOA 2QL1A 4B41A 1NCUA 1INQB 3DV4A 4PR5B 2ESVB 5IBTL 3HAEA 1VPOH 4S0TD 1GGUA 4RWYL 2ZSVB 4LLYB 2FEEL 1UCBL 1HOCA 4MA1B 2UVEA 5FUOL 3HMXL 4BFIB 1KFAH 4MNHB 5DJXA 2WBJA 2QQLH 4HMDA 5GS1A 2UUDH 3VXPA 3LQAC 4W70A 3BI9X 4DWHA 4WHDA 5GS2D 5CBAA 3KJ6H 3D48R 5IHLB 3P0VL 1G6VK 2CK0L 3GMRB 3HUJA 3HG1E 4HQQH 3CLEH 1RZKL 1RHHB 3X14B 4UINH 5C0AA 3D2UB 5FAAA 3GHBH 1WICA 1QBAA 4Z8FH 1FNFA 1UWXK 3OQ3B 3GK8L 2BHZA 3EDEA 1X5KA 2YZ1A 2MQ0A 4NGHH 1IQDB 5SWQA 4GW1B 4MWFA 4LOUC 4F7MB 1CDYA 1WAAF 5KN5B 2D0GA 4WRLA 3WS6C 5CEZE 3RGHA 1EUUA 3E2HC 1I9IL 4PGCA 5MEQA 5E9DE 4PRHD 1C5DA 3TO4C 3RIFF 1JVKA 4XC3L 1FYTE 1S7TB 1K8IB 1YPZB 4HUWA 1LNUB 4K07A 3RWIB 2BX5A 1QNZL 4TUOB 3WDJA 5CGYD 5M7QA 4KI5C 2HKHH 3DO7A 1RUMH 2E9BA 1WT5C 1TVHB 4UT7L 4OV5B 5CJ5A 4OF5A 1CDBA 3MLTB 3QQNA 3MOQA 4PJIE 4QHLB 5KANI 1U8HA 1F5WA 1DQQB 3VWJD 4GQ9H 5CSZB 3BKYH 3QUYC 5L2KB 2ZOKA 3L3JB 1CTOA 4KKBD 3RIFK 2A83B 3HG1A 1A5FH 1UM4H 2A6KB 1EO8H 4Y4FD 2XI9A 3MRPA 4M5ZH 5F7FA 1CN4A 2XIDA 1IGMH 3F62A 3RY5A 4ZAKD 2ZCKL 5INDB 1T4KB 5IFHL 4YXHL 5BV7C 5IB2A 3ARUA 4DEPC 4TVPL 3PHQA 2XWBA 5JMOC 4A2LA 3P4NA 1EFQA 3KS0J 2WQ8A 3QIUB 5E9DA 3VCLB 1JYXA 3HG1B 4N0RA 3UMTA 2AEQL 2ZCHH 1L0XA 5DJDB 1FYTA 2ZOLB 2DLIA 4LSTL 1LO0H 3QUXB 4RFEB 3BVNB 1N3NB 3TBYB 3T3ME 4Y19D 3V52L 5I19H 3OHXA 1EEZA 1K4DA 4EQ3A 1TJIL 2HMID 4CADB 3DYOA 1IEAA 4YXLL 3DI2B 4PJIA 3FL7A 1HDMB 3H9HA 1HK6A 4PYHA 5TGBB 5C08D 3FB7A 5LAXB 2ZUVA 2ITCA 1A3RH 5I1JL 4NOFA 1SJEB 2J8HA 5DEGA 3AY4C 2FJHB 2FEDD 3I3DA 4NJ9L 4P5TA 4OLZH 1I8LC 3LEXA 2ENSA 4NC1C 1LD9A 1ORQA 5B39G 1HQRB 4LKCA 2XA8L 4NZTH 4P5MB 1UJ3B 4OFYA 4WEMB 4P4KC 1WBZA 5FCUH 3G6DL 2R4RH 2WLYA 1DBMH 2ZG2A 5DK0A 4DAGH 2BNQE 4OGAD 3U36B 4NCC1 4W68A 1IEBB 3MTRA 5HVHC 1MH5A 4UTAH 5FYLL 5E8NB 2VABA 1EK3A 1K3IA 4GXVL 5DZNA 3QRGH 3IRZA 4L4TB 3UTTD 1F00I 5A2IH 3GB7B 2A0LD 2X40A 4NKMB 4OCXL 3O4LB 4QHUB 3WN5B 3HFML 2H1PH 3RTQB 1AGCA 3JWDL 2OP4H 3GJFB 1WZMA 3UPCA 3QULA 2XQBH 1SJHA 1JRHL 4LEXH 4PYGA 5JPNA 5I9QB 1PG7W 5IB3A 2Q86B 2PXYA 4XPGH 1ED3B 4RSVA 3W2DL 1CFVL 3O9WB 5GGSY 5DUPH 1MI5B 3EZ8A 5EPMA 4QRTA 1CL7H 3ZTNL 4YBHA 4PJXB 2NTFA 2E9JA 3H6JA 2W9EH 3D87B 3VXME 3MLZH 4K8RL 5KAQG 5L8JB 4AEIH 2VLKA 3HE6B 2HWZH 4IRZH 1A1NB 5CWSB 2XTJE 4FHBD 1FL5B 3OWEA 5C07A 5T5NF 3VFOB 1WAAE 3HKFA 3CXHK 3SKNB 3ZT5A 5IR1A 5IGXH 1NC4A 1N64H 4ZUTA 1PW3A 3MV11 1KACB 1HEZA 4MGXA 2VR4A 5ACZB 3FMGL 1INEH 1P6FA 5C0CD 3W5NA 2BNQB 4QRPE 3NGBC 3LS4L 5GS0H 4MA3B 3UJJL 2ICEA 1WBYA 3VXUA 3MC0A 3NIFF 3K2UH 4NM4L 5EO1A 4GXUM 3C6LA 1J05B 4V1DE 2H8PB 3IJYB 5ETUB 1IZJA 2I5YL 5IR1B 2IADA 3CSGA 5EO0B 5JORA 2VDQH 3RGVA 2XXCB 5SWSD 1P7HL 2PCPB 4NKQB 4ZS7H 1FFPA 3OKLA 3N85L 4D3CH 4HSQA 1C5CL 4YR6A 2H45A 3VXMA 1R5VB 5JW4Q 1X44A 3QFDA 3JV4B 4MXVF 5KOMC 1FV1A 4NZRH 3NOIA 5GGRB 1KGCE 3C6LB 2AJUL 4ZQKA 1FLTX 4MJIB 5LGJB 3L3DB 2ICWI 2XZAH 5EBGA 4BSJA 1WAAA 3BQUA 3LKQB 3T0DA 3V6ZB 1VSCA 2BMKB 5FA3A 2DBLH 4PGEA 4W4OC 4GUPB 1QD0A 2P8LA 5KSAD 4UILH 5MENB 2OYPA 2VXVH 2AXGB 4CKVX 5EBMA 1H3WM 4QRPA 4U6XA 1S9YB 1F4HA 5D7JD 2XG4A 3VXSD 1MPAH 1KCLA 2PYED 4PS4H 4V1DA 1J11A 5C2UB 3UXFA 3KLHC 3BKCL 5GRYA 4H1LB 1KPUA 3BKJL 5F1KC 1JPFA 4S1QH 1YQVH 1PKQE 3CX2A 5HHQA 3OKEA 2RFXA 2AQ2A 1FP5A 2XFXB 4MA1C 1XF2B 3QHFL 4FXLA 3B43A 4QRPB 2IFFH 2ADGB 5GHWL 3ULUH 3QDME 5ESQB 3MYZA 3TYGH 4HUUA 1ACZA 4CAGA 5MP6H 2DMCA 3OJDA 5I73B 2XQYK 4KJQC 3BZ4B 3MRGA 1OPGH 5C08E 2VDRH 5ENWB 3RP1A 1M05A 3BJ91 4PG9A 1OAKL 5FCSH 1KSRA 3B4NA 2KBGA 2NX5E 4WUKH 1QR4A 4MCZA 1RUPH 2PR4L 4RGOL 3GIZL 1VERA 4RNRB 3C8HA 4KVNL 4AENA 4LEOA 3C08L 3VJ6B 3IDGA 4ZUSA 1BZ7A 3TH2T 1XZ0B 5E8EA 1EEQA 4LKXA 4CJ0A 1YEEH 4LNRA 5L8KB 4I77L 4KMQA 1MHHB 1XF4A 2ZG1A 4L9LA 1FSKB 5HPOA 5L6YH 5ADOH 4CVWA 4KTDH 3U9UA 3QDMA 1AP2A 3MXWH 2AQ3A 3BPCB 3QQ4A 3WNPA 4ZUWA 3GKWH 3WBDA 4PJGA 5C0JA 2V2TA 4AENB 2W9DL 3EFFB 4IDLA 3O2VL 4JFXB 1E28A 1PKQB 2VSCA 1BFSA 1E4KC 4NUJA 5C08A 5FDWA 3MNZB 1DANT 1NLDL 3QWOB 4WTWA 4YGVA 1RURL 1WEJH 2ICES 3VD4A 4U05A 2FSEB 3D5OF 2W92A 1TIUA 2NX5A 5E2UL 1RIUL 5H94A 3MRIB 2OR9L 1BQLH 3GRWA 5JXED 4JFZH 3OZ9H 2AAVA 5FKPA 3QIUC 1UM6L 4HF5L 4Y1AE 4IMLA 5GZND 4JFDE 1U8MB 4ODVH 2NQCA 4HUMB 1EO7A 5F7EH 3QUXC 1Q1JL 2DQTH 2GSIA 3NIFE 3AS2A 2VN7A 4E42B 4M9OA 5GGUB 4JQXA 3KPRB 1NGXB 1R5WB 2X2YA 4MDJA 4UI2A 5IBTH 3W9EB 1W0YT 4RWYH 3LZFL 1UCBH 3EOTL 4JQVC 5FUOH 2AGJL 3HMXH 3QWRA 4RA0C 5EIQA 3DXAB 3WXWL 2CDGA 1CQKA 3KVQA 3WEXB 1T1XA 1XH3A 4MXVE 4WW1B 4YHOL 1ZA3B 4JKWA 3R0NA 3P0VH 2CK0H 1UJ3C 4Z7OE 2G5BA 4IRJA 1RZKH 4U1KB 3VFRB 4RCAA 2YRZA 1XIWD 4GFTB 1HCVA 5TE6L 4EI5D 3GK8H 5SWSE 3GSWB 5D6DA 1AQDB 4J3SA 4G9FD 4JFDA 5F6IB 3BWUC 2D0HA 3VFMA 2AXFB 1A6ZA 1NAML 4Y5VB 5F97E 2LFGA 4K9EL 4JFFD 1I9IH 1MCOL 2CK2A 4WUUB 4XC3H 3S96B 3WN5C 2DKSA 3RTQC 4HIEB 1QNZH 3PWUB 4Y1AB 1JHKL 4UT7H 3G5XA 5H8DA 5F9WB 4BKLA 2VXSL 5C0CA 5I9QC 4FXKB 1CGYA 4XVSL 2R1XB 3R8QA 4CBPA 3O9WC 2PYEE 3BDYL 1JYWA 3HPJA 4HS3A 4WTZA 5B38G 3IAGC 1G7JB 1EA9C 4X7TA 5CJBA 5SWSA 3HE6C 3MCG1 3GI8L 3CSYB 1XGQA 2ZCKH 5IFHH 4YXHH 1YECL 4CN1A 3ULVD 1U8NB 4O9HL 3MZTA 5C8JB 4X4XA 1HXMA 4TVPH 4CMMA 1CFBA 4GRWF 1AQKL 1KB9K 1NL0L 2EO1A 2VNCA 4R2GB 3HZYB 4YHML 2O61A 2AEQH 1W0VA 1AGEA 1S7SA 4LSTH 4PRNA 2CRZA 4N68A 1ADQL 2CIIB 4FFZH 3V52H 3QI9D 1RJYB 2XWTA 4M7ZB 3OKNA 1G7PA 3OAYK 1TJIH 4YXLH 3CVHA 2CLZA 3EJYC 1EHNA 5B21A 5EZIL 1UACL 4O4YH 2P8MA 5CJ8A 1S7UB 1A6VL 1D5ZB 1X5JA 1ZLSL 3VXSA 5I1JH 5ID1B 2PYEA 3MOAL 3MFFB 2YBRB 4S2SA 1N7ML 2V6HA 1IAIL 5JA9A 4KK6D 4NJ9H 1MJJB 5IV2B 2DLFL 4OI7A 1CFNB 3D9AL 3C6LC 3JUYA 2XA8H 5D7IE 2YEZB 3Q48A 3ETBF 3D6GA 3RVVC 3G6DH 3MRQA 3T2PA 3TNMB 4NBYB 5I0ZA 1CYGA 3EZJB 3LAFA 3FO1B 4KTEL 1BZ9B 1MFDL 4NQUA 4NKOB 1CDCA 3JWNC 4FFYL 5FYLH 3T0BA 1I7UB 4LRIC 4GXVH 4RISL 5FECB 5KSUA 1HHIB 1N4XL 1M6OA 2KKQA 3MA7B 4ENED 3WUWB 4AT6B 5SX4H 3IFNL 4OCXH 3T77A 5A2JH 4Z7UB 3L9RB 3HFMH 3FT3A 1A64A 3QCVL 2GUOA 4C83B 2HT3D 3JWDH 4HGWB 4P23D 2IALA 1JRHH 1JV5B 2Y5TA 3PV6A 4Y8AA 3E6FA 2FJFB 5FGBA 3GJEB 3W2DH 1CFVH 3P4OB 4PLNC 2VISA 2ZSWA 5D7IA 2FIKA 3S88L 3QDJD 3ZTNH 2PNDA 5I73C 1S7WB 3HCVA 4HGKC 3CFCL 3PWLA 1MRFL 2NY6B 3F7YA 3KAAA 1E4WL 3NN8B 3L95A 1H3XA 1U3JA 3CFBA 4K8RH 2OTWA 4GS7B 4PJ8B 1EAPA 2IH1B 2IPKB 4GAYA 1QSVA 3QCTL 3QO1B 3H7BA 2C3HA 4J12A 3Q6FB 2FHBA 2X4UA 1CDJA 2D9QB 2N4IA 3BH8B 1CGSL 4KWUA 1SVZA 1YEJL 2X5PA 2XN9D 3KYAA 1ZLVH 3FMGH 3L5IA 3UYOD 1VFMA 1QRNE 1IARB 1S5IL 25C8H 4NQTA 4NJAL 2E7BA 1X6NA 3TCLA 1B0RB 3UJJH 4ETQA 5DS8B 4GAYB 4ZPVA 4JREB 4NM4H 4WFHE 2VO5A 2H2PC 1QPPA 1FSKC 4MHHG 5C0ND 5FB8B 2I5YH 4ZXBB 5IIEB 1ZGLA 3MLYL 3GZKA 4JHAL 2VLJE 3BUTA 4F15B 4J1UB 3SGJA 2QQQA 2GJZB 3N85H 1PG7L 2EDEA 4LASH 4M6ML 4IMKC 1JE6A 3DVGB 1C5CH 2WIIA 1F3DH 3REVB 3HI1B 2AJUH 5I1HL 1A4JA 1R5IA 4KK8C 3FTGA 3K4DA 1RMFL 1G6RL 4GRWE 1KUMA 2ICWA 4GH7B 3O3DB 5LXGL 4XTRC 4Z0BL 4ZS6D 3FONB 3QQ9D 2HN7B 2RB8A 4PJ5D 1AKJD 5DTFB 1OSZA 1ES0B 1XIWA 5EUKA 3TESA 1X7QB 3QBTB 4EI5A 3KHOA 3O11A 1RHFA 3DRQA 1B2WL 2G2RB 4EKXA 5F21B 1MHCA 4Q7DA 3QPQC 3BKCH 3L5HA 4N90D 1P1ZB 1RQ5A 4PJBF 2VLJA 4JFFA 5FXCH 4NWUL 4PJ9B 4WVRA 1QRNB 3QHFH 1AHWB 4ZOAA 5GHWH 1U95B 2BHUA 2W38A 4GG8A 5EZJB 1VEOA 1FJ1A 3GBML 1WC7B 3D0VB 4OD2B 3UBXG 1CDIA 4JRYE 2A77L 3RA7L 1UYWL 1P84K 2AK1L 5IB4B 4JANA 5FUCE 1OTTC 4GKNA 1OQXA 4KK9C 3KXFB 5IMMA 2IMNA 3VRLF 5HXMA 4I13B 1NCCL 4NQSB 3P11L 4QXGL 2UWEF 1K2DB 1TJGL 4K55A 1OAKH 4DTGL 4WHTA 4PRID 5F6IC 3HMWL 3TCXA 2LU7A 4K71B 1B4RA 4Y5VC 4Y16B 3RVXD 3S4SG 1EZVY 2PR4H 4RGOH 3GIZH 5D96B 4XNXL 4KVNH 3C08H 3U0TA 3GSUA 3SOBL 1MJ8L 4OAWA 2ZPKL 1SYVA 3N50A 1CL7I 4I77H 5IEHB 5F9WC 5D7LD 5BRZD 5CBEA 3IDXL 1OB1A 3O2WL 2PW2A 5K9KA 5JA8B 4DGVL 4LVOB 4JGUA 4MQTB 1WVZA 1CIUA 2W9DH 3KR3L 4AIOA 3S37L 3IFLL 3O2VH 4F9LC 1OGTA 3HZKA 4N8VA 3RY4A 4LLMA 3F8UB 3EO0A 3QT2A 1G9MC 1NLDH 2QHLA 2DQEL 3LN4B 1I7ZB 4XXDA 3TFKD 3D39E 1RURH 1Q9LB 4GG6E 3RL2B 2ATKB 3MPCA 4I2XE 4Y5YB 2FR4A 2PW2B 5E2UH 4D9QE 1FE8L 1UH2A 1Y18B 1RIUH 4HHAA 1OF2B 4LSSL 3ARGA 5EU7E 2OR9H 5DFWH 4JRYB 1D5MA 2XPGA 2EH8L 4R2GC 1UM6H 4YDVA 5CIPB 4HF5H 1SY6A 4FZ8L 4XBPA 1VFAB 3T8XA 1NSNL 1KPVA 1Q1JH 3BGMA 4XXDB 1J88A 2BY3A 2FJGB 4X5WA 1QSED 3VGHA 1UXWB 1GIGL 4NN5B 1K5NB 4M7ZC 4HUKB 3C8KA 1TCMA 2EDYA 2EH7L 3KPSE 2R2HB 4FQIL 3LZFH 1L7IL 1H3UA 3EOTH 1F3RB 2AGJH 1U8IA 3WXWH 1K6QL 4E5XA 2C4XA 1FL6A 1A6AA 1KCSL 3MUGB 3GHEL 4R7DA 4KHTL 4YHOH 3DX6B 2PW1A 4JFQB 1DQJA 3BUYB 4GG6A 3QWQB 1KPRA 1NEUA 3SGDH 2GW5A 5TDOA 5JPMB 3B9KA 2V9RA 2MPAL 1R0AL 2D7NA 2X7LB 5TE6H 3FB8A 5C0IA 1P9MA 1NAMH 5ISZE 1U6AL 2H3NB 3T2OA 4K9EH 4ONFL 2JLLA 5HD8D 3D39B 4PBXA 4XHJD 4P49A 4I2XB 1L0YA 1MCOH 3MBED 3ES6B 3RKDC 3MJ9L 4DKEL 4PJBE 2BY2A 3KPSA 2OZ4L 3EDJA 1S7XA 3PG2A 3CH1A 1JHKH 5FUZL 1U8LB 3WIIL 3MRMB 4WO4B 3WHXB 1I9EA 4QF1A 2VXSH 1RZIA 1FZJA 2OCFD 4MAUL 4XVSH 3VFNB 1AE6L 2CMRL 2J2ZA 4M4RA 2A6IB 3L3GA 5M94B 1XCTB 4IHOB 3SKOA 4NWTL 3BDYH 2FO4A 2ADIA 2AP2A 1RD6A 4FG6D 3EYSL 5LGHL 1GGCL 3A6OA 2NY6C 4N90E 4JE4B 2UWEE 1BECA 1MCWW 2D31B 4GS7C 4PJ8C 1NJ9B 3GI8H 3BD5A 5CGTA 2X89D 4FQQA 1FZJB 1G7IB 4L1DA 5ISZA 1H15A 1YECH 3V95A 4O9HH 5FGBC 3PGFL 1AJ7L 3FQUB 4L3CA 1N59B 4U1NB 1AQKH 5IW1B 1Q38A 1NL0H 1OP3H 3QYCA 4DUXA 4YHMH 5FK9B 1AD0B 4R3SA 5HHPB 3SEPA 3S5LG 5KAQF 4PJBA 1MCFA 3LSOA 1ADQH 3OJMB 2HYMA 4Y7MA 4Y4KA 4M4PA 2GTWB 4JREC 1ZHNA 2E6JA 5BZDA 1IGYA 3RNKB 3ARBB 1AKJA 1NGWA 4OLVL 3U4AA 5EZIH 2Y36L 5HPMB 1UACH 5CZXC 4ZXBC 1A6VH 2VQTA 1ZLSH 4JPIA 3H3PL 3MOAH 4F15C 3ZKSD 2BC4B 1N7MH 4CVZA 5F1NB 1IAIH 4P2OB 3ME0A 1QOKA 1R3LA 2V2XA 4Y89A 3SBWC 4Y4KB 2UWEA 2DJUA 2W59A 1VGEL 2VZVA 2DLFH 2L7UA 3FFCD 3QIBB 3SGKA 4X9FA 3D9AH 1FZOA 4J4PD 3V4UL 5DGQA 2AXJA 1LE5A 3C5JA 3MGAA 1PYWB 1VFBA 2ARJB 2VLMD 4HIJB 5E8OA 3S35X 1RK0B 4M02A 2I9TA 3MBXL 4HK3N 5E6YA 4KTEH 4TTDC 1MFDH 4MVBD 5I18L 1G9NC 2P5WD 4NSKA 2W9LA 4FFYH 1A9EB 4Z7QE 2VDML 1CGXA 4RISH 3MJ7A 3BPNB 5JOPE 4BFBD 2FGZA 4J6RL 1N4XH 4PRIA 1MWAA 4G6FB 4NQED 1WCBA 1CFSA 3IFNH 4POYA 5DF0A 3QCVH 3RZCA 1TQCB 2NY0B 4L29A 4PJ9C 3T0AA 5JXAL 4QHNA 1AHWC 4QOKE 3VXTA 1KJMB 3R8BB 4KRPB 4KK5D 4YJZL 3QFJD 4J3TA 1BLNB 3BW9B 1MWAB 3V6OE 4RA3A 3S88H 3BWAA 4GRLD 5J12B 3CFCH 2DL2A 2BSSA 2YUZA 2GT9B 3IB4A 4G42B 1MRFH 1E4WH 4H0IA 5J6HA 2FL5A 4YFDB 5KOVC 3B9AA 4LLUA 5IM7B 2HA1A 2EDRA 5AUMA 1ZXQA 4UUJA 1AXSA 2YN3A 3QCTH 3REWB 4NT6B 3N1GC 4K71C 4S1SH 4Y16C 1CGSH 1YEJH 3GSNB 3V5KA 3X13B 4KH2A 5D96C 3G08B 5E94A 1M7IA 4GW5A 4JN2B 5D1ZD 1S5IH 4QRRE 2JJSC 4NJAH 3LQAL 5KVMC 2X4OB 4NRZA 2Y23A 3IXTA 4FXGB 3O45A 1DL7L 1QR1A 5KG9B 1BQHG 4NDMA 4QOKA 3GSVB 4CVXA 1BEYL 3RKPA 3KYOA 1H5BA 2XKNA 3MLYH 3DBXB 4JHAH 4LVOC 3OF6D 3ULUF 4HWZB 2FECL 3D3VB 1PG7H 1DQDL 4M6MH 5CGMA 2B5IB 3UDWA 1JYNA 3GSOA 1F13A 5JZ7C 2YD9A 1I3VA 3BZEB 1S9WA 4MA7L 2GY5A 5DRZA 4UZGA 5I1HH 2BVUA 5B39A 3FQWB 1QLRA 1Z5LA 3EYQC 2GFBB 4Y5YC 5KJRL 1RMFH 4NFBA 1G6RH 5IOPA 4PG2C 2LAGB 4YNYB 3O3AA 5LXGH 4TQEL 3G6AA 4Z0BH 5EG6C 3O41A 3GKZA 5FUCC 4APQD 5K9OB 3F6LA 5LKNA 3UEZA 4QRRA 4KJPC 3PGDB 5KZCD 1R3HB 2O26U 4OFDA 4WU7A 1DLHA 1E4JA 4NN5C 1B2WH 1B0GA 2DICA 2VQ1B 4OD3L 3MRRA 4K23L 2YD6A 2JCCE 5TFSL 1JZ5A 5K9JL 4NWUH 5GRWA 1PX3A 5HGBA 1YN6B 2L7JA 5E95B 5BV7L 3GBMH 3T0EE 2A6JA 1DE4B 3TT3L 4U7MA 3NCEB 2A77H 3RA7H 1FC2D 1UYWH 3ZMRA 1T22B 4NBZB 1A6PA 2AK1H 2D4FA 3W5MA 5F88B 5GGRY 2ZP0T 4JPKL 1NCCH 3KJ4B 5DO2C 3HB3C 3P11H 4QXGH 3VFTA 2BOBB 1TJGH 4DTGH 5SX4I 4G8FB 2X10A 3HMWH 5INCB 1T1YA 3IVKB 3PJSB 5T5FL 3UTPD 3DTXA 4Y4HD 1D9KD 3MA9L 4XNXH 2E7LA 2VAJA 1JRHI 1UKTA 2J12B 3GIVA 4MJ2A 1WSST 5EU7C 3RY6A 3G04B 4O2FA 1UKSA 1S9XA 3SOBH 2VLME 1MJ8H 5HDBE 2JCCA 4JQIL 5IWLC 1PEZA 1T0MB 2WV3A 2ZPKH 5EORL 1I1FA 3Q5TA 1RZ8A 4WO4C 2P8PA 4PJFF 4MHHI 4A6YL 4ODXB 1S7RA 3IDXH 3O2WH 4DGVH 3STLB 3T0EA 1NBZB 3KR3H 2GQHA 4YBQC 2H9GA 4XWOC 5JOFB 3S37H 3IFLH 3O8XD 4Z77A 4Z78B 1BWWA 3SQOL 1UB6B 3IKCA 2MHAA 5T1KD 2MFNA 2HG5B 3X3GH 3VDCA 1K85A 2DIAA 2DQEH 2Q6WB 5I75B 1H3GA 2F74A 4MYWB 1KENL 3QUZA 4HKZB 4GO6B 2NXZD 1QEWA 1FE8H 1U8JB 1D5IL 1WGOA 4LSSH 3LKOB 1MHEA 1CICB 1E6OL 1J8HE 2EH8H 3QFJE 4J4PA 4FZ8H 2OM5A 2NXYD 4NNPL 5IB1B 3QXVA 1NSNH 1X5LA 3LH2L 1I8MA 5HYJD 1GIGH 3TJHD 3TN0A 1VADA 4Q6YA 3FCTB 5B22A 5C09E 3TWCL 4OZ4B 3ARBC 1OWRM 2IG2L 2EH7H 2WWKO 2J8OA 2LVCA 4XVJL 3ULUE 4U1IA 4FQIH 3KPPA 4TVPD 4QXUL 1L7IH 5IKCB 3PWJA 2VYRE 3DURB 4I18B 3CH8A 3F12A 3S36L 3KPMB 1K6QH 3QO0B 5DSCB 2DQFB 4P2OC 5E99L 4HS8L 1KCSH 3C5ZD 1P53A 3SE4A 4Y4KC 2YZ8A 3GHEH 4BELD 1VEMA 4KHTH 1LDPL 2RCSL 5BOZG 3QIBC 4G6KL 5GGVY 2VLRD 3UBXI 3FQXA 3TIEA 1BJ1H 1JF5A 3FT4B 4B53A 5KSVA 4XVTL 4M61B 3KHQA 3V7MA 3ESVF 2MPAH 3UYRL 1R0AH 4F3FA 3JV6B 4D0CA 4NPYB 3VD9A 3QFJA 1J8HA 3F12B 3DJ9A 3MRCA 4JG1L 5HI3D 5IFAL 3VXQB 4X4ME 1U6AH 4WNQB 4ZOCA 4I0CC 5F3BA 4NC2B 4FS0A 4ONFH 3TBWB 3DUUA 5IJVB 1FNAA 3BPNC 2OI9B 5C09A 3WNOA 1WBXA 3RVWD 2DTML 1OY3B 3MJ9H 5FM5O 4DKEH 4XP9L 2OZ4H 1TQCC 3KPOB 5C0BE 2NY0C 5FUZH 2HJFB 1UXSB 3BIBX 1ZSDB 5D1ZA 2WWMD 4U1LA 1FO0L 4XNQA 4ZTOL 1QBBA 4KJWD 1T5WB 4KRPC 1AE6H 1QFOA 2CMRH 3DX9B 4KDWA 1IM3A 2Y06L 5F1SA 4NWTH 3C6SB 3GGWB 5IB5B 2GTZB 4L8DA 2V7NB 5J12C 2X4SA 4KVCL 4EI6A 1HKFA 5MI0B 1EFXB 2BNUA 3EYSH 2R9HC 5LGHH 1GGCH 3L7EA 1RZ7L 4G6JL 3EYFA 5BXFB 2W0FA 3IDJB 4M7LT 4ORGA 4EN3D 4IEFB 4IIQA 1EXUB 5FOBB 1K8DA 4D0DA 3DWTA 2UYLB 3PGFH 1AO7B 4X6EB 4JRXD 1YMHB 1PBYA 5T3XE 4PY7A 4PRAA 4M6NL 5BO1L 4P2CG 4GJTB 5ICXA 1IM9B 1UFUA 5EC2A 3PL6D 5ICYA 5C0BA 4MNQE 3T2QA 4O2CA 4P2RD 4WFFE 4K8RD 4PJFE 1YNKL 5J6GB 4LCIL 4OLVH 4HPOL 3OAZH 2Y36H 5MERB 3UTPE 5HJ3B 5JIIA 2VDKL 2FB4L 3MCKA 5HY9B 3SJVD 2GKIA 1N2RA 4XZUB 5J7CC 4WW2F 1OAQL 2B5IC 1ZEAL 5ICYB 4U6YA 3CCHB 1VGEH 2J6EL 4NYLB 4HGMA 4KHXL 4G9DB 1FVDA 3V4UH 5BW7C 1U8KB 3MYJA 5HGHB 2JB6B 1YC8A 4OCYL 3V6OC 1IC1A 1QFUL 2IGFL 4PV8A 4O51A 3WLWD 3MBXH 4Z7NF 4OFIA 2X4QA 3MX0A 2PETA 4MQ7A 4G80A 4QRQB 5I18H 1RK1A 5GZOD 5B3NA 1OGAE 2FNBA 4MNQA 3B3IA 2VDMH 4C55A 4PJFA 4J6RH 4N0UB 4FABL 4EBQL 5E7BA 3HMXA 3FRPG 1JTOA 1P5VA 3WFCL 1OTUD 2P7TA 5FO9B 5EZLB 3CJJA 5BJTB 3HZVA 2R56L 4KTYA 3SGDI 5HYSG 1TFHA 5JXAH 4BZ1L 5IHZB 4XI5D 3LRSB 2G60H 2OQJB 3IF1A 4JY6B 43CAB 5ID0B 3VWJB 3U7YL 3E6HB 5CSGA 1KTLB 1J0ZA 3RQ3A 2IJ0C 3Q3GB 5CEXB 4JY4A 5F6HJ 5EO9A 1U0QA 1EAJA 4HDIA 4QHKJ 2Q76A 3KJ4C 4N9GA 5B38A 4Y4FB 32C2A 4PGZA 4PRBA 3MNWB 1U8PB 3IS0X 2E5EA 4ZAKB 3UJTL 1OGAA 5CEZL 4U3CA 4I4WA 4GRMA 5H35B 2VLRE 5IVXF 1CDGA 1S7VB 1MLCB 4NO0D 5F89A 4RGNE 1T03L 3G9VA 3S3SA 3LQAH 5IMKB 4MMZC 2DQHL 1GGYA 2R0WL 3NCFB 4Z0XB 4Y19B 1DL7H 4ZG1A 4HAFA 1I4FB 1FZKB 2H41A 1BEYH 1IJ9A 5I1IL 2E7LC 3QNZA 5L2JB 1UH3A 2VZOA 4S11A 3WYRA 2CRYA 4LLQA 1A4KA 2NW2B 1SEBB 1DQDH 4POZC 2PTUA 1HN1A 4E41D 3OG6B 1I75A 5I75C 4MA7H 2Q7YB 4TSCL 4RFNB 4DJMA 2NW3B 2VZUA 5KJRH 3BD4A 5F7DB 5EU6D 3HNVL 4UAOB 4TQEH 1IGIL 5D5ME 3T65A 1CICC 5HSFA 2VLRA 4LK4A 5FYLE 4JVPA 2D4DA 4UU9A 5HGDA 3P73A 3EDDA 2EEDA 3OR7A 4IDJL 2I26N 2AJXL 3RWEB 4HUXA 3I6LD 3MV8E 1NUFA 2NY5C 3UTTB 2V9QA 2AW2A 3WFDL 1FG2B 2R69L 4OD3H 3MUJA 1ODAA 1J10A 1DUYA 4K23H 2MJWA 2Z35A 5TFSH 3GMPA 5K9JH 3PIQB 3FT2A 2JE8A 4I18C 5DDHB 4MXQD 5FYJU 1A14L 1XF3A 2B2XL 5BV7H 1MCSA 2FZ3B 1PQZA 3NA4A 2OMNA 2X1OA 3K80A 1BX2B 4Z95L 4XBGB 4ERSL 4X9HA 4QT5A 4XXCA 3TT3H 1JZ7A 4X4YA 3L5WA 4MJ6B 1JN6B 3IGAA 4G43B 2VIRB 3L6FB 3V5HB 2QR0A 1P7KB 5D5MA 1ZANL 2R23B 1PFCA 3QIWA 4Z7NE 3ZDXF 3SJVE 5DQ9B 5F93C 5I76B 5T5FH 1IAKA 4G8GE 1U91B 4XPHL 1KNOB 5HI5D 3MA9H 3L5WB 3ARYA 3EJZD 3CGTA 1HH9A 3GSRA 3MV8A 1A22B 4KY1L 1EHLH 3P40A 2W60B 3HC0B 1ZGLP 3MRKA 4UNUA 4FMKA 2WLZA 4JQIH 3DMMB 1ZVSB 5EORH 5D2NE 3EDKA 4XRCB 3ABZA 4RMTA 1HYSC 2EEAA 4XPAL 1HHKA 4A6YH 1YC7A 3HHRB 2HFEA 5C6TL 4NNXA 4M3JA 5MI0C 3KPNA 3SQOH 4BSVA 1KN4L 3EO9L 4YHPB 1DZBA 4WW2B 2Z31D 3BXNB 4ACPA 3SJVA 5HYQB 4OCWL 1KENH 2VSDA 4PJ7F 3MSPA 3U2SA 2YD7A 4FTVD 3BP7B 1GGIL 1OP5H 4LAJH 1D5IH 2DM7A 2MKWA 4HJ0C 1T20A 5IMLA 1E6OH 5KS9A 3T04D 1T80A 5E5UB 3LQMA 3ROOB 1JP5A 4NNPH 5KSAB 3OKDB 3LH2H 4V2BA 3C9NB 5ELIA 3U9PL 1KTKE 2D2OA 3U1SL 3PABB 1WIOA 3T4YB 4M48L 3TWCH 4RDQF 2B4CC 2DN7A 3DX8B 4PGDB 2IG2H 4X7CC 4IRSD 4G8GB 2OTPA 3FRUA 2BXZA 3UAJD 4XVJH 1UQSB 5CHNB 3OKKA 3ILPA 4QXUH 3SDAA 3STZA 1LP9B 2EZ0D 4RAVB 2P49B 5F7YC 3S36H 3RL1A 4X8JA 3MRBB 1KC5L 1CE1L 3BEWB 1YEGL 4HS8H 5E99H 4NQDD 5D2NB 5DJ0A 3TIDA 1LDPH 2BSTB 2RCSH 4G6KH 4XNMB 4LDOB 4HUNB 2Z91A 1Q9KA 1CLCA 4F58L 4XVTH 3UBXA 3IETA 3QUMB 5T1MA 1BVKB 1MSPA 1X5IA 3EIFA 3UYRH 1CE6A 1PZUB 4P3WA 3FO2B 4X6BA 4BSWA 4JG1H 3PQYE 2Y5EA 4X8JB 1BIIA 2NY2B 1UJTA 5IFAH 2I9LB 4OCNC 1A0QL 3QISA 4NIKB 5H37H 3S4SA 2DWEB 2J3SA 3QEQD 1CGTA 5IFJA 5GGVL 2DTMH 1A7BA 4RZCA 5IVXB 4XP9H 4DOHB 3D0LB 3AM8C 4JVWA 4Y2DD 5DRWA 5EBWA 1Q0YL 3BRFA 1FO0H 4ZTOH 1YY8B 1ZGLM 4WGWB 3RDTA 1S5HB 4BQ6A 5IF0A 2Y06H 1ZV5A 3AS0A 3NFNB 3VWJC 4LDEB 3ZKMD 2Z4QB 4KVCH 4WDIA 4LCYB 1RZ7H 4G6JH 2F9BT 5H37G 3RHWF 4Y4FC 3PQYA 3MRHB 4U1MA 1FGVL 4LGSB 3P3YA 2JIXD 4JN1L 3VFSA 3VFVB 1AGFB 4ZAKC 3AREB 3GRWL 4X80H 1IC5L 4E41A 5D1QD 1HE7A 3HE7D 4M6NH 5BO1H 3W39A 3K0WA 2IBGA 2F53E 2C1OA 3RHWK 4HAGA 5EU6A 2LQRA 1V3LA 1DTUA 1K3ZA 3GDBA 1GJIA 2DM4A 4HCRL 5IJKC 2HLFD 3D69A 3DUHA 1BFOA 1YNKH 3E3QE 3QEGL 4P3DA 1ZHBB 3VRJB 4EUPB 4LCIH 4HPOH 1HHJB 2A1WL 5B8CA 4D0BA 5J56B 2P1YA 2VDKH 2FB4H 4XCEA 2DQCL 4LSRL 4WV1B 1OAQH 5DZLA 1N0LA 4DKAA 2FO1A 1E6JL 1ZEAH 5T33L 4P4RA 4MNGE 4JY5L 4DUVA 2J6EH 4WFED 3X12A 4KHXH 4PJ7E 4RFNC 5D6CB 1T89A 1F6FB 1AD9B 3AU1A 1T2QL 4UAOC 4OCYH 1QFUH 2IGFH 1KXVC 3HR5A 5EH1A 2VZSA 2C3VB 1YZZA 4S1RL 5EN2A 2F53A 5CP7A 3V6FA 4G9FB 3D25A 5FYKU 1FFOA 4FABH 4EBQH 3V2AR 3RBSA 4HUVA 1KEML 2CXKA 3WFCH 3BHBB 1G9ML 5JQHC 2VL5A 3WIFA 2R56H 1J0JA 3TBSB 2KQNA 4OGZA 3KYKL 3OKMB 4QLRA 5C7XL 3MV7E 4BZ1H 4YEFA 1FIEA 2QKIA 5DHYA 3VXOB 3ARDD 3RWFB 5E0QA 1AGDA 1D3CA 3I6KB 5DJCA 3TH3T 5I66B 4P2QE 2DL9A 2DYPB 3A0OA 4OZFB 1NAMA 1F6AA 1QKZL 1WIUA 3IDUA 5I30L 4MAYA 4DCQB 4GLRH 3PHOA 1DUZB 4ODHL 2BOCA 3ECBA 2JELL 3L1OL 4Z6AT 1BGXL 3CZFA 4MNGB 3UJTH 1GSMA 1T7ZA 2I24N 4OSUL 5CEZH 4JFPB 3RWHB 4GBXD 2YSSA 3Q2CA 4L8SA 4PJ7B 5J9PA 1U92A 1WK0A 1MVUA 2FBOJ 1W0WA 1A2YB 1F90L 4FTVA 3JTTA 1T03H 3EYOA 1T7VA 5F7HA 3ARVA 1X5ZA 3N0PB 3DMMC 3S5LA 2DQHH 1I8KB 2DQDL 3L3KB 4AIZA 2R0WH 3FFDA 2CDEA 2Y4SA 3QI9B 3P0GB 4GMTL 4NQXB 3UYPA 1AGBA 3LHPL 2BSED 4HS6B 4JB9H 4MD4B 3B2UD 2R2CA 5HHNB 5CFHA 3ET9F 4L8SB 5I1IH 1NFDB 1A3QA 2DQJL 2X09A 3BH9B 2Y6SD 4JFOA 1WIPA 3WV0A 4R90L 3ZE1E 3H9SD 2W07A 2XKSA 4P2QA 3SQBA 4JZOA 4O2EB 2F8VA 4FQHA 2IAMB 2YK1L 4MQSB 4PJHB 3BIKB 3CFEA 4WW2C 1JWMB 2W0PA 4P46D 1XGUA 1CR9L 3MV7B 3P9WB 2FBJL 4TSCH 1DQLL 3R06A 4HMEA 5D2LA 2VOTA 4KKCC 1H9VA 4NQDA 3HNVH 5F9JB 1IGIH 2NY3B 3RWDB 1ADQA 3GJFH 5GGTL 3HRPA 4MMXC 4YUEL 5KSAC 4WI3A 4BUGA 4IDJH 2AJXH 3HPLB 4JZNB 5E8PA 4BH8A 2AV1B 3QJHA 4WI5A 1JF6A 4UV4L 3ARFD 5JNYB 2IH3A 4XCYB 5I1DB 1REIA 1AC6A 3VXNA 2V7HB 2QSTA 3WFDH 2R69H 4JG0L 1YEDB 4LL9A 5EIIA 1FAIL 1T21A 4N5ED 1ZWIA 1BOGB 1A14H 4JAMB 1FPTL 2B2XH 1JPSL 4P23B 2PO6A 1CF8L 3A6BL 5D2NC 4Z95H 4JKPL 3X11B 5SWZD 3KPLB 2CO6B 3QDGD 4G5ZL 1I85A 4HWEL 3QDJB 1JMZA 2XYCA 2PTTA 1ZANH 1A1OA 1NC2D 2N7BA 2NY2C 3QCUL 1LWRA 2HVJB 1ZHKA 1EEUA 2Z92A 4KRNA 2GSGB 4QHMA 4UQ3A 2A74A 4C4KT 2AJSL 2XTLA 4XPHH 1TQBB 3MLSL 2XN9B 5FA4A 3UPRA 4KY1H 2JIXA 2CKBB 2I60L 1UWXH 2EXWD 4L3AA 5DQJB 1HSAB 3DLQR 2D9CA 4KKAD 4ESKA 3DX7A 1LEKB 4B7IA 1UVQA 3G5VB 5C0RL 3DGGB 4XPAH 3CFKA 1R6VA 1EJOL 2XZZA 1GHFL 2A74B 3IU4H 2ZCLL 1BQHA 1U2CA 5C6TH 1DQML 2IANE 3QXDB 4R96A 3U79A 1DN2A 1BD2D 3R4DA 4LHUB 1ONQB 4PREA 5HYEA 4JDZA 1G9NL 4NOBA 2I25N 1KN4H 3EO9H 4M6OL 1ZA6B 1C12B 1NGYA 5T1DL 3CFKB 4OCWH 4PY8I 5E00A 3W0WD 1GGIH 4H1LH 3RDTC 3AREC 5GGSA 4CNIA 4ZO7A 5FO8A 1QSFE 3TPUA 3IRPX 2Q87A 5JXEC 2FLRT 3BO8B 4WWKD 3UTSB 4W6WB 5JDJA 5GZNC 4PJ5B 4NM8L 4XPTL 2WZPD 2FECI 3NCYS 3U9PH 2F54E 3MRDB 3U1SH 2X6MA 3SPVB 3D18B 3O6LL 1I1AD 4M48H 4U4BA 1MUJB 1XGRA 4O5LL 3B5GA 2NR6D 3TBTA 3UTZB 3QH3A 2IANA 4JKKA 4X6DE 3ZHLA 3LKPB 2JJVA 4I48B 4H1LG 3QQ3A 4WV1C 3FQTB 1KC5H 1CE1H 1YEGH 4HV8A 1MJUL 3CFDA 4D94A 5EFIA 1G6RA 3VFWB 2A6DA 4JPWL 2VITB 1I9RL 3W9DB 4EEEA 4BFGA 3CD4A 4PRPD 2R2BA 2PKDA 5I74B 4F58H 2EDJA 2H32B 5D7SL 3ARDA 3R1GL 4NZJA 2LAAA 5TH2A 1QSFA 2G75A 4KDTC 3D85A 5FV2A 2CLRB 3H9SE 4DZBB 3LRHA 4PTTA 1MLBA 3IU3B 1YDPB 2VDPL 2F54A 1A0QH 2A38A 5HI4D 3ROLB 1HHGA 5IK3B 4UNVA 1HCFX 3MRJB 5EC1A 1FNEB 5F9OL 1KJVA 2P47B 5GGVH 4I5BB 1MAKA 5FO7A 4MSWA 4GBXA 4X6DA 2EXYD 4ZFZA 2FX8L 3ILQD 2IBZY 3C60A 5ESVA 5DA4A 1Q0YH 4K7PX 1JWUB 5D7LB 5FIEA 5BRZB 4BQ8A 3GEWB 4TNVK 3CDYA 3WD5H 5DJZA 4EOWL 1WWWX 4OD1L 3PGCA 3BZFB 4OUUA 1D6VL 5EUOA 2V17H 5BVJB 5BZWB 5F9DC 4F7EA 4Q2ZB 1O7SA 3OAZK 2ZZUT 3IDNA 3C09B 3DV6A 3SE3A 4JM2D 3H9SA 4XPBL 3GMNB 1FGVH 3T3PF 2ITDA 4JN1H 1X9QA 3GRWH 4PIRF 3AROA 2CD0A 4LCCA 4F2MB 3ULVC 3VGDA 5F1IA 4M1GL 2F8OA 5SWZE 4JO2L 4WU5A 5ANME 1X5AA 1FFNA 4PUBL 1KXTB 1QBLL 4PLOB 4NHUB 4JFYA 4U1SA 1C16A 5F3HA 1B3JA 4HCRH 4MQXD 1TNNA 3QI9C 1QSEB 1NPUA 4OIAA 3MJGX 3QEGH 4EDWL 1KLUB 3DROA 3G5YA 4IS6A 5C0DA 2Z8WC 4L8SC 5KVGL 2A1WH 3TVMD 3ZT6A 3ARFA 1GOFA 5DJ6B 3HNSL 4JFED 1KBGL 2DQCH 2F19L 4LSRH 2AS5M 2X70A 1F3JB 4GOSA 4L8CB 1T0NB 5DD6A 1E6JH 2IAMC 5F7LB 6CGTA 1VHPA 4PP1C 5T33H 4KK6C 5CJXA 4JY5H 4F37F 3OX8B 5HHMD 3LQZA 3AAZB 5J1AA 3WLBB 1FBIL 5CMAB 2YA2A 1T2QH 4OB5L 2NY3C 1OOAA 5SWZA 1LEGA 3GMQB 2O5ZL 5ANMA 2BVOA 4S1RH 5LCVL 2YD8A 5C0EB 1C08A 3VG0L 1LO2L 3CU1A 5HHVL 4F37K 2IFGA 5MEOB 5ESAB 3DNKA 1O7VA 1JCKA 3PWVA 3DOSA 1ZVYA 5DMJB 4DVBA 4NN6B 1PVHA 2G9HA 1KEMH 2APXA 4LFHD 4X99B 3DVNA 3MBEB 1G7HB 1G9MH 3L3HA 5T5NG 5I8EB 5JIKA 4NO2B 3PWNB 3KYKH 4KI5D 3VGAB 3TNNB 5C7XH 5IW6A 4P23C 2YPLE 3H0TA 5J8OA 3OXRA 4OKVA 2D3VA 1JPTL 5EZOL 3RUGF 4UIMB 2XNAB 1T1ZB 4PLKC 4LF3B 1YN7B 3T1FB 4KROD 5DUML 1QKZH 4ELMF 3HR6A 3OKOA 5I30H 2KPNA 4NQCD 1BD2A 1KYOJ 3S34L 2HVKA 4ODHH 3JTSB 1S78D 4XMPL 2JELH 3L1OH 1BGXH 1IGJA 1LE9A 2NZ9D 2D7OA 1DLFL 4HJGA 1MY7A 4OSUH 4U0RB 1S9VA 1ORSA 3MJ9A 3VW3L 5DMKB 2OZ4A 1TQBC 4G7VH 1F90H 2I07B 3IXAB 4F7TA 1CFQA 4K94C 5EU4A 4O02L 4NN7B 4U7SA 4FQ1L 1IT9L 2ATPA 2DQDH 2VZ3A 4LCWD 2JKXA 4GMTH 4WWKA 3LHPH 4BQ9A 2YPLA 4YAQA 5I1AA 4EVNA 1U8QB 4HZLA 2DQJH 3VXRD 1T5XB 4R90H 4LCUB 5LVEA 1CT8A 3RAJL 1OLZA 5I17A 4KZDL 3MGTB 1WUNT 5IW3A 1B4JL 1MIML 2XQYG 4Q9RL 1RJLB 4QRUA 1CR9H 3F7VB 3FFCB 4RMQA 2FBJH 3T3PE 1DQLH 1N8ZA 4G8EA 6FABL 4FQ2L 4HT1L 4J2XA 4P4KD 3ESUF 4MA8L 3DIFB 1CD1B 3DHJA 5E1HB 1YMME 1FVEA 3V5DA 2GITB 1XGPB 5GGTH 4YUEH 1W72B 1JNJA 3QQ9C 1P2CA 2P5EE 3GSXB 2BVYA 2YUXA 3RVUD 1F4AA 3I50L 2P5WB 4UV4H 1MWAL 2AEPL 2Q20A 4LLWA 3EGSA 2BNRD 2EIBA 1A7OL 1Q94A 3SCMA 3KNBA 2GK0B 5DRXA 4NQEB 4JG0H 5GSVA 1NDMB 3FRPA 4PV9A 1FAIH 1NBYA 4OZGF 4C56D 2WUCL 4WHYH 3O3EB 3WUWG 1XF5B 1CLOL 1FPTH 1KJ2B 1PLGL 4UQ2B 1JPSH 4J3OC 5HYSA 1CF8H 3A6BH 5IVZB 3GSNL 3EYVA 1GRWA 4JKPH 1F4YL 1IMHC 1LO4L 3SY0A 5I74C 4G5ZH 4HWEH 1QTYT 2GI7A 1JGDA 2D0FA 4GRLB 1BAFL 1XCQA 1YMMA 3SDXF 1OD9A 5CKAA 1I7TB 4EZMA 1DEDA 2BVQB 3ARQA 3QCUH 2P5EA 4ZSOE 5JQ6L 5J4MA 2AJSH 4E0RA 4IOIB 4WHYG 3RVXC 4JM2A 3MLSH 4MD0A 3S9DB 2F8XC 5I8KL 1ZT7A 3RWJB 5I8CA 2AK4B 4ONOA 2GEEA 2EDTA 4X5XA 1S8DB 1OWWA 2I60H 4N1CA 1DN0B 3MRNB 4OM0L 1FG9C 1H8SA 3WXVH 1JGEA 4ORZC 5HHOD 5C0RH 1UC6A 1EJOH 1WWBX 1GHFH 5T1LB 3DRTA 3KDMA 4P5KA 2ZCLH 1DQMH 3RUGE 4GLRI 5DUBA 3UO1L 3BYYA 1JI1A 4LBEB 5CEYB 2EYSA 1HINL 2M26A 3GNML 2OK0L 1Q9OA 5DMGC 1G9NH 3QUKA 2QJDA 4M6OH 4ELME 4QY8B 4N0FB 4MJ5A 3C09C 1LVEA 4NNYA 5T1DH 4B0MM 5GS3A 3TFKC 1EO5A 4KRMB 1T7WA 4YDLB 1NFIB 4OFVA 1R24A 3WFHA 4OIBA 1F97A 1P4LA 2MQCA 5ERWB 1QYGL 1V05A 4APQB 2P43B 4ISVB 4NM8H 4XPTH 2GK2A 2Y1VA 3QB7C 5JHDD 1R3KB 1TZGL 5KZCB 3FN0L 3O6LH 2HFTA 3EOYG 4ZSOB 3QR2A 1JK8B 1BP3B 2PYFA 4BM7A 5F9AC 4O5LH 2JK5A 4OLZL 3FQNA 5AD0B 2X4RB 3GSQB 2X4NA 3WS6A 4L3ED 1KIQA 1QO3A 4NRYB 4ODUA 4DZ8B 3TO4A 2V2WA 1J1PL 1T1WB 3MV9B 4OLXL 1HQ4B 1BBJB 2GJJA 1MJUH 4DN3L 4ELMA 3JWOC 3GBLA 1QLFA 3JV0A 4JPWH 3TA3A 2NZIA 3OAYH 1I9RH 2HJLA 4LCWE 1WT5A 3I02B 1VKXB 3IDIB 1N6VA 4G3YL 5DRNA 5D7SH 3R1GH 1A21A 3RUGB 3SKMB 2Y7QA 4Y8DC 1G7MB 3VFUB 3L7FB 2CQVA 5IEKA 5TDPA 3VXRE 3QUYA 4AH2A 1LK2A 4DVRL 5B3JF 3BN3B 4HKBB 4XGZB 2VDPH 3VGEA 4OLYL 4G8IB 4NC1E 4Y4HB 1D9KB 3MGOA 4HFWB 1KTDB 2E8ZA 5F9OH 4NN6C 4XHJC 2DLEA 4H20L 2FH6A 1LMKA 3B5TA 3MBEC 4XAKD 4W6XB 5E8DL 5I1GL 4X6CE 1K4CB 4JGJA 1FVCB 2FX8H 12E8L 3VGAC 2AJ3B 4ELKA 1UKQA 3P30H 4RWHA 1ZHLB 1KLGB 3ZKNC 1DSFL 4U1GB 5CIPH 1BJMA 4EOWH 4LCWA 4OD1H 2FWOB 4CW1A 5E6IB 2HJKA 1JNHB 1D6VH 1FN4B 4UIKL 3M45A 3ALPA 3O8XB 4QRSB 1HKLL 2VE6B 4YO0A 3QRFM 1HXYA 5T1KB 4H25A 3EOAB 3VXRA 4XPBH 2DMBA 2NY5L 3AY4A 3F7QA 4Q9BA 4NHCL 3QG6A 1E27B 4MDIA 4U0RC 2NXZB 3P77A 2YOCA 3HRZB 4CW1B 4M1GH 3OR6B 4JO2H 1AY1L 3TPKA 4I8DA 4BFEA 3QAZB 4PUBH 1ETZB 3HG1D 3MRLA 1QBLH 1IC7H 4NN7C 1PJ9A 4P4KA 2NXYB 2J8UF 2GCYA 3CFJB 4A6YA 2EYTA 2EE9A 2WWKT 3VRIB 5LWYL 43C9B 4X6CA 3K8LA 1I3RB 5HYJB 2H6PB 1N0XL 2NLJA 3DUSA 5F7KC 5DJ8B 2EDWA 1CI5A 1U58B 3M1BB 3I75A 4QTIL 4EDWH 4DFIA 1U9KA 5KVGH 5CEZD 3EOBB 5E9DD 3LVEA 4NQVB 2WP3O 3HNSH 5C9JB 1KBGH 1ND0A 2F19H 2FRGP 3U30B 1BVZA 3LN5A 1KG0B 4HWBL 4XH2A 1FYTD 1B90A 4GAJL 4OZGB 2RAMA 2DBJA 3TYFA 3L3IA 1A9BB 1P6AB 1PZ5B 3LV3B 2VUYA 5HHOE 4M8QA 4X6FB 5DD3L 3M07A 5E03A 2R1YB 5LBSL 1FBIH 2EDFA 4LLVA 3VGGA 3T09A 3ZE2E 5DJ2B 1GC1C 1UB5A 4OB5H 1P7QB 2O5ZH 2W65A 3G6JF 5LCVH 5FM5M 1M71B 2FLBT 3SDXB 4MX7A 4HG4K 1HI6B 3VG0H 2QADD 5HHVH 4MVBC 1H3VA 1RV6X 2ADJA 4YDJA 1QHPA 3WUZA 4JLRA 4AG4L 4YQXL 4J8RB 4LLVB 3GMMB 3U46A 3O4LD 3RTQD 1A1MB 1QQDB 3IFPA 1KIPB 4U6HB 4MX7B 2W0KA 4PD4J 1C1EL 5TQ0L 1MEXL 1U36A 3QDHA 5TE7L 4I0PB 4W4NA 5IVNA 1JPTH 4KK5C 5EZOH 2QV2A 5DI8B 2ZG3A 3O9WD 5HHOA 3U46B 5JW4M 4K2UL 4UMGA 1CGVA 4GRLC 3LKSA 2R2EB 5DUMH 2ESVE 1D7FA 4QXTA 1FNGB 1DBBL 2VDNL 3S34H 1XAUA 1LHZA 2B4CL 2VMFA 3HE6D 4XMPH 4QTHB 5A1AA 5CSBA 4EN3B 4YWGL 1DLFH 2PXYD 4KGLA 3VW3H 1G7LA 5DJAB 1JYVA 1WV7T 4JRXB 3GUTB 4O02H 3NCCB 4FQ1H 1MFNA 4U6VL 1IT9H 2BNQD 4FP8L 4ZOBA 5DWUL 3S97C 1VFOA 5E4IA 5ECJE 4L8BA 3PL6B 5C0FA 4W4OA 5F71A 3PDOB 1U8OA 4P2RB 4N1EA 4AY0A 1NCDL 1S3KL 5DK2B 3EJYD 5KSBF 1N5AB 5JMRA 4V2CB 4HKXB 1W8OA 1HH6B 4QCIB 1S7QA 3RAJH 2N1KA 1INQA 1YEIH 3BOVA 4PR5A 4KZDH 2ESVA 3QXTA 3PNWB 3CDGB 1B4JH 4ZPTB 1MIMH 1YPZE 5KVEL 4Q9RH 1IC4L 2ZSVA 1NAKL 4LLYA 4HIXL 2C1PB 1I1CA 3C6LD 3U82B 4AZ8A 6FABH 4FQ2H 4HT1H 3ELAT 4BFIA 4MNHA 3K3QA 5T3XL 4YDLC 4MA8H 3RGVD 1FQ9C 3BP4B 3TT1L 3G5ZB 5L2KE 2DIBA 2HTLC 2RJMA 3GMRA 4APQC 2XICA 2X1WL 5IQ7L 3VXMD 3I50H 1RHHA 3QEHB 3X14A 2X42A 3D2UA 3NIDF 5DJYB 5IQ9B 1MWAH 2AEPH 4KV5F 5KTEL 1GYAA 2XTJD 3RRQA 3S3PA 1A7OH 1WZKA 2DQUL 3BQUD 1IQDA 3NBNA 2NCMA 5MHSE 1CWVA 1JUFB 4S1DD 5DYOB 3S3JA 2IWGA 4GW1A 4F7MA 5KN5A 2WUCH 1DP0A 4DW2L 2J6EA 5ACLA 1CLOH 2GHWB 5EBLB 1PLGH 4XHQA 3ARXA 4QRPD 1VCAA 1S7TA 1K8IA 1YPZA 3GSNH 2APBA 4N0CD 1LNUA 3RWIA 1F4YH 4TUOA 5IESL 2R4SL 4GKSB 1LO4H 4UDTB 4V1DD 1F11B 1M1SA 1TVHA 4OV5A 3MLTA 5DEFB 1BAFH 4PJDF 4QHLA 3SE8L 1DQQA 3I84A 2K1MA 3LKRB 5IG7B 5CSZA 4TUKL 3V4PL 5EU5B 5L2KA 3EO1B 3L3JA 2YWYA 2V5RA 5DHVB 2A83A 5JQ6H 5EOQL 1ZT1B 3TA3C 2KQMA 2A6KA 1E4KA 1DDHB 1I7RB 1KGCD 1V3MA 2QQKL 2VN4A 4O58L 4Y4HC 1D9KC 5I8KH 3QG7L 4NO0B 3U48A 5INDA 1R3JB 1T4KA 1F4XL 3MR9B 3BP5B 4WFGE 3IFOB 4OM0H 1HNGA 1Z0MA 2J8UB 3QIUA 3VCLA 5FEBA 3NCYP 4FMFA 2H2PD 3UX9B 3MLXL 2XZQL 5DJDA 3ZSSA 1G0DA 1KT2B 2ZOLA 3QUXA 4RFEA 3UO1H 3BVNA 4U1GC 1N3NA 3HLAB 3TBYA 2LABA 5C9KA 1HINH 3GNMH 4Q0XL 5D7KE 5E6IC 3SE9L 2OK0H 5EWIL 4L4TE 4LNVA 4CADA 1CG9B 4WTXA 3O8XC 4JO4L 4RIRB 1HDMA 3QXAB 1OT1A 3O4LE 5TGBA 1J5OL 2C7UB 2BVEA 3D1MC 5LAXA 4HBQA 1FORL 1NANI 4JQVA 1SJEA 2ED8A 3MREB 1NGZB 2FJHA 3QDMD 1OAUL 4FQXB 5AZEL 3BMVA 4ZD3L 2NXZC 4JRWA 4NKIL 4FFZL 4J3VA 3MO1B 2OJZL 3QJFB 4AL8L 1HQRA 4HX1B 3QAZC 1MI5E 4P5MA 4P9HC 1UJ3A 1QYGH 3MMEB 4HK0B 4PJXE 2NXYC 3FN3A 4RAUB 3BT2L 4O4YL 1ZLWH 3G6JB 1OM3L 3U36A 1OCWL 1TZGH 3FN0H 2AABL 2YN5A 1XF1A 3TJHC 1IEBA 5IBUB 1SVCP 1FZMB 2NX5D 2P4AB 4AM0B 3ZYOA 1T66C 1BF2A 1GVIA 5KSBE 4XBEL 5E8NA 1RU9L 4NO3B 4KPHL 1J1PH 3U30C 4NFDA 4L4TA 4OLXH 1BVLB 1JFQL 2H26B 3GB7A 4L4JA 3BP6B 4NKMA 4DN3H 2DJ4A 3O4LA 4QHUA 2R15A 3WN5A 3RTQA 2P45B 1RUQL 1KF9B 2FDBP 3GJFA 3ZT7A 1N6QL 1XGTB 4G3YH 1TNMA 5EIVA 3LIZL 3C5SB 1OTTD 2K3TA 1D5BB 2Q86A 3N9GL 5IT2L 2QLVB 4NP4L 3CNKA 1ED3A 3O9WA 2HLAB 4PTUB 1QZ1A 2CUIA 3QWRD 4OIIL 4YPJA 1MI5A 4DVRH 2VLLB 4PJXA 1AIFB 4KV5E 4OLYH 5J11B 1ITCA 1LO3L 3ZYZA 3HE6A 1A1NA 5CWSA 4IRJD 4H20H 4MJIE 1FL5A 1Z3GL 1KB5B 3VFOA 2LTQB 3RVWC 3DECA 5E8DH 1SEQL 5I1GH 2OSLB 4NKDB 3SKNA 1JNNL 4Y1AD 12E8H 4JFDD 1NMBL 3OL2A 5ACZA 5MENE 1AI1L 3GO1L 2OBGA 5IHBA 2SEBB 2BNQA 4I0PC 4JFHE 4MA3A 2OXHA 4KJWC 2YMXL 1F2QA 2UZIH 1DSFH 1OLLA 1QFHA 2WUBH 2PN5A 3QA3B 4UIKH 1J05A 2H8PA 1VEPA 3P4LA 3IJYA 5JR1L 5KSBB 1HKLH 3AXLB 5ETUA 1LQSR 1LILA 5EO0A 1TJHL 4H5SB 4YPGB 1KIUA 2Z31B 2AJVL 2NY5H 1ZT4A 2PCPA 4JJHA 4WEBL 4XT1C 25C8L 4EN3C 4NHCH 3QP3A 2CR6A 1R5VA 2E3VA 3JV4A 1SM3L 1AY1H 5GGRA 5ACMA 1J12A 4R2GD 4N8PA 4MJIA 5LGJA 3L3DA 2Z93B 1EX0A 2EKSB 3LKQA 5L8LB 5I1LB 2DI8A 2WM0A 5LWYH 3V6ZA 2BMKA 3PL6C 1TETL 4GUPA 1ZT4B 4X98B 1N0XH 3CZJA 1IAIM 4QTIH 4LASL 5MENA 2B20A 4EDXB 3QUML 2AXGA 4JJ5B 1NCBL 4IRSB 2NTSP 4PGBB 1S9YA 1I8IB 2HTKD 4LRIA 1FNLA 2F5BL 3FQRB 4HWBH 4NRXB 2YS4A 2V5YA 4GAJH 4H1LA 2BFVH 1PD6A 3Q1SL 2R1WB 4ZFFB 4OF0A 5IUSA 2XFXA 3CLFL 2ZUXA 5DD3H 1XF2A 2HFFB 5LBSH 1MRCL 4ZUUB 2ADGA 2AV7B 1EVTC 5ESQA 4RQQB 2M2DA 4PJDB 4G6AD 4UNTA 2ORBL 4L4VB 5FF6B 3BZ4A 4K7FB 2RHEA 5ALBL 5ENWA 5EU3B 2D03L 4NCDA 3VDBA 4YQXH 4AG4H 2R0KL 5J3HC 2Y07L 1UCTA 3QEQB 2HT4C 1YJDC 3RKDD 5CD3B 1OTUC 2G5RA 3I9GL 4UOW1 4RNRA 5KW9L 4IJ3B 1CXIA 4Y2OA 4Y2DB 3VJ6A 3CXDL 1C1EH 5TQ0H 1MEXH 5TE7H 1XZ0A 4XI5C 3OB8A 3U4EB 4PJEF 1BWMA 3H9ZA 4PB0L 2UV3A 4XCNB 2APWA 3F5WB 1MHHA 4K2UH 1A7NL 5GSRB 2X4PB 3KPRE 2WINB 1YUHB 1D6EB 1U2HA 3BPCA 1J0YA 4HXBL 1DBBH 1NEZB 4Z7UF 3VWKB 1RZGB 2VDNH 5AAMA 3UTQB 3WFBL 2B4CH 4JZJB 4U1HB 3EFFA 3SDCB 4JFXA 3DXAE 1PKQA 2B8OT 4YWGH 4IMKA 2HH0L 1YEHL 3MNZA 3BD3A 3QWOA 1QFWL 5F7WC 1XGYL 5D1QB 1HWGB 4JR9L 3HE7B 2FSEA 2YA1A 1JPGB 3DI3B 4U6VH 1Q0XL 1WISA 3O3BB 4JGMA 5DWUH 4FP8H 3MRIA 4F33B 5GS2H 1SYSB 1NCDH 1S3KH 1U8MA 1L9NA 1L0QA 1A6WL 5CZXD 4X7FC 4ZXBD 4E42A 3VE0B 5GGUA 3KPRA 1NGXA 4KKLC 4WUUE 1R5WA 2V5MA 5C70A 5K9QG 3W9EA 5KVEH 1TTFA 1IC4H 1NAKH 1WQVT 4HIXH 4R6UA 5L9DL 3DXAA 4HIIB 3JZ7A 3TV3L 4FQXC 5T3XH 3WEXA 1DCLA 4OFPA 4ZYKB 4ZFOB 4N0YL 3JBG7 4WW1A 5ITFB 1ZA3A 2P46B 3TT1H 3MRFB 4HCRA 2QSCL 3BJLA 4TTDD 5IQ7H 2W91A 4U1KA 2X41A 3VFRA 5F8QC 3H3KA 5KTEH 3PP3H 5TE4L 1ULVA 5JUEL 3GSWA 2FHFA 1AQDA 1QHOA 3DPBA 2XWJB 2DQUH 2AXFA 4Y5VA 4ZFGL 4R4FL 3TBVB 3ZHKA 3AGVA 2B0SL 4DW2H 2M1KA 4H26B 1QRND 2GJ6E 4MXQC 4WUUA 3H7LA 3IDMB 3T4AB 4R0LB 1YEKL 5GJSL 3S96A 3ULVL 1JHTB 4HIEA 3M17B 4WFHD 3TP4A 3PWUA 1ZK9A 5E1AB 4Y1AA 5IESH 2R4SH 3VGFA 3WS3B 1EGJL 1Q9WB 4FXKA 3SE8H 4PJCB 3V8CA 4BQCA 2VLJD 3CPLB 2R1XA 1MCDA 3LKNB 1U41A 4TUKH 3V4PH 4F9LA 5EOQH 1JHLL 1G7JA 4Y16D 3QEUB 5J11C 3P9LB 1DEEB 2QQKH 4O58H 5HI5C 1C5BL 3CSYA 3EJZC 3QG7H 4XP4L 1F4XH 1MHPH 1U8NA 2LTQC 5C8JA 2EIEA 1E0OB 2ILLA 5EOTB 3HZYA 3VD7A 2CJUL 3WNNA 2GJ6A 3NACL 3MLXH 2XZQH 4OLUL 4HBCL 4PJEE 3HN3A 2CIIA 3FOMB 4U2ZA 1RJYA 3KYMB 4Q0XH 3SE9H 4K9EC 5EWIH 3BESR 1IE5A 1U93B 4JO4H 1X4YA 2XY1A 4JEGB 5IMOB 4Z7UE 1J5OH 1S7UA 1D5ZA 1CXLA 1FORH 2GJ6B 2VDLL 2Z31C 4P46B 2DRUA 5ID1A 1J9CT 2RQ8A 2YBRA 1ZKAA 3MFFA 3WL9B 1OAUH 1A6TB 2FX9L 5AZEH 3EYQD 4ZD3H 3FHAA 1MJJA 1ZS8B 5IV2A 4YFEA 4MD5B 4NKIH 4HKJB 3STBA 2OJZH 4JRYD 1BZQK 4AL8H 1CFNA 3FHQA 2YEZA 4N8CL 5HDOA 2E6QA 5CILL 1JL8A 3BT2H 4KJPD 1O5DT 2DDQL 3TNMA 1OM3H 5TQ2L 1OCWH 1NUNB 3P0YL 2AABH 2ZNXA 2WK2A 2DMKA 1M7DB 3VFPB 3DVFA 1MAML 3FO1A 4PB9L 1BZ9A 3ARGD 4IRSC 4NKOA 1EEYB 5JW5B 3T0WA 4XBEH 3CX5J 4U7KA 1I7UA 2ZUYA 1YY9D 4UBDC 4EIGB 5FECA 4M1CC 1RU9H 2PF6A 4KPHH 4J3WA 1HHIA 2EZ0C 1VDGA 1JFQH 2YR3A 2XY2A 3MA7A 3WUWA 4AT6A 3U4BL 3CXHJ 3FB5B 1UEYA 4Z7UA 3L9RA 3VMPA 3BDXA 1RUQH 4P0DA 1T3FB 4C83A 2EEBA 4HGWA 4YHIB 4F80A 5GGTA 1N6QH 3KWWB 4K94L 2CKBL 1RJZB 4PJEB 3LIZH 3QDGB 2AJYL 4XP6L 1JV5A 3IJSB 5IT2H 3N9GH 2FJFA 4NP4H 3GJEA 4AQ1B 5DO2D 1H3PL 3P4OA 5SV4A 2C3WA 4OIIH 2MNUA 4GKZB 2IMMA 2VZTA 1NC2B 1S7WA 4K3HA 2VKXA 3NN8A 1LO3H 3D39D 1RZJC 4PJ8A 2IH1A 2IPKA 3ZLQC 3OB0K 3QO1A 3AMLA 3BE1L 3RNQB 4D9QD 1Z3GH 3Q6FA 3B9KD 1S9KC 2EC9T 3LB6C 3BH8A 4KJYB 4OZHB 1SEQH 3QZWB 1IL1B 4PJAF 1JNNH 4TUJB 3SDYL 4IJ3C 5HYFA 3WMSA 1NMBH 1T04B 3L3OB 4Y2DC 1AI1H 1LO5B 3GO1H 5D1XB 3B9DA 3OXSB 2JJUA 2YMXH 4KFZC 1B0RA 5JO5B 5DS8A 4LRNL 3KLAB 1ITBB 4YBQD 5TDNB 3MODH 4HW6A 1CZ8L 3KPQB 2DKUA 4S1SL 1EHXA 3ZKMC 5JR1H 7FABL 1DVFB 3KPSD 1HHHB 5FB8A 4OBRA 1TJHH 4ZXBA 5IIEA 3VWKC 4Y5XB 4JZJC 2AJVH 2EC8A 3WKNA 4F7PA 1SJXA 4J1UA 3SDCC 4WEBH 2GJZA 3W0WB 1KELL 4C4KO 3DVGA 2BVTA 2CGRL 3SBWA 3I6GB 2R39A 1SM3H 3REVA 4ZUVB 5D1QC 3HI1A 2XV6B 1BM3L 3HE7C 3X3FL 1BQSA 3MQIA 1IFHL 5FFLA 3KXFE 5CD5C 3O3DA 4TSBL 1TETH 4F7PB 3T2NL 3PP4L 3FONA 1UZ6F 2HN7A 4OZIB 1I1AB 5ISZD 3FAXA 2HLFC 3QUMH 2IQ9L 1NCBH 5DTFA 4P99A 3H42L 1D5XB 5E2JA 4D8PB 3U83A 3TO2B 4AEEA 1ES0A 2OTUB 1X7QA 4ZODA 5EOCL 2F5BH 2VR5A 7CGTA 2G2RA 4P2OD 1G7QB 2DQIL 1UM5L 3FOLB 3Q1SH 1P1ZA 4Y4KD 1CVRA 1N26A 1HILB 3WNMA 3QIBD 2NNAB 4YC2B 1P4IL 2XT1B 3CLFH 4PJ9A 1QRNA 1MCKA 4PRPB 1AHWA 1MRCH 3WO4B 3RU8L 1U95A 1F8TL 1X5FA 2WMPA 5EZJA 1WC7A 2YWZA 2R0ZL 3D0VA 4OD2A 4PLJD 4XNYL 2ORBH 1QA9B 4ODTL 5JLZB 5IB4A 5DZOA 1TCRB 4ZDHB 3KXFA 5ALBH 4NQSA 2D03H 3ZKXB 1K2DA 1CFTB 3E8UL 2R0KH 2Y07H 4KU1A 1OT2A 3WE6B 2ZUTA 3V0VA 4Y16A 2OR8A 2VAAB 3I9GH 1NH6A 1NKOA 2DOCA 5KW9H 5CINL 1VGKB 4URTB 5GISL 3CXDH 4YXKL 4HWNA 3HS0A 4R0LC 2JJSA 2CDFB 3X17A 4PB0H 1UGNA 4WCYL 5CLTA 1A7NH 1Y0LB 1IZKA 5IEHA 3V0VB 4PP2B 1UZ8B 2R9HD 4YEEA 3RZCD 2EYRB 4HXBH 4M62L 2MKLC 5C71A 3WFBH 2X4TB 2VTFA 4FNLL 3KLSA 3HS0B 4EUPH 5FYJE 1RUAL 2ZJSL 4ALAL 1T6VN 3CMGA 2HH0H 1F6LL 1YEHH 1QFWH 3LN4A 1I7ZA 1XGYH 4I9WE 3KYNB 4JR9H 1Q9LA 4OJFL 3RL2A 2ATKA 1XR9B 4Y5YA 3JWOL 1Q0XH 4PG2A 1Y18A 2VC2L 1OF2A 3RPIB 4YHNB 4JRYA 1TVBB 4CJ1A 4FQPA 5CIPA 3PWPB 2BRRL 4X7DC 5ICZB 1VFAA 3NFPB 4OQTL 4KUZL 1U3HB 3X3GL 2OJEB 3FZUD 1A6WH 4JDVB 2MCG1 5JDSB 2P24B 1HSBA 5JOPD 2FJGA 3TVMB 1UXWA 3U6RA 4EUPG 3PF2A 1K5NA 4JFEB 4XWGL 1X6LA 3MLUH 5FM8A 1UG9A 2R2HA 4DGYL 4ODWB 1TZHB 4P46C 4R4BB 5I15L 5L9DH 4QOKD 5AG9A 5HHMB 3GMOB 4GW4B 3TV3H 3ZZ1A 3MUGA 2A9NL 4N0YH 1HSBB 1X4XA 4RX4D 4YH6A 3U6RB 3DX6A 4JFQA 1H0DB 3CSBA 3BUYA 3DYPA 2QSCH 4R97B 4XC1L 3SO5A 3LMJL 5JPMA 4TOYL 2ICWJ 2DM3A 2X7LA 4D9LL 4ONHB 5TE4H 2JTDA 5JUEH 2BXYA 5C0GB 1YYLL 2OLDA 4M9PA 4OZFH 2AJZB 4XMKL 2H3NA 4ZFGH 4HH9B 1JWSB 3MCLL 4R4FH 3D39A 2E8YA 3FO9B 2B0SH 4XVUD 1CGUA 4I2XA 4QRRD 4YIQB 1YEKH 3ES6A 4PJAB 3BN9D 5GJSH 4AQOA 3ULVH 4D9RE 4MXWL 5IWLA 1KB9J 1U8LA 3MRMA 4WO4A 3WHXA 3MJ8B 3P9MB 3OGCB 4OKDA 5I16A 4R7NB 1EGJH 2UZXB 4KROB 2GYSA 3VFNA 2A6IA 1XT5A 2EICA 1NBVL 1XCTA 4IHOA 4OZFG 4H88L 4F8TA 2IQAB 2CLVB 4X7SL 1JHLH 4XMLL 2DS4A 4CN6A 2QHRL 3CC5B 2D31A 3HUJF 4X0KB 1C7SA 1C5BH 1NJ9A 5I16B 3WNLA 1G7IA 3QHZL 4XP4H 5D8JL 1OSPL 4P57B 2F5AL 4WWID 3FQUA 1MCRA 1N59A 4RMSA 4U1NA 5IW1A 2EXWC 4BH7B 4KKAC 2CJUH 2DLGA 1TZIB 5FK9A 5BQ7B 3NACH 1AD0A 5HHPA 1GZPB 1T83A 3VRLE 4OLUH 5F96L 5D1XC 1GC1L 4HBCH 4HIHB 1VB9A 4YHKL 1ZLWK 2YC1B 1QLEL 1KIRB 1W72L 2GTWA 2FIRT 2EIZB 3VH8B 3RNKA 3ARBA 4RDQG 5J89A 3W11C 1DVFC 5K9QI 4R9HA 5HPMA 4LSVH 3ULSB 1DJSA 2E9IA 2VDLH 4WJ5B 4Y5XC 2CIKB 3QNXB 2BC4A 5F1NA 2E27L 2FX9H 2YPKB 4P2OA 2FATH 3MNVB 3MUHL 3IT8D 3T0ED 5HBBA 3QIBA 4P2YA 1CICD 1MFAL 3O6FA 1GPOL 4LLDB 1KJ2L 3PUCA 2DWDB 3B8SA 2ZNWA 4N8CH 4YHZL 5CILH 3BISA 3FB6B 1PYWA 3NIGF 2ARJA 2DDQH 2DB8A 5TQ2H 3P0YH 1FL3B 4HIJA 1RK0A 3QUZD 1MAMH 1I1AC 5MEPB 1G9EA 2CSPA 3EAKA 2YHGA 4PB9H 2BNRB 1IGTB 3U0PB 4Z76B 1YNTB 5GS0D 5BS0E 1A9EA 1QRKA 3O6FB 4WENB 4C56B 1WTGT 1RFDL 3NVQA 2BVPB 4M7KL 1CLZL 3U4BH 1NUDA 3MROB 4Z5RB 3ZTJH 5LQBL 3TN0D 4PJIF 4YC2C 1LEIB 3CUPB 4K94H 2CKBH 1NDGB 3WO4C 1QVOB 5B4MC 5GXBB 4Z7VB 2AJYH 4XP6H 1KJMA 3GM8A 4FZEL 1AH1A 5H2BB 3FO0L 3NZHH 1H3PH 1BLNA 3BW9A 2OL3B 3E1F1 3D3VE 5E5MB 1BPVA 2GT9A 1PY9A 4G42A 3Q0HA 1I9JL 3B9VA 3ZKXC 3VI3F 4UT6L 5IM7A 3OKYA 2BSRB 3REWA 3VG9B 3WIHL 3BE1H 2Q8AL 4NT6A 2G60L 1OAXL 3ZTJG 2BCKB 1J8HD 4HC1L 3GSNA 3X13A 3G08A 1XR8B 3SDYH 2EXYC 4WEUD 8FABB 1HYSD 5A2FA 3ILQC 4JN2A 3T3MF 5CUSL 2MOVA 5GIRB 2X4OA 5HVWA 4AEFA 4LRNH 1KCVL 5C09D 4FXGA 4FRWA 1CZ8H 4PRDA 3S35L 3GMLB 3IJHB 3TZVB 4RMVA 5KG9A 1JF1B 5FYKE 3GSVA 5BS0B 7FABH 3ULUD 2EDDA 3O2DL 5A3ID 3V6BR 4LHUG 3DBXA 2DI9A 2MCPL 2LU4A 4HWZA 3D3VA 2Z9TA 1KELH 3VGBA 1QSZA 2DJSA 3B6SB 4KXZI 2CGRH 1VACB 1FO0B 3BZEA 1I1YB 1EMTL 2WW8A 4PRDB 4TSAL 1JZ8A 1GZQB 5BW7A 1BM3H 3O81A 3X3FH 1IILE 3FQWA 4E9LA 1IM9D 2GFBA 1IFHH 4YNYA 3ZYIA 4CMHB 4RX4A 3SDDB 1Q72L 2NY1B 3NZ8B 4TSBH 3V6OA 3T2NH 3PP4H 4Q6IB 4JPVL 5JHDB 4PPTA 5AZ2L 5K9OA 1P84J 2H32H 2VQUA 4UOW0 1V5JA 2A73B 2IQ9H 1U3HC 2Q8BL 4ZMAT 3H42H 4IBLT 3PGDA 1R3HA 5EOCH 3TVMC 3QNYB 4L3EB 3RWGB 5A16B 1MCWM 2DQIH 3P4MB 2VQ1A 2AKRB 1UM5H 4J7RA 5GQBA 5C0BD 4QNPF 4UB0L 5T3ZE 2GAZB 1F42A 1P4IH 3AS3A 4LAQL 3BEVB 5E7FA 4QYOB 1YN6A 4UV7L 1IAOB 5F8RC 3RU8H 1F8TH 3DV4B 2OR7A 1TENA 3HAEB 1NQBA 4PGJA 4UTBL 1DE4A 2R0ZH 1HOCB 4XNYH 1UADC 4ODTH 1T22A 4R97C 4Q97A 5DJXB 3NIGE 5F88A 2WBJB 1DANU 4CRPA 3C2SA 5GS1B 3VXPB 4F9PC 2BOBA 3E8UH 5CBAB 4U2YA 4G8FA 5INCA 1RIVL 3HUJB 1L7TL 3SGEH 3IVKA 3PJSA 1GH7A 5T3XD 4M1DL 1DBAL 5C0AB 3S8WA 1MREL 2ADFL 1OD7A 5CINH 3R0MA 4YLQT 9CGTA 5GISH 4YXKH 4X83A 3K8MA 3G04A 5SWQB 5SX5K 4MWFB 4MNQD 1IKNC 1T0MA 4WFFD 4FA8A 4WCYH 3ARRA 5MEQB 4P9HL 4PGCB 1C5DB 3JVGC 4ODXA 4KROC 4M62H 4HUWB 3STLA 1NBZA 4FNLH 5JOFA 1EHLL 3DO7B 3E0GA 1S78C 1RUAH 2ZJSH 4ALAH 4Z78A 1UB6A 2LVEA 2NZ9C 1CDHA 2HG5A 4YZFF 1U8HB 3VI3E 2Q6WA 2ZOKB 1XEDA 4OJFH 4HKZA 3JWOH 1J7VR 2AI0L 5A2KH 1U8JA 4MS8D 2VC2H 3LKOA 3MRPB 2WQRA 4AIXA 1CICA 1URLA 2BRRH 2WP3T 4U3HA 2EDBA 4LMQI 2YD2A 4OQTH 4KUZH 5IB1A 1OGAD 1TTUA 5IB2B 2LU3A 3PHQB 2XWBB 3P4NB 3ZHDA 5E9DB 3PP3K 1WWCA 3FCTA 4OZ4A 4XWGH 1FYTB 2YKLL 5E4EB 4DGYH 5DURB 3UZQA 5IKCA 5I15H 3DURA 4I18A 4HJJL 1T83C 1WCQA 4AYFA 3IAPA 1EEZB 3OHXB 3KPMA 1K4DB 3QO0A 4PJGF 2DQFA 5DSCA 5J13B 4B50A 1IEAB 5FKAA 4PJIB 2A9NH 4CL7A 3H9HB 3OMZA 2Y72A 3FB7B 3A6CL 2ITCB 1FHGA 2HT2C 5DEGB 3FT4A 4XC1H 2VLKE 5BOPA 3LMJH 4M61A 3LPWA 4TOYH 4P5TB 2QADB 3JV6A 3K8KA 3RVUC 3LEXB 4D9LH 4NPYA 2DTSA 3NPSB 5C07E 1LD9B 2XZCL 1ORQB 3IAQA 1YYLH 2YD3A 4LKCB 5FKAB 3VXQA 4TNWF 4HWBA 4XMKH 1WBZB 4QWWD 4WNQA 3MCLH 1AO7E 5DK0B 3O6FC 3TBWA 5IJVA 4UOJA 4RGND 2PUQT 3VXUE 1KTRL 1NCAL 4G6ML 3NAAL 4QNPE 1MH5B 3KPOA 4MXWH 2CUMA 2HP4A 2VABB 4TNWK 2HJFA 1UXSA 1BJ8A 1ZSDA 1DFBL 5J0BA 5DVKA 1T5WA 2D7TL 3DX9A 4RRPG 1AGCB 1NBVH 3C6SA 5CJQL 3GGWA 3CX5K 1G1CA 2GTZA 3QULB 4H88H 2V7NA 4P48A 5IB5A 1SJHB 3T1WA 4X7SH 3JSSA 1A7QL 3BPLB 1EFXA 3F6IA 5JPNB 1G0YR 4XMLH</