2APSA

Cu/zn superoxide dismutase from actinobacillus pleuropneumoniae
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
155
structure length
155
Chain Sequence
b'EKLVVQVQQLDPVKGNKDVGTVEITESAYGLVFTPHLHGLAQGLHGFHIHQNPSCEPKEKDGKLVAGLGAGGHWDPKETKQHGYPWSDNAHLGDLPALFVEHDGSATNPVLAPRLKKLDEVKGHSLMIHEGGDNHSDHPAPLGGGGPRMACGVIK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (CU,ZN SUPEROXIDE DISMUTASE)
molecule tags Superoxide dismutase
source organism Actinobacillus pleuropneumoniae
publication title Cu,Zn superoxide dismutase structure from a microbial pathogen establishes a class with a conserved dimer interface.
pubmed doi rcsb
total genus 34
structure length 155
sequence length 155
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 1999-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 2apsA00
1PZSA 1E9QB 2WYZA 1SXNA 1OEZW 2VR7A 1SPDA 3KBFA 3RE0A 1SXCA 1U3NA 1F1DA 2GBTA 1RK7A 3GZPA 3KBEA 1HL4A 2GBUA 2VR6A 2V0AA 1YAIA 1Z9NA 2ZOWA 2AQSA 2AQNA 2Z7UA 2JLPA 2JCWA 3L9EA 4B3EA 2NNXA 2Q2LA 2R27A 1AZVA 1SRDA 3KM1A 1SDAB 1SOSA 3ECWA 4U4IA 1JK9A 1DO5A 1SXZA 1YAZA 4MCNA 1E9PA 1EQWA 3QQDA 5KBKA 3CQPA 2C9VA 3L9YA 2Z7WA 1OZTG 1SXBA 1PTZA 1S4IA 1FUNA 2WWNA 1TO4A 4BCZA 1JCVA 2LU5A 3GTTA 1BZOA 3SODB 1E9QA 1SXSA 3F7LA 1XTMA 3KH3A 1CBJA 4BCYA 3QQDB 2ZKYA 1JK9B 1IBFA 2WKOA 2Z7YA 2K4WA 1N18A 3GQFA 1MFMA 3HW7A 1OALA 1UXLA 1B4TA 3H2PA 2WKOF 2GBVA 4A7GF 4OJAA 3HFFA 3ECUA 3H2QA 2AQTA 2E46A 2WZ6A 3GZQA 3K91A 1DSWA 2AEOA 3KM2A 2XJKA 2Z7ZA 1TO5A 3T5WA 2E47A 1P1VA 2WWOA 5KBLA 1E9PB 3CQQA 1UXMA 1E9OA 3F7KA 1EJ8A 2AQQA 2AQPA 4A7GA 1N19A 1Z9PA 2SODB 3ECVA 2APSA 1ESOA 2AF2A 4A7QA 1F18A 5CU9A 2C9UA 5KBMA 1BA9A 1COBA 2ZKXA 2XJLA 3KH4A 1IBDA 1F1GA 1IB5A 1L3NA 1PU0A 1IBHA 3S0PA 1YSOA 1F1AA 2WZ5A 1CB4A 4N3UA 2ZKWA 4A7SA 1QUPA 2VR8A 1Q0EA 2C9SA 3MKGA 3PU7A 4A7TA 1SDYA 3GZOA 3LTVA 4MCMA 1E9OB 4A7UA 2WYTA 2AQRA 3GTVA 1SXAA 2WZ0A 3CE1A 4BD4A 1KMGA 1B4LA 1OZUA 1HL5A 4A7VA 4L05A 1OAJA 4N3TA 3HOGA 3MNDA 1XTLA 4FF9A 4OH2A 1IBBA 1XSOA
chains in the Genus database with same CATH superfamily
4MA8L 1NDTA 4LDLB 1QWNA 5CR8A 1D6VL 4OZHE 2DB8A 5DMIH 3HZVA 5IQ9B 4L4TD 3HLKA 3IDMA 1I1AC 1P6AB 2B3RA 4KJYA 1HNFA 2A38A 2OMVA 4V1DB 3CFDB 2JJSC 3TT1H 1XB8A 1GGIL 3JTTA 5EO9B 3TA4D 3GBEA 1C08B 1DZ0A 3FBKA 2XOTA 4PS3A 3SDAD 2GIMA 3N50A 4M7JH 3L2NA 4HKBA 3BEVB 3LXAA 1LE5B 4AK2A 1CQKA 1NJ9B 4U4IA 5GGUA 1HCZA 2VL4A 1GSMA 2I07B 3QHFH 5EIQA 5A16B 4YSUA 4IW4C 5HTSA 2ADGA 3ILDA 1EEZB 4GAJL 3DXAA 4FQXB 4N25A 1IVLA 3VWJA 5B8CB 1SJEB 4I0PD 1AQMA 3F85A 1U3JA 3F65A 4ZS7H 1XEUA 2P8LA 3TJHD 1IE5A 3MCG1 1FC2D 4MDIA 4ZX4A 1N0LB 5EMYA 1KFAH 5LCVH 2ZICA 1CDJA 1QTSA 5FA3B 1M3JA 3SKJL 3VDAA 1G9NL 1TEYA 3CH1B 1ITCA 5E8EA 2AV1A 3W2DL 4YWGL 3FO1B 1AG0A 5J11C 2H47C 1M7IA 2A83B 2X40A 3SDYH 4H8UA 3VGAB 1NUDA 2VZ3A 3H2PA 4LOUC 3QFDA 3QJFA 4LNVA 4MMZC 5EWIL 4UOZA 3D5OF 4Z7WA 4LEOB 5KYXB 4D0BA 4D9LH 2DAVA 3WFZA 5I6XC 3QE5A 4LVEA 3KPPA 1E4JA 2WSDA 5HGHB 5JW4R 1W0VB 4P2OC 3C5ZA 2ZCKL 2XY1A 1XIWB 4WHTA 3T2LA 3GDBA 4NRXB 3GMOB 4CSPA 1I8MA 4ZODA 4IOSD 3VJ6B 1JZ8A 3MTRA 2ESVD 1J9QA 4OZGE 3O11A 1OP3H 4XOAA 4BZ1A 1KJVB 4WO4A 3T8XA 1ZKAA 4G80A 4G8GB 1TDQA 3P3YA 1KJMA 3GK8H 1TEFA 1U6AL 1DDHA 1RIVL 3HPLA 4TNWK 2AXGB 4TL4A 4RFEA 2WBJD 4OZGF 5T1LA 5T5NF 1E90A 3VSUA 4YDNA 5AB9A 4NM8L 3JUYA 1HVXA 4N0YL 4DJMA 3CDGB 5F6HI 3HE6A 4G11A 3B43A 4LVNC 2Q3AA 2YD9A 2E0PA 3RZWA 2EDWA 1BBDL 3PQYD 3QZOA 3HS0C 4Z3TA 4JFOA 3BUYB 1TG8A 4XPTL 4ZFOB 5AAWC 4R83A 3SDCC 3U1PA 3OJDA 3B7TA 2PWFA 4N5UA 4WKZA 1KCWA 2J4WH 2Q3ZA 1E6OH 1TCRA 4KNQA 5IUSA 4S0SD 4FYRA 5FW8A 5EWIH 2PF6A 1SPDA 1I3UA 3RX7A 3KWUA 5DQJA 5HDOA 2ZUYA 3L16A 3QIWA 3EGXB 3D39A 1CXEA 3V0FA 2CU9A 3MROA 3BGMB 2AV7A 1U42A 3D1MC 3QEHA 3TEXA 2FBJL 2PTVA 4ZFGL 3QUGA 3RZCA 1UWFA 1EUTA 3PNWA 2IWFA 4QYOB 3DV4B 4F7TB 1X7QB 1SEQL 4PCSA 4ABQA 1HXYA 1Y6NR 4RLDA 3B1TA 5E9DD 3C2AH 3WSQH 2R8SH 4K8RL 5F0MB 3VH8B 1CYWA 2XG5A 4XOCA 4N1CA 4RFOL 5F1NA 2B9AA 4KOCA 3KLHC 3HE7C 1I53A 3OBAA 1A9EB 4GSRA 2DQIH 2DQHH 3G08A 5DQ9A 5JOFB 1DJIA 4KXCA 1K8IB 1MFAH 1OTUC 2AJSH 5IJVB 2N1TE 4HIHB 5CBEA 2CBQA 4XMVA 3IXTA 4BCYA 5LG1A 4R7VA 1WZ1H 5E1GA 4XO9A 2VITB 4YXLL 4YE0A 4LPTA 3TASA 4NBZB 1CFVH 5LBSH 4QNPE 4ES8A 7FABH 5J4MA 4Y2DC 1SVBA 1YDPA 2QVMA 3ARBC 3W0WD 3Q8AA 1JF1B 2XY2A 4BFNA 4DP6X 5KS9E 2IH3A 4MA8H 4X6FA 2BSED 5BV7L 2BOCA 3FQRA 4LCWD 5E5MA 1UD6A 4YVNA 2ZG3A 3WFHB 3GS4A 4O51B 1CK0H 1I8LC 3QS3A 5EFIA 5T3ZL 5CCJA 4CDHA 3LS5L 1U3YA 2XXFA 3PIQA 5IB3B 2WCSA 2NXZB 2H1PH 1YN7A 4M7LT 3SGKC 2YMTA 2HG5A 2EVFA 1JHTA 1NC2D 2X53A 1DUZB 5JHDB 4NBYB 1A7QL 4WJKB 32C2A 3OHXA 3O2WL 4AY0A 4FQ2H 3MBED 4PRHD 1BDYA 4AVKA 2MWCA 5HJ3A 1UENA 2MEJB 4PRAB 1GZQB 4ZSOB 3DETC 1OO2A 4J3XA 4X8XA 2R29L 4JRLA 3CLFH 2K9FB 1PZDA 2A4CA 1EHLL 2IDFA 1G87A 3OSKA 4MA1C 1QUNB 4KKLC 4OLYL 4AYID 3SYPA 3MQIA 4FNPA 3LIZL 5H37G 1PEWA 4A2HA 2FIRT 4PVBA 2GUOA 4LU5H 2AITA 4A7VA 4EI5D 4ONGL 4YC2B 3VG0H 3OZLA 1KIRA 2CWRA 4A39A 3LSOB 1AZBA 4UIKH 4WWOA 3WNIA 4E9VA 5I76A 4JQIA 3ZMEA 4NC1C 1I7RA 2EIEA 4POYA 4LF3A 3EH3B 3RE0A 1AAJA 5E5RB 4QT5B 3FQ2A 5FLVA 3L1OH 2DF3A 5F7UA 3ARGB 2C7FA 4KI5D 4QXUH 2VR6A 1X4XA 1DEEA 4PJ8A 1FL5A 1H5BA 1TETH 4L9LB 3SJVE 1WCQA 4Y1SA 1JXKA 4FG0A 1SRDA 1Z5LB 5L2JA 5A43C 3KPSE 1UEMA 3BC9A 2ZWYA 3WXVH 3IJSB 1EQWA 4PJDA 4ZUSB 1OANA 3X3GL 3FTXA 1AQKL 2V8LA 4OJCA 1IEAA 4AH2B 1CGVA 2GSGB 1KELL 3VU2A 3CLFL 5JPMA 1PG7W 4Z77B 5KYUB 4WTQA 1CS6A 3U9PH 2H26B 4ONHB 4TUOB 1NGYB 4CJ0A 4G6FB 3HBQA 3BGFB 2ZKYA 3GMOA 3KXFB 5I30L 4PUBL 1OWRM 2X6BA 3GSXB 2YJQA 3US9A 1VB9A 1YN7B 2H6PB 3MRQA 4OV5B 4HJGA 5ICYB 3IDYC 5CEZE 1QLFA 3HAEG 4G7VH 4LLWB 3TVMC 3UO1L 2PP7A 4IEFA 4JE4B 4KVNH 4Y9FA 3CVIH 5E2WH 4L8DA 2AQ3A 3IDXL 4D8PB 2B20A 5FYJL 3RBGA 3SDAC 1TU2B 4ERSL 2Y7OA 2B8OT 3Q5TA 3NQIA 3TGXA 1QBLL 3UBXG 5FW7A 1S9YA 3SYCA 2QR0B 1K3IA 2ITEA 1IRAY 3K46A 2H3KA 1QLRA 1F18A 2YARA 3P77A 1NUFA 3WMPA 1UA3A 1J8HD 1Q72H 2X42A 5DHDA 4Z0XB 1HINL 2BNQD 2OR9H 2XJLA 1NDGB 3QAZC 2P80D 3FSVA 1IC1A 3LSOA 3NZHL 4X50A 1IBDA 6CGTA 1HHKB 4FYQA 4WK2B 4XC1H 4Z0BL 1Y1UA 3Q5OA 4DK5A 4HBQA 3QDJE 1LDPH 4UIKL 4HWNA 2WIMA 4RMVA 1A6ZB 1KELH 3SGEH 2CR6A 3C6EA 1KDJA 2PPDA 3BWSA 4U1IB 1QQDA 3D0LA 4ETQA 2JQMA 5F7BA 1AO7D 4PBDA 5A2AA 4A66A 2B77A 1YJDC 3CFCH 3UTQA 3WY3A 1ORSB 4HDIA 3MGAA 4NN7B 2H0JA 1HZLA 5EO9A 3THML 3AY4A 4PJIA 4FHKA 3ULUL 4FQXC 4LOUD 3OKDB 3QUML 4KC3B 1FZOA 1X5FA 2FT6A 1SYSA 3DXAE 2X4TB 3V0JA 4E9SA 1XB3A 3T9WA 3X14B 1CMOA 3FTUA 3IEAA 1OAUH 2FECL 2CRIA 4XCNB 2JTYA 1LQBC 1T6WA 1DBML 4IIQB 1NUNB 1JYNA 5FYJU 3KPMB 2P52A 1UG9A 3LYRA 3SYOA 4M02A 4ESKA 3I6KA 2CBOA 1JERA 3UAAA 2SEBA 4XAKE 5HDRA 1VIWA 1RPUA 2D7TL 1CE1H 4XMTA 1NBVL 3W5NA 4I0PA 3TO4B 3S36H 3JV6A 1KULA 7PCYA 3MOBL 5EBWA 5DD5L 4E9WA 1JWUA 5IZ7A 3IFPB 3QDME 3UGXA 3CNKA 2YMXH 4U0RC 1IVTA 3FCSA 1SXBA 1UHVA 4H8HA 3U4AA 2ED8A 2DLGA 2V33A 1RK0B 1JYWA 1I8IB 3QAZB 3B8YA 4JPVL 2FEDD 4FX5A 4R2GD 5AOZA 2FJHB 3J07A 3QZPA 4A2GA 4YGVA 2EO7A 5F72S 1H6TA 5EFIB 1M56B 5KVGE 1NEZB 2BX5A 3DDGA 3V0IA 3HR6A 2EYSB 5DRZA 1EZLA 3L1GA 3LKSA 5BMFL 1ZPLA 4JKPL 2VN7A 2CHWA 4UQIM 4PLKD 1QA9A 4YSPA 4NO0B 3HTLX 2JSFA 2P5EE 1B9KA 2PABA 3BFQG 4ZS6C 4HOMA 3CGTA 3NIDE 2CPCA 2CLRA 3LH2L 2NY6B 3O6LH 4U1GC 1BEXA 2KC0A 4JJHA 3LN5A 5EC1B 3ULVC 1FL6A 3GO1H 5J6SA 2UZXB 3UIZA 4OLXL 5CUSL 1UB6A 4KRNA 3VNYA 3ZUCA 4D9RD 1R3JB 4LIQH 4HD9A 2ZJSH 2X1QA 1HYSD 1BF2A 4GJTB 1P2CB 2XIIA 1A4KB 2FEEL 2APBA 5DK0A 1RPKA 4ODTH 3UOAB 5IOPB 4AGLA 2CO4A 4EUPA 3CZFB 3JTSA 4AZUA 2PKDA 3PDOB 3NJFA 4OQTH 4K9EH 1H8NA 1JZEA 2EC9U 1YEFH 1F90H 3L3IA 4E41E 1ILSA 1B6UA 4N2CA 5B7EA 3KS0J 5MHSE 2IPTL 1OL0A 1E4KC 3QJOA 1SEBB 2B14A 5MENA 2VLRB 3NH7L 3IDJA 2GAZB 4MD0B 1E4KA 3MUZ1 4OZIB 4GKSB 4I3GA 5DA0B 4K0OA 1UYWL 3I3EA 3M7FB 3L5XL 5CLXA 4HFWB 3KYAA 2NYKA 4LQ1A 3RZCB 5H94A 4NN6C 3MRMA 4ZMNA 3RBSA 1I1CA 1S3RA 3N0PB 3NJJA 4LSTH 4HPOH 4M6NL 4QHMB 3MLWH 5A7EA 3K1KC 3FCSB 2F19L 2WVSA 3MJ6A 4JN1L 2NDGA 3NJKA 4XN7A 3V0EA 2ARWA 3TBSB 4QRSA 4IS6A 3GSRB 1EJOL 1O5PA 4W6XB 2PO6D 1QYGH 4Q6IC 3A22A 4AGQA 4XOEA 1ZGLB 1AOHA 1KGUA 1WC7A 2R4RH 3MFGB 4WI7A 3SKNB 3RTQA 2EYSA 5CBEB 1Z32X 4PN6A 5MENE 2P7TB 5EV7A 5FF6B 2A9DA 2IPKA 3VFVB 1GOFA 4BGLA 5C6WH 5FUZL 4NM8H 4N0CC 1FDLL 1IAKB 2QJDA 1F00I 3U1SH 1RUML 3H1ZA 3CN1A 4W6YB 3SODB 2AXWA 1RU9H 1B4JH 1XAUA 5I75B 1NLDH 3IFNL 4QXTB 2JJSA 3A5VA 3PDDA 5DZLA 1CICB 2EEBA 3L3GA 4DW2L 2CDGA 3QYCA 3SCMA 2GFBB 2G3XA 1BGXL 2XTJD 3V0DA 2K4WA 1X44A 1MIML 2AMGA 2RACA 4PGZA 1UXLA 4K23L 4WTWA 4O5LH 1XD0A 3PGDA 4JNXA 4N4YB 5E1QA 4NQEA 5CZVL 4X8CA 3CPLA 4YE4H 3GGWB 1RHHA 2X4NB 3FTVA 4M7JL 1OSPL 2J5LB 3KXFD 3NACH 2SODB 3VMPA 5A2JH 1BVKB 2YPVH 1RURL 3NGBC 1MDTA 5ABZA 2W65A 2F8XC 4G6KH 3MX0B 2X70A 3C5JA 5E4EB 1K6QH 1NFAA 2J3SA 1P4IL 3EOAA 4LNRA 4PMEA 1FNSH 1OE1A 2DQJH 3FFCB 1D6VH 3IXAA 2NSQA 1QTYT 3UZEA 4JFDA 2F6AA 2VO5A 1JWMB 3N43B 3A23A 4I9XA 3L9RB 1ZWIB 2KUTA 3BFWA 3S8GB 4HPOL 3L2LA 2I27N 4P2OA 3BKML 1LK2B 4AENB 4H1LH 3T0EE 1J10A 2C9QA 3PWVA 3S5ZA 4JHWL 3MR9B 3CD4A 4JFFB 3WN6A 2L7QA 1YMMB 4FF9A 4FULA 5EBWB 3KPPB 1J5CA 3ZKXC 1UOWA 2F2HA 3AFLA 3TCLA 3K6FA 3DSFH 4YFLI 4UDUA 3FH8A 1D5XB 3VI4B 4F5CE 2WLLB 4NRXA 3FZUC 5F9WC 3FMGL 2GKIA 5D93B 2YA1A 2A9BA 1H8SA 3NPSC 1KSRA 5MERB 1Z5HA 4ZTPH 3F12B 3C6LA 3ARTA 2NY4C 3CZLA 1CTMA 3HLAA 4QKTA 2DIAA 1A4AA 2LGNA 3V52H 2VDKL 5DO8A 5I5JA 1XGRB 4Y89A 1FFPA 5MHSD 2A6IB 3FONA 3ZX1A 1G0DA 2FWLB 2LFEA 3CVIL 4RGNB 4XBMA 3D25A 3HHSA 2C3VA 3ZZQA 5D1QB 4BFJA 1LDSA 3ARSA 4XVOA 1UWYA 3MRQB 2FQDA 3NEXA 3SD2A 4I3SL 3T0EA 1T04A 1TTRA 2WBJA 3NSDA 4XP4H 4ZD3L 4KZCA 5IB1A 5HPMB 3OPZH 2ISDA 5HYSG 2Y7LA 3KL0A 3V10A 5I76B 1RZIB 2VRKA 3HR5A 1SBSH 1NM9A 3KVPA 4URKA 5D7JC 5IGXL 5J12C 5GS0L 1LL1A 3IAQA 3B2DC 1MXGA 1G7HA 2HX8A 2LE9A 1EFXD 3OX8B 1IL1B 2ENYA 3ZK0A 4EJ1C 3VXME 2XWXA 1CFTB 1BMZA 2PPEA 4WDIB 4K3HA 3HG1D 4ZMXA 1DDTA 1S78D 3PDOA 2DKMA 4RVBA 5SWZD 2UYLB 2MCG1 4AQ1A 4ZMYA 1P84J 1CU4H 3BAEL 5ITFA 1UM5L 3ETTA 4Z7NE 2OW6A 1A3RH 3B4NA 4ZO8A 3TN0A 1E67A 1H8OA 2LLLA 5I1IH 4KK5D 4NDMB 4UQ9A 4DESA 1CE1L 1TF4A 1NGQH 3BAIA 1RJZB 4J3OH 3MV9A 1UA7A 3ECVA 4IMLA 4LP5A 3HEIB 4GG6F 1VKXB 3S88L 1F11B 3Q7JA 4GW5B 2N59A 5GS0D 4J3BA 2I9TB 5D7IE 1YMHB 1DQLH 1JGLL 3FT3B 4ZFFB 4FZEH 3KXFA 1T7XA 4HOWA 3P69A 1Q9WB 2IVFC 4J8RB 4M7ZC 2EE2A 3QJXA 4OF5A 3THMH 2BHFA 2AKRA 3MJ8B 4YDIL 5F0LB 5F9JA 1UUSA 3S3SA 4IEFB 2QQLH 3ZYIA 2YGOA 4QUOA 4OR1A 3DJTA 1NCDL 1NGPL 2XXMB 1FZKB 4RH4A 2V9UA 4ANXA 3KYOA 1U91B 2ICWJ 5LG6A 2IPUG 2R1YA 3P73B 1CJYA 3FUJA 3VXRB 5C9JA 3S37H 4A2EA 2IH3B 5CJQL 2BFGA 3BUQA 1N64H 3WY4A 5C0EB 3O8XD 1TTBA 4X6CE 2AJUL 5GGRB 4NC0B 5DO2C 3L5WB 3M86A 5IR1A 1UWEL 2ZG2A 4L0PB 4XVSL 1YEKL 2P24A 4JM2A 3F62A 3K6NA 4LMQE 4PTTB 4OT1L 3WNKA 3RZCC 5ACLA 1RZGA 4CU7A 3UTSB 3UROR 1XL6A 2YPLB 2FAUA 1KCRH 3NCYS 4MCYB 1WG3A 4UAOC 2DWDB 2R2EB 3EG9A 3BPCB 3MJ9A 2X2JA 1J8SA 1FBIH 2DYPB 4Y4FD 1DJYA 1UGKA 4RBPK 1QQDB 1O7VA 3HE7A 2D7MA 3LKNA 2KPNA 2OZ4A 1HZHH 3FUEA 2NXYD 4MAZA 3L5IA 3Q1SH 1OAZH 2WXMA 1XF5B 5LGYA 4YFEA 1FSKC 5A2BA 5DU7A 3JV4B 3ZXAC 3P40A 2OX5B 4PJAF 4D94A 2CKBA 1XSJA 4JQIL 1L6ZA 1G6RB 1MG3C 2EKJA 1S7UB 1CXLA 1OXYA 4YMPA 4XCFL 2AGJL 2PO6B 1IGJB 3QO1B 2OMYB 4B6ZA 3UBGA 1JFQH 1RHHB 1NAML 3Q5YA 4QHNB 4YR6A 3TO2A 2F5AL 5IFAH 3VMOA 2Z1PA 1AXIB 1QACA 3UTTE 3L4VA 3O0LA 1F13A 1ZJBA 2XU9A 2Y7MA 3WUWG 5F7HA 3SD5A 4RX4D 3MAWA 4AEHL 1W8EA 2YQ3A 3KVQA 1A3LH 3A6CH 3R18A 4YO0B 1KTLB 3HNVL 4PB0H 4HS6B 4XNXL 4LPUA 1OTUD 2ZP0T 2WINA 3LH8A 4TOYH 4PRHE 1MNUL 5LXGL 2BH0A 4QEGA 2W5PA 4Y5VC 2JQZA 3KWWA 5JIHA 1KGJA 3O41A 3VXPA 2HT3D 2JXMB 4FKHA 2VISA 4TTDD 5HDBB 4P5KB 5D70L 1N5AA 4JKLA 5EUOA 4YXKH 3UZQB 5DI8B 5LQBL 2FQFA 5JORA 4KQ0A 3JYBA 4Z3HA 2C9UA 3QPXH 3KEDA 3QQNA 2P1YA 5GRJL 1TZGH 2AI0L 5C2BH 3B3IB 2IDUA 1JGUL 1JPSH 3O81A 5CR1A 4OAWB 2L7EA 1IC4L 3BMWA 4LMQI 4H8PA 3EDKA 4FKEA 1R3HA 3VSVA 1WO2A 2V5YA 3T8VA 1QSEE 5GSRA 4Y19E 2WYTA 3VXMD 1YNTA 3PJNA 4PJHB 3O6FD 3O3EB 4EDXB 5K59F 4L8CA 2D7NA 5JTWA 5KJ4A 1B2YA 2YGNA 3ATBA 1RHFA 3I9IA 3TNNB 1JGEB 1IAMA 2WXRA 1MFEL 1NICA 2DM2A 2NY2B 4LDCA 4YL4A 3SPGA 2FJGB 2PW1B 4IDLA 3UAJA 5EBMA 3LOWA 2VR7A 4XAKD 2CRMA 4CNIB 1U3HC 1RZ8B 5E9DB 2NNRA 2C9AA 3TBWA 1MDAA 4X7TB 1YY8B 4DK6A 2YAOA 3BKCH 3NCJL 2PXYA 3LZOA 3CZUB 1TFPA 3K72A 4K94L 3LXCA 1HKLH 5AVWB 1M42A 4QMEA 1LE5A 1Z3GL 2AGJH 3BYTA 5BCAA 1W91A 3H3BC 2VDLH 2ZUVA 2W07A 1IAIL 4GMTL 4XXWC 2VAAB 1G7LB 3DC0A 3EFDL 3FUFA 4K7PX 3MNVA 4JPQA 4LCCA 4U0RB 2WXNA 4U1IA 4Z7VF 2DQTL 4NERA 2NT1A 1X9RA 2QSCL 3PP3H 2WJ5A 3PDGA 1KCKA 3ZTEA 2GUOB 4OZIF 5CJXA 4Z7UB 5KVDL 3NEOA 2AK1H 1G9NH 4PJ6A 2YWYA 4DKTA 2XBZA 4AG4L 1KT2A 3PWNA 1RJLA 4OZFB 2NY1B 2X4QA 4QRSB 3LRSB 4ZYKB 3WS3A 5JDSA 3MCLH 3FUDA 1TFHA 2ENJA 4HEMA 3MODL 3FC8A 2HKFH 4UNIA 5AD0A 4OSUL 2BIQA 2VN6A 2J56A 2WZ6A 2AEOA 1S7QB 3AU0A 4HBCH 5H4YA 5EZLA 4WEUD 3AG4B 1PPIA 2VDLB 1RI8A 4MX7A 1E9PB 3NJHA 4PJGE 4X0NA 5D7KD 4AV0A 1JV2B 5IFHH 2JI1A 4BA8A 1SGKA 4U1SA 3IDUA 2XQ0A 2FCBA 5E6IC 1BWWA 4AH2A 3BZ5A 2R1YB 3PP4L 5F3BB 1K2DB 1GCFA 1V3MA 1KXVA 3DK0A 4OIFA 5E6IA 4U6XB 1MZYA 4F2MB 4BH8B 2AJ3B 2MTPA 4UQBA 3GJFK 4MSWA 3ZOAA 5JIMA 1Z7JA 1ADQL 5JXAH 1ITBB 1INQB 1RIHL 4LAQH 2D9QB 2H32A 1XGQB 1Q0XH 4DZ8A 4P5TA 5EA0L 1BVNT 1X4YA 3CVHA 2WQVA 5A6LA 4G6KL 4RAUA 2Y1AA 3IGUA 2F8IA 1BBDH 4XP1L 4ZK8A 3RPBA 4X6CA 1E6JL 4GP5B 3BO8B 2ADFL 3G6DH 4NWTL 2WLHA 3GB7B 3NMEA 2XPGA 3HHRB 1K4CB 4L3EA 2GT9B 4POZC 1IM3D 5DUBB 2CM5A 2O6PA 3CWGA 4KO7A 4IGBB 4A6YA 3DYOA 3HE7B 2A1WL 3NA9L 5AB0A 3AJ7A 3ERXA 4WFEE 3KGUA 4L3AA 5KG9A 2FX9H 3V5KA 3SQBB 4NJ9L 4H25A 1WCBA 4Y16B 3OKNA 1KEMH 4P23A 1MVYA 1TJIH 4HX1B 1NIFA 3FN0L 3INUH 2XKNA 4UM8A 3ULSB 1KUMA 4UT9A 3H9HB 1IFHH 3ZW3A 1DUYA 4IOFC 4BA0A 1A5FH 1TZ8A 3N6YA 3TP4A 2V2XA 1YAZA 4B9ZA 2NQ3A 1KN4L 5HGGS 3U83A 5T33H 3GI8L 2Y1ZA 4QTIL 4BXSV 3ARDA 1W0YT 4KVCL 1LO2L 1O5DT 3WHXA 3SDCB 2E7LA 2YK1L 3NCBB 2QQKL 2YD8A 4B7LA 2WYIA 3U25A 1T03L 1DANT 5EZLB 2DBJA 2R0KH 4F27A 4ZMQA 1WE5A 2XV3A 3L7FA 4K8RD 4LLDA 1AH1A 3TJPA 2VRAA 2DOCA 3QG7L 4X6BA 1IEHA 3VFTA 4ZG1A 2JLLA 2CHZA 1DN0A 1BCIA 3ZDYB 5J89A 4JUSA 4TSAH 4KI5C 5FCSH 2IAMB 5J9PB 4OU3A 3E8VA 3L5JA 2HWZH 5JHBA 3ZRSA 1MOEA 1WBZB 3CDCA 5AZ2H 5C6TH 5MEQA 3A67H 1OIOA 3UMTA 4F3FA 2XVGA 5JIPA 3Q13A 1HHJA 4J39A 3BKMH 1XIWC 4MXVF 2MFNA 4GFXA 1OPGH 3OLGA 3T1FA 3AREA 4DP7X 4IRSA 2FLMA 2ZP8A 3U4EB 3MV01 4XP1H 3LNHA 2MHAB 2D2OA 4UZGA 2ERJC 1IKNA 3VG9C 2E6JA 2P3YA 4UB0L 4Y5VB 1MRDL 1ED3B 3F8UB 3H9SA 3OQ3B 3W82A 3WIFB 4D8OA 4D3CL 3HN8A 4M43L 5IK3B 1IL1A 2J8HA 3L5HA 3AS2A 1VFUA 4LSQL 5JNYB 3U2SB 5T3ZD 4OFVA 5C0EA 3GBML 3LH9A 3EIFA 2VMDA 4IK7A 4XE5B 4XP6L 2WXIA 2YPVL 2VUYA 3ZT7A 4P99A 5E4OA 4Z7WE 5C3LD 3DX6A 3BP7A 4FQQB 2V2TA 4X9FA 4BCXA 5F96H 4JL1A 1MQKL 1TQBC 4OLWH 5E6YA 3G6AA 1DYZA 1EEUA 3F2LA 1MHPH 3IGFA 2B1AH 2X4NA 1TTAA 3BPNC 3O6LL 5C0JA 4TQEH 3SE3A 2F8OA 1QKZH 2XI9A 1EFQA 3VFWB 5HJGA 4AYEC 1P6FA 1VEOA 5K39A 5CEZH 3QVAA 4CJ1A 5GXBB 4ES9A 2OMXB 1X9UA 2WZPD 4WNSA 2EDJA 4LLVA 5CJOL 1KC5H 3QR1A 5KSBE 1REIA 5BQDA 1I9IH 1A7RL 1S5HB 4ETYA 2ZYRA 3IJYA 4PCKA 3V0HA 2VXUL 1T1XA 4PJ9D 4CN6A 1J9SA 2N01B 4DPCX 4P23D 1UM4H 1YY9D 2VSKB 4W81A 1Q9LB 2Z0BA 1Q94B 4TM9A 1GSKA 4F8PA 3OAUL 2YD4A 1NMCC 1F58H 1OCZB 1QO3A 1NFDA 3MV8B 4X5PA 3FAXA 1MRCH 2CJTA 1QSFA 3PXJA 4NQUA 2R0WH 1SXSA 2Y36L 2UUDK 1AYRA 5CO1A 5IJVA 4JDTL 2WWMD 4XCCL 1R3KA 2WXGA 5D4QA 3O41B 4LT7A 2PPCA 4M5TA 1QFPA 4TTGA 4YLQT 4HT1H 5GRJH 1BJ1J 4GW1B 4JFQB 2OZNA 4EN3A 4QHKI 4Z7QF 4KKBD 1YDPB 3WDJA 5DHXB 3KG5A 4XMLL 1MWAL 2ZXDA 2A83A 4FTVD 5KSBA 2QZQA 1WA1X 4X83A 5F6IB 4OB5L 2YO3A 5AW7B 5FFGA 1ZANL 5TK2A 3S88H 3LD8C 3LNFA 4L1DA 4WTZA 1L7IH 2P5WE 3CFJA 3RNKA 3DSNB 3VFMB 4AYSA 5KZCB 1S8DB 2DL2A 2XG4B 5BVJB 1EV2E 1YEWA 1D6EA 3GBDA 1R5VB 3MODH 1K8DB 2KH2B 4HHWA 1JGDA 5BJTA 1U8LA 3VXSE 2IDTA 5D96C 4JHBA 3S36L 3CFTA 3QA3A 3K81A 3TO2B 4FCAA 1CR9H 1OOWA 4BDVB 1CC3A 1IC4H 5SWQB 5KVEL 5C70A 2E56A 3VXSB 5IHLB 2J12B 4H8QA 2CCWA 3AXLB 1U4EA 1JYXA 4ZO7A 2A0LC 3QUYC 3PP4H 1LMIA 3MYJB 3TN0C 3E3QE 5ABAA 2PCPA 3LNEA 3O6MH 3VXUE 5DJAB 1AI1H 1N6VA 5JPNA 4WZ9A 3MLYH 4AQAA 2VERN 3LPGA 2CLVB 5TPWH 1BOGB 2BNQE 4Q52A 2OMTA 1MCPH 4BELD 4Z76A 5KUMA 5I30H 4ZX6A 2DLFH 3GMMB 1GL4B 2YOCA 4FLQA 3QK0A 4J3WA 5D1XA 3FT4B 3TIDB 2ZX9A 2HT3C 1XF4A 3D8MA 1U8QA 3ZU8A 3BQUA 1SXCA 5LWYL 2BNQB 4JFHE 2WSKA 4HWEL 4GMSH 3Q9QA 5DHYA 1OSZB 2MQ3A 3FT2B 4ECNA 1I8KA 2V0AA 3HMXH 3HS0A 1SOQA 3MLSL 4J27A 1D2OA 1KB5A 1WWBX 2AQNA 2BSTA 2OBGA 3L9EA 3NN8A 4N8VA 2BVPA 4PB9L 1R3HB 4PJ8B 2R83A 3FW6A 3FU8A 3UCQA 2F53B 1ZEAH 1FL3B 3MCKB 4KY2A 5JUEL 3ZZLA 1LTXA 4JZJC 4YZFF 5ESVB 3KDPB 2NUTB 1N8ZA 2EECA 2VLKB 1WZKA 1CL7H 4KXDA 1JVKA 3EO1A 4EI5C 2F53E 1Q8MA 5HXMA 1MWAH 4BH7A 4PV1C 5J6HA 3FH5A 4PY7B 4ZUUB 4CSSA 2FJGA 2PW1A 5FCUH 3KPNA 5KVFE 4RRPM 4PIRF 4XCYA 3VO0A 2VO8A 5HHNB 3KH3A 2BXYA 4X4MA 5BV7B 12E8H 5C07A 5I0VA 1BXXA 3NZUA 1XO8A 1N5YH 2ZX8A 2Q20A 4HPYL 1J0HA 2BNUA 2Y36H 1XSKA 1N3NA 5GRYA 3CVCA 1MFMA 5I71B 3L1OL 5I8EA 3JZYA 4IK6A 3HRZC 1U8CB 1I9RH 4N6RB 5INCA 1FL6B 4G8GD 1CFMA 3ECUA 1GY2A 4PBVC 5IT2H 5K1JA 2WXFA 4F2MA 1YRKA 4O2EA 4AITA 4EN3D 2X9ZA 2VSMB 4WKXA 4NNXB 3MLXH 3LKNB 4OB5H 4WFHD 1IM9B 2CKBL 2W9EH 3P77B 4RDQF 1A3LL 1KGIA 4K5MA 4KV5F 3RGVB 3DX7A 1DVFD 2ITFA 1F6FB 5GGRY 4LCWA 1LK3H 3EBGA 4XBGA 4QTHA 4JY6A 1OB1B 2DTML 2YBRB 4KK5C 3WTYA 1NJ9A 1DQLL 5D1XB 5DUBA 5J11B 5JDSB 1KGYE 3APCA 2CJ3A 3OPZL 4WHYG 4P2QE 1T0NB 1MRCL 2VQUA 3L48A 1WT5A 3GMNA 3KGTA 4G72B 3GTVA 5E51A 3EYSL 4HH9A 5HYQB 1MZZA 2X0UA 4EIZC 3EGDB 1ES0A 4FLOA 2VOTA 5KVGL 4FFYH 1FBIL 4WWKD 2D31A 3S4SA 4P07A 3REWB 2K78A 4NDMA 3BVWA 5TDNA 1FLRL 5FHAH 1XH0A 2LT9A 4HIXL 3TZVA 1NOLA 4L1LA 1L9TA 2I60H 3GIVA 3VD1A 5EIIG 4B9PA 1BIIA 2XX0A 4YHZL 5GZOC 3VFRA 3L3KA 4OUOA 4Y4HD 3ZE2B 1ZHNA 1LWHA 5HHPA 4LASL 2G3MA 3KR3H 3MVSA 2Z31C 3QJTB 1PGRB 1PKQA 4JANB 3SDXE 2FQEA 2JCWA 2JLPA 3ZKMC 3SDCA 4NO5B 3D0VA 3DDFA 5DD3H 3PJLA 2SEBB 3ARFD 3EO9L 2FR4B 1VGEL 3ZDYF 4NAMA 5J0BA 2WVVB 3ZTCC 3V4VL 4G7YL 5EEZA 4YHKL 4L4TE 4QRPD 1EZUA 4K3EL 1ZLVH 1OB0A 1AS6A 4YPGA 1JG9A 1GC1C 5B39B 1MH5A 4KFMA 3FPYA 5C0IA 3HZ3A 4GQRA 3O4OB 2A5UA 4XI5D 3KHOA 3KPTA 3KE0A 3VD4A 1SEQH 3LPOA 2OMUA 4DAGH 5F0JB 3WJLA 4XMXA 1CFQA 2V2WA 3MTXA 1ZV5A 4HMCA 4M1GL 3ISRA 3V4PH 5DZ9A 3VRJA 3JTBA 3TJEH 1N4XH 1L0XA 1FO0B 1TVBA 3QARA 3NSXA 4UB0H 2HVKB 1FNLA 5JHMA 4E5XA 5ACZA 2OMZA 4LBEA 4IRSD 2ZPKL 3OC5A 1KXQA 5HGBB 1RURH 2E7DA 4M4RB 3S9DB 4JVPA 1AGCA 4K5LA 3DX1A 1CDYA 3CPLB 4LFHG 4OVUA 4KHTL 1CFSA 3WE6A 1E42A 3AS3A 3MLZH 1ZMYA 2HB0A 2IDCA 2Y7SA 1UQSA 4FC3E 1FFTB 2HUEA 1F6AA 2B59A 2XN9E 5I16A 4B9CA 2A6KB 1MXDA 2A73A 3C9NB 5CJOH 5FDYA 4I2XE 4NZJA 1GZHC 5I1DB 4U33A 1WQVT 4AQZA 5GS1A 4Y2DA 4L4VE 4B95C 2CIIA 3NAAH 5SWZB 3H3PH 2FD6L 2HKHH 4GY4A 2I69A 2YD3A 4JDTH 2AJYL 3W39B 3DI2B 1P7HL 2QMKA 3G6AB 1W6LA 4OVVA 5D9SA 2A9NL 1UXWA 3U9WA 1ADWA 3MNWB 1I8KB 1QABA 3LRSA 4MASA 4DOHB 4ZYKA 3PWVB 2FVNA 2HFEB 3VU1A 4UILH 1GS8A 5I82A 3FSOA 4YWGH 3GBMH 3Q2WA 4YX2H 3J7HA 2NCMA 1OEZW 3HI6L 1A7RH 3MOAL 4JREC 2BVOA 3DMMD 3MFFB 5HHMB 3EJQA 1GXEA 2WK2A 4APQD 4BGDA 1KWGA 3AU1A 3TEWA 3HG4A 4XP5L 1ADQA 4IU2B 2ZUUA 2AJZB 3M1CA 4TNVF 3BT0A 5E4EC 5IJKA 3AQYA 4UUJA 1PIFA 1MIEL 3Q8EA 4ENEC 4OFKA 2VTFA 3V4UH 4Y5YB 4F7PB 2NTFB 2KI6A 1Q4NX 5FXCH 4MJID 2QVTA 3L9YA 4NZUH 1THAA 2JVUA 2ZYHA 3CMOH 1OW0A 4O02A 5HYSB 4XPAH 1WWWX 2P5WA 4NQQA 4FMKA 1KJVA 3PPEA 4QXTA 3POHA 4PJ8C 4RNRB 4R3SA 1M57B 4C4KT 1BVLA 2E9BA 4L2YA 5ERWA 4UTAH 3CFJB 1G7QB 4PLOB 1XSIA 3MXWL 1VCBC 1C1EL 1J05A 2Z93A 3U7YH 3L3GB 3FQNB 4BFOA 4R0LC 1QI5A 2VH5L 4JN1H 4N87A 3K8MA 4KVCH 1RUQL 5C0BE 5L8JB 2UYLA 4AQ1B 3L4YA 3CMOL 4ABVA 2XVKA 2J44A 2WXPA 2VUOA 4DGYH 1G1OA 3GSNB 4V1DE 5CEXB 2VDNB 1F4WL 4LLAA 3UTPD 3S4SG 1JHLL 3B83A 4LBAA 3MRDB 1OY3B 4WEBL 2WQ8A 3TTSA 3SBWA 4P46C 5T5FA 3K6DA 2Y2YA 1EDHA 1A64A 4I5BA 2RFXA 3R06B 4ZW8A 2VNCA 1NSNL 2PCPB 1KBPA 4K15A 3WTSA 4X5XB 2JI2A 3MRNA 3UERA 4JRYB 1J48A 3CC1A 1S46A 4MHHI 2VZ1A 2J21A 3DO7A 1CB4A 2QTVA 2LTQC 4EN3B 5IW3A 4WI2A 2B5IB 2OMWB 3VH8A 1MF2H 4B0MB 2OL3B 1QTPA 2MH4A 4YHIA 1CGTA 2DEYX 4HUNB 4MRCA 2VB5A 3ARYA 4GAGH 4IU3A 3WEXA 4N2KA 1WAAE 1GMIA 2CHDA 3CLEL 4K71B 4DFHA 3JYCA 3DXAB 2Y24A 5DD5H 4H7VA 1XXFC 4DTGH 2VZVA 3TJEL 1XH1A 4MDIB 1VGKB 1WP6A 4N9OB 1QFUH 3EW3B 2O5YH 3M07A 3FRUA 3ULVD 2PPFA 1PAZA 3QIBC 5F3BA 3Q3GB 2QQQA 2XIDA 1BSIA 1Q9OB 2X38A 1W72H 2X2HA 4LP8A 4XN9A 3C6LB 3QUMH 3B9DA 4JPWH 1P84K 2P9RA 3OKMA 1QNIA 2KQMA 2Q7YB 4PP2A 3MRBA 4YAQB 3QXAB 5CSBA 3ECQA 2E4TA 5HGBA 5HI5C 5LHDA 1EJ6A 2A0LD 4NN6B 3GZKA 3BEWA 4CVWA 2QPDB 3EJZD 2OX5A 3C5ZD 4JKWA 4LL4A 1VACA 3GIZL 4YBQC 1Y0LA 2V2TB 3MHZA 4LHUA 1CFNB 1RIUL 5B1JC 1HHKA 4N0UA 5FECA 5F89A 2FO1A 1M3IA 3IVKB 1MCRA 1BQKA 2D4FA 4JO1H 1FLRH 2HRLA 5FHAL 4WI0B 5I1LA 3BWUF 3QG6A 5C71A 3CK0H 3MUGB 4H25B 4JJOA 4JQVC 4QRPB 4B96A 2UZYA 3OKEA 1S9XA 3QEUB 5GS1B 5C08D 3NCCB 2WKOF 2DQTH 1AR1C 3HI5L 3NCFB 4PRPB 1MLBB 3JVGA 5BXFB 3QXTA 4Y4FB 4ONFH 2CUAA 1TQBB 2VLLB 1S5HA 5D70H 1DVSA 2ZAHA 1IV8A 1T2QL 3PWJA 1WBXB 3QZWA 4P2QA 2XVBA 3T6ZA 3OKDA 1MAML 3CZNA 1VPOH 3PV6A 1W72A 4WNJA 2NY1D 4YFDB 2WUBH 5SWSE 4K94H 2G2RB 4UBDC 4YHKH 4MJIE 3C60A 1CICC 1KCRL 3DOSB 2ZXAA 3IFOA 4PCYA 2P80A 4PGDA 3BRGC 2HFEA 2QHLA 3FRPB 3CLWA 4N2MA 3QIWB 3QIUA 3SY0A 2LU7A 3R19A 4Y4KD 4U1HB 2NY7H 4WENB 4XXCC 2AKRB 3AT9A 2AEPL 4NKMA 1MHCB 4Q14A 1QSFD 2O5XH 5TH2A 4PJCE 3SEPA 3UGUA 1MUJA 2OXHB 4HJJH 3VXNB 2HT4D 2OULB 3BVDB 3X3GH 2DYPD 1UWGH 1YEJL 2ADJB 2JB6A 1OT4A 2HLAB 1FNEA 5L2KE 1ZXQA 2IANB 5LO7A 2CO3A 4YDIH 1NBVH 3RP1A 1IEBB 4XNZC 1Z3GH 3QI9B 4JB9L 4FQIH 4F7PA 4CW1A 3CIAA 4PM1A 3HHMA 2WXKA 4YEFA 1YEGH 3K2UL 4Y1AA 1BPVA 1QBML 3DX7B 2OAAA 4N86A 1OP4A 4ATWA 2W60B 1PX4A 3SB3A 2Z31A 1PZ5B 1DQDL 4OKVA 1HDMB 4OGZA 5A7BA 1UASA 4WUKH 5EOQL 5DR5L 3RIFK 4J3SA 2R59A 4MKTA 4RWYH 1QFHA 2ATPB 1U8IA 3KM1A 2NY5C 3EJSA 3AZUA 2W0FA 4ZUWA 4X6DE 3AXLA 4EI5B 1CDCA 2XKSA 3BPNB 3QG6B 2WXLA 3QORC 1FFPB 5I1EL 1XF2A 1CU4L 1EXUA 3SDDA 2GHWB 5HYEA 1XZ0B 2F7IA 1IGCH 1PTZA 1UWXH 2WWNA 5ISZB 5EZOL 4AV4A 3QPQC 4AYDC 1ODUA 2D03L 2ZXWB 3CZFA 3SPJA 1O0VA 3QUKB 5DJ0B 2VDQH 2YPVA 4Z7OE 2DM4A 2FDBP 3C60D 3BMVA 1U21A 4HZLB 4U0QB 3ZIYA 1FIGL 3T6XA 4RWYL 2DQGL 2VDPH 3RGVD 1M9WA 3PWNB 3T4AC 3QPKA 5C2BL 3BZFA 4WW2A 1U8QB 2GAZA 1GZQA 1J0KA 4QXUL 4NQCE 3FTGB 5DEGA 3N5AA 4NKDA 3ZDZB 3ZBMA 4WJG3 1Q1JL 1MJ8H 4FN0A 4OUUB 5D1XD 4QRUB 3O2VH 4FQXA 5LNDA 5DMGD 4DPBX 2BWDA 4M6ML 2ILLA 4L2LA 4U05A 5DWPA 2J8OA 5CEYA 4NFBA 1GYAA 1VDGA 4XNYL 1U93B 4TRPL 1TLKA 2Q86A 1G1KA 4ORZC 2QLVB 5GJSH 3WELA 2DQEL 2WXQA 4UNVA 1J1OL 4KRMB 4KZDL 4RMTA 1I9IL 1N19A 5I1HL 4ZNEA 1Z2KA 2IGFL 4PW9A 3VXNA 1J87A 1UXWB 4IYKA 3LKRA 2BINA 1YUKB 2V17L 2P5ED 4P2QD 2G9HA 2JJWA 5HVWA 3UL4A 5T1KB 2Y69B 2YXMA 1LDPL 2NX5D 5E95B 2WCPA 4G9FA 3MRIA 5AVTB 4DZBB 3T0WA 2DI7A 1Z9OA 3P4LA 2Z8RA 2HSIA 3I2CL 1INDL 1NA8A 5C07B 1HINH 1UA6L 2PTTB 5FM5M 1QLEH 4JFHD 1NZRA 1E9OB 1A6TA 3IRPX 1JGVH 4APQA 1DUZA 1QBMH 1Z9MA 3C8KA 1WGOA 3G5YA 4WI8A 1P7QD 4IQHA 5DT1L 3VXQA 3TCTA 4DP4X 3DVNB 2YGVA 5C08E 4QJ3B 2KS0A 3OXSA 2R1WA 1DL7L 1IAIM 1I1YB 4LEXL 4Z7NF 4ZX5A 2B1HL 3FQWB 1GYCA 1BFVL 4FXLA 1YEJH 4FZ8L 4JFWA 1MSPA 1IARB 1V7NH 1ET5A 2KT6A 4QOKE 1KDIA 3HFML 3WLBB 3VXOB 1S7SA 3I9GH 1C5CH 5DWUH 1RZ8A 4JKNA 4Y2NA 2Z91B 2BS8A 3RGVA 3WHE1 3L3HB 3P0VH 1RUAH 1JRHL 3KD4A 1YMMD 2WBXA 2QPUA 3FTSA 4QAMB 3IRZA 2YAEA 3OMZA 1EERB 5F93C 4GKNB 5D1QE 5D2NA 2W38A 2APFA 1AHKA 5IFJA 3H42L 3HZVB 1Q38A 3MUGA 2X4UA 2I9LB 2F58L 5HDQH 4CKQA 4MMXC 3U46B 4GSUA 3ALXA 4PS4H 2QQLL 4Y4FA 4HWBA 1Z1WA 5E7FA 1LE9A 2F5BH 5I9QB 3ZL2A 2F7OA 3C6LC 5HVGB 5L2KD 3C6SB 1V8HA 3DK2A 5E9NA 4Z76B 1CBJA 4RAVB 1WUNT 2A4ZA 1X7QA 1KGCD 1SBSL 5IGXH 1IC7L 1NLDL 3IFNH 2Y25A 4F57L 2R0WL 4NC1E 2DLTA 2YK1H 2NX5A 1TJGH 5E1HB 3PABB 4Q4IA 1IM3A 4PJXF 3F04A 1A6ZA 3HW7A 5GRVK 4OGAC 3GINA 1NC2A 3F58H 3OMIB 3PQYE 5AZUA 4CU8A 3LEXB 2JKWA 3MGOB 2WBJC 4QKXB 4JB9H 1LO4H 2X05A 5JLZB 4I7ZC 4QHKJ 3CPUA 3BW9A 3DV6B 4Q9BA 5JW5B 4NSKB 2ZD0A 3D07A 5DJ2B 2NZIA 1A3RL 1FL3A 1EZVY 1FFRA 1RMFL 1JPFA 3MCKA 4TNGA 3U7WL 4E9TA 4FFYA 3Q48A 3D9AH 1E9OA 1N5AB 1G7MB 5AVSB 5D7IB 3SDCD 1P9MC 3FO1A 4RCAA 3ESPA 1MRDH 4Z7VB 4NQVA 3A47A 4XCNA 4LVOC 3BP4B 1RCYA 3U2JA 4GB9A 3F7RA 3JWOH 1CT8A 4KXAA 3QI9A 4MKMA 4X6FB 5E2TH 1U6AH 1UXSA 1SDDB 3ZO9A 1NLBL 3BIKA 4CVZA 1UWXK 1KTDB 2ATAA 3WG7B 4PPTA 4S1SL 3VRJB 1NSNH 2BMKB 3QEQD 3VA6A 3VD3A 3I9AA 2FUQA 4R90H 1NDGA 2WUBL 3HC2A 2AW2A 5EORH 4NM4L 2YXFA 4L8BB 1A1NB 4C57C 1FFNB 3EJCA 4TXVB 4EZMA 5I24A 5DGQA 2K70A 2ALWA 5E94A 5E70A 2FJHA 1AQDA 2OA9A 3GKZA 3H7BB 3QJUB 1CGSL 2G30A 4LKCA 4RFEB 1ADQH 1BFTA 3SHSA 2E8ZA 1CFTA 3MRBB 4NRYA 5EUKB 4MLIA 5CD5D 1AGFB 3VG9B 3HE6B 3WIHL 1Z9NA 2JELL 2QPEB 1BIHA 2HXAA 2Y7NA 3NACL 2YN3A 6FABL 1JZIA 3L9BA 3SPVB 4H26B 3K72B 1HSBA 1P69B 2WAHA 4QXWA 1WS8A 5EEYA 4ZW3A 4ODUA 1LVEA 1SOSA 1A1OA 3HZYB 1EGJA 3RB5A 5IQMA 2D0HA 4QCIA 3DGGB 1SJVA 4AM0B 1WJ3A 2YEZB 4BXVA 5LN4A 2G0KA 1O6SA 2A6DB 3CSPA 3CXHK 2HKFL 2NY0D 3KPMA 4IKJA 4PJFA 4W9EC 1CXIA 1FIEA 3WFEH 2BCKB 4GUPA 1IJ9A 4LAJH 3BP6B 2BSCA 1JNHA 1LEKA 1X5HA 1F0LA 1NCCH 4DH2A 4S1SH 2Y07L 1Z5YD 4JY4B 2YAMA 4GQ9L 3QRFM 4EUPB 5C0GB 4J3OF 1QFOA 3NZSA 4Y8AA 3BN3B 5K69A 1INEL 1WZMA 2A1WH 3NA9H 3FZUD 3IU4L 3TEUA 3L3IB 1IGIL 4F8LA 1J1XL 5IBUB 1EEYB 5FUCC 1QFUL 2G9HB 3LKQA 3D2TA 4FCHA 1CGSH 3GI8H 1DQVA 2Q76B 5KYNA 3P4OB 1TITA 5EG6C 1QRND 1AFVH 5K9JL 1HHJB 1A5FL 4D9LL 4PRNA 1V3KA 3N44B 3B7UX 2WVVA 3V79C 3P0GB 1FYTB 2QL1A 1F3DH 4BUHA 5AVVB 1JSYA 1TVDA 4RQQB 5EHFA 1G5AA 3GXDA 2YKLL 1IKFH 3KCWA 2RALA 3M88A 3MKKA 2NY3B 3MDJA 4LLWA 3D39D 5D7LB 1E30A 2WAQA 3Q2NA 3S5YA 3SJVD 1GYVA 4Y5VA 4BEIA 4RMUA 2XZAL 5HYJE 4PW3A 3WKML 4FXGB 4UINH 1TQTA 2IANA 1ML0A 3QWOB 1KCLA 5DZAA 4NENA 3INUL 1BQHG 3OR7B 2HRPH 2V3DA 1NCCL 5FKPB 3SGEI 3A4DA 4F5CA 5ILTH 4XP5H 3QUHA 3FQNA 3OKKB 3L5XH 3NJXA 2JCCA 3PRZA 3WGVB 2EKSA 4MGXA 4XNMB 1AZRA 1MCNA 2VR4A 4EUPH 5MEOA 1UZ6E 2H9GA 3RDTB 2ZCKH 1R5WB 1KBWA 3ARFA 3FQ1A 1HSBB 4Y5XC 1HHHB 1NGWB 2HTLC 2XFXA 2ID5A 1GGCL 1MHEB 2Y06L 3WE6B 1XSOA 4DGYL 3IFLL 4FTVA 4BZ2A 5DRNA 1U8IB 2F54A 5FO9B 1FI8C 1NEPA 5B38A 3F58L 1UZ8A 4FI7A 5B3JF 3R8QA 2PLTA 2D2CC 4P9HC 2GFBA 5FYLD 1D7FA 5AEAA 3QUMA 1JK8B 1Y6KR 3BDBA 3K2MC 4GRLB 5F88B 3VW3L 3SDDD 3QQ9D 2EDEA 3B3BA 3QUKA 4WV1B 5I66B 1J7VR 5CWSB 1DUYB 3IWVA 3CSTA 4NLHA 1DHKA 3I74A 3D85A 3GXMA 3EBIA 1MUJB 1D5IL 3MV9B 1O9ZA 5KVEE 4YDJA 1AJ7L 1W6WA 3MC0A 1A9BB 3BQUC 4M29A 2GSIA 1JL8A 5KJRL 2JB6B 4QRFA 5AVQB 3AG1B 5I6NA 4X9HA 1BF5A 4E68A 2HTKD 3G5WA 1YO4A 5EU4A 2DYRB 5F9OH 1FL5B 1H5BB 4YSSA 2NY1C 1IMHC 1DVZA 4J2XA 4MNGA 1K5NB 1S5IL 3TT3H 2I60L 4ZNEE 4MD5B 1WFOA 3L7EB 2CALA 3VYPA 2BNUB 1IKOP 2AK1L 5IB2B 1EHNA 3DIVA 4XMPH 2XA8L 2ZCLL 1C5CL 4KPHL 4FE9A 5DJDB 1PEZA 2PWHA 4BYHA 1ZE3C 1HEZA 4KZ0A 5I1HH 2XQYG 3CFKB 3FU9A 4JRYE 2GTWB 2QTEA 2H45A 3QQ4B 4JGUA 3ZQXA 4EEEA 3KYKL 1TQCB 1KBVA 5J9PA 1X5YA 1N2RB 3GSNL 2W9DH 4P46D 1I7ZA 1H0DA 4OD3H 4WCYH 3U0TB 4EI5A 4KTEL 3T08A 5IVZA 2AXFB 5MI0B 1T5WA 1OQOA 5D5ME 1WAAF 4X42A 1E7UA 1X6NA 1D2PA 2CRYA 4HG4K 5IY5B 4LGRB 3UC0L 4M8RA 5IHHA 1Y0LB 2N0MA 1NGWA 1W8OA 1FNAA 3OAZK 4XMWA 5IMKA 5KYYB 4UM9B 3UCRA 2QHRL 4BK5A 4KGJA 4JDZA 4LXFA 1KIUA 2DJSA 4QXGH 1OAYL 3FU0A 5AUMA 4DPAX 3NCYP 5EC2B 1KJ2L 4GKZB 3OAYH 4QF1B 4LHUD 4WF7A 5B1AB 3IWUA 4W4OC 1SFHA 1P2CA 5J12B 2VIRB 4BD4A 2QFRA 2DMBA 4EXPX 3T77A 4KROC 3WXWL 2CO6B 5ADOL 4UQ2A 2H7WA 2BWQA 5IB1B 3LRHA 2F7QA 5F7EH 4OY9A 4GXVL 2HFFA 1NAMH 5E4IA 1RJLB 3QCVH 2E7BA 1ZT4A 2PXYD 3QI9C 5T1KA 4I5BB 4PJEE 1DBMH 3SN6N 3L3DB 2FK9A 5KBDA 3MV7D 4PGBA 3EHBD 2BSDA 2BOBB 1TQVA 2ICEA 3ROOA 4JPIB 4NO5A 4LLVB 3QJRB 5IMMB 1A65A 4MJ5A 2VLME 1AC0A 5I2IB 1O7DE 2BNRB 3FAWA 1RQ5A 4PRPD 4FQIL 2QLYA 3MRGB 4F15B 3CH1A 1BQ5A 4PLJD 2F9BT 5DSCA 5GZND 1OAQH 4ODWB 3IPFA 2WKLA 4ZO9A 3TVMD 1EEYA 1CFBA 3MBXL 2Z34A 4UT7H 1CLOH 2KMWA 2F58H 3TONA 5HDQL 3HNVH 5EZJA 3RI5K 1UJ3C 3ZE0F 5T3XH 3ZT6A 4KKCC 4D0CA 2AJ3A 3R1GH 2WXHA 1HHIB 1QRNA 1QNZL 3ESUF 1CFQB 1MJUH 4P05A 3N85L 1EBAA 3QRLA 5KSBF 2H32B 1Q0YH 3OMAB 4C56E 3QWRD 4H88L 5DUPL 2WKOA 4IBWA 1KG0A 1I1AB 3KYMA 3T04D 4JRXB 4EDXA 3ISWA 3N06B 3BXNA 3PF2A 3K2UH 5CN1A 2ZWZA 1E5BA 3QUXC 3V5DB 3FO2B 5CZRA 1YC7A 3K91A 3C2AL 3WSQL 2APVA 5FCUL 2CBTA 2VZOA 3DJRA 2LAAA 1YNKH 3QI9D 3QEQA 2HT2D 1LE9B 4BQBA 4DCQB 2GK0B 1T7WA 2IV8A 2WC7A 1OE3A 2P24B 4JM2B 4RSVA 5I15H 1IGFH 3LXUX 3O4OC 4JJ5B 3GMPA 4RAVA 3RJDA 3F5WB 5ESAA 1N0XL 4QLRA 3RL1A 5GGVL 5T3XE 4PHZA 2VN5A 4KROD 5SWQA 3GUFA 5CBAB 4IMLB 4LCCB 3PWLB 3VNZA 4JE0A 4X98B 4ICWA 5F3FA 4R96A 4NJAH 3QCUL 3QUMB 5DVKA 4XHJC 1WA0X 2EIZB 3PNWB 4WFGE 5AFAA 5IMMA 1IKNC 4MDJB 2I7SA 4AQAB 1DBBH 1NWOA 4GSDL 1OGPA 4XN8A 4PWJA 4TNFA 1IQWH 2NR6A 5C0CA 5ILTL 1J5HA 2GQHA 4QYAA 4ZW5A 2VWEE 4CGTA 3KLDA 1S7UA 4RIRA 1GZPB 4M5ZL 2FEDC 4ODSL 5GS2D 1WGVA 3ZN6A 1YPZB 5CN2A 1NKRA 5TDNB 4Z7VA 3O9WA 5H37H 1ZXKA 1XGUA 2IQAB 2WN3A 4DT2A 4M1CC 3WS3B 2YEZA 2NLJA 5D1QD 2DD8H 4XAWH 5JW4N 2DM7A 2L4OA 1PJWA 4PEEA 3J8F7 1NOFA 4WLCA 4XNUL 1XD1A 5C0RL 1N5YL 5J57B 2NW3B 1HWWA 2H26A 4JL2A 2Q3XA 4P3DA 1XQ4A 4MB3A 3TPUA 3LHAA 4DTGL 3L8QA 3EADA 25C8L 4KJWD 4H0LC 1A2YB 4U2ZA 3VXPB 2CXGA 4ACTA 1HHGA 1G1CA 1SBBA 2AZUA 5BZDA 3V7AE 1AGDB 1M6OA 4OCSL 1JNNH 4MVBD 1MG2C 2IGLA 5HHXL 3E80A 5IJKC 2ZONA 4YSAA 5C0CE 1MF2L 1HILB 1NAMA 1CDHA 4UF7C 1XF1A 1OAYH 3F12A 2V2WB 3TBVA 1QKZL 3W11C 3CC5B 3S98A 3D3VE 3EOTH 1G7QA 1ZGLA 4G3YL 3NA4A 2WLMA 2IF7A 4W9ZA 5D2LB 5DJXA 5DCCA 5T1DL 1YQVL 3L4XA 1MVFA 2LLNA 1QLRB 3E6FA 1YEHL 5C3TA 3OZ9L 2F74B 4JLRA 3MXVH 1A4CA 3NIFE 3QSKB 2BIPA 3N1GC 3VJ6A 5DJ8A 5ELIA 2QKSA 3DARA 3ZL4L 2JKTM 2E46A 3KGRA 5T3ZH 1L9SA 3MACL 4DETA 3EYQC 2WO2B 3SDDC 4GG8A 1WUZA 3ILEA 3EKCA 3JBG7 4ZW7A 3MREA 3RDTC 2GY5A 4AXWB 2BY0A 3CQQA 4UT6A 1UZ6F 5DURB 2UXTA 5HGAA 3II2A 4DQOH 5I1DA 3VI4E 3WTVA 3P4MA 2IBZY 1JS4A 3FCGA 1XGTA 3CK0L 2AK4A 4IBLT 5C08B 1XCTA 3ATAA 3B34A 3W2DH 4BINA 1YY8A 5BO0D 5MEOB 3KLAB 2QDVA 2WLYA 5I6KA 1F1GA 4AQOA 1URZA 1IIIA 4GXUM 3EAKA 5GSVA 1HHHA 4A7SA 4W4OA 1TCRB 3ZKNC 1WS7A 1C16B 1VEMA 2YSTA 5CEZL 4TSBL 1EX0A 1D7CA 2IAMD 3OHMB 3ZQWA 1GHFH 3LB6D 4X9YA 4TSAL 2M8XA 3D09A 3GMNB 3IM1A 4ELKA 4U1MA 5C09A 3NFSL 4R7DB 3WUWA 4K8RH 3LX9A 2IGTA 2GJRA 1BD2D 3TBTA 5I26A 4B9IA 2MCAA 1AKPA 1L7TH 3B1UA 3FFCA 4NQDD 4J12A 2Q86B 1ANUA 1QI3A 9PCYA 2FHBA 2AVFA 3QZLA 2VLKD 4DGWC 1P4LA 5IV2B 3MRLA 1DN0B 1X9LA 4NKQB 3APNA 1C1EH 3LQZB 3TZVD 1EK3A 5GS0C 2AQSA 3SBQA 3UADA 4DQOL 3UX9B 2I5YL 7PAZA 2G60L 2VKWA 5CMAB 4YE4L 1K6QL 2P48B 1WZLA 1JK9A 2X4PB 5E9DA 4OF3A 5IKCA 2R4RL 1G0YR 3OLEA 3VE0B 5DTFA 5HYSA 3E6FB 3CQPA 3IJ8A 3MZGB 1EA9C 1R5WA 1L3WA 4JFPB 3OB0K 1SY6L 3GMRB 4A37A 3MXVL 2AEIT 3Q05A 2HVBA 3KL5A 5C0AB 1T0MB 1JZ3A 4N0UB 5FECB 1PF3A 2XACC 43CAA 1RL1A 2R2EA 4OGYH 4BH8A 1S9KC 1MIEH 4PWFA 5EF0A 5LJYH 4AZ8B 1GIGL 2CBMA 5DHVA 3D39B 1VFOA 3VTMA 3PL6A 3TV8A 2ENPA 3IDMB 3V6FB 1E8YA 4HJSA 3ZE1B 4RESB 2ROXA 3F5WA 3VA2C 3N1PC 1XGPB 5IHZB 1F86A 1NGZA 2X7LB 3QDGD 3DETD 1WBXA 3QZWB 4P2QB 4BWTA 5JHDA 4TL5A 5EU6D 3RFZC 3MOBH 3N40P 5F96L 4M8QA 1GPOL 3HN5A 4N5EC 2APTA 2VM9A 4F2FA 1FO0H 5HYJD 1TNNA 3MO1B 1K8IA 4NQSA 1GTNA 4XNUH 5C0RH 1NCAH 4HSAC 3GSUB 3TT1L 2GJPA 4WEMB 2UY7A 3HRZA 5DO2D 2YPLE 1P5UC 4HS6A 3AT8A 2X6UA 1LP9A 5FYKH 4KZEL 1E40A 4HK3N 1LEGB 4X99A 4FLSA 1W0WB 4HWBL 4XO4A 3H6JA 3GXPA 3ARBD 2UX6A 3G5XB 2OCCB 1QW8A 4I9WD 3TA3D 3S35L 1PZ3A 3LQZA 5I6MA 1T20B 4Z3GA 4F7MA 3BIAX 1UATA 4HOXA 1JE6A 3K71B 5DMJB 2FX7H 2KZWA 2VERA 3NP3A 1SHXA 3FF8A 1EANA 4PP1D 1JPFB 3FTZA 3NTCL 3R7QA 3ATDA 3ENEA 5ENWB 3CUPA 5T1LD 4ODHH 3O3EA 4JCMA 3BKYH 1BG9A 1J1PL 1U58A 3EJTA 4HCRL 4M1GH 1F90L 2X4OA 1OCRB 5JXAL 4Z18A 1DDHB 5DRZB 4LEXH 3SCMB 4D2NA 4OLXH 3MRKB 4KKLD 4PIBA 4FQHB 5CUSH 2N56A 1H3XA 2XWBA 3QQDA 4Y16A 2VIRA 5G5DB 5FKPA 1I4FA 3L45A 3LXBA 1BWMA 4P57B 4RDQG 3TFKD 3WHE0 1K3ZA 4IGBC 7CGTA 3UMNA 3M17B 3O3BB 3QH3A 3BVTA 4KMTH 4YC2C 1UD2A 4WK0B 5J13B 2MHAA 1GAFH 3HZKB 3BPCA 3EOBA 3MRJA 4X5QA 2J1XA 3WTUA 1IBGL 2O93L 2N1KA 1FORL 4JFEA 5FYJE 4JGJA 1LWJA 2C1PA 2FYVA 1NEUA 1KV3A 3ARDB 3EDDA 3MNVB 4FEIA 4NT6B 2G3NA 3JTSB 2AK4D 4N2OA 4N20A 4OIIH 2B0SL 3HCVB 1XR8A 1KOAA 1OM3H 3T2NL 1KENH 2VLJA 1UCBL 5DLML 3WEAA 2K9UA 4K55A 4N1HB 3UZVB 3RWFA 5L6YH 4C4KO 3WIHA 2HFTA 1SFDA 5D4JA 4A7QA 4WUKL 4QRAA 5EOQH 3QNFA 4H20L 1D9KA 1UACH 3QPXL 5F8QC 4YDVB 4MNQA 4MMYA 1EO5A 2FYYA 2WGNB 4ZDHA 4Y2OA 3GHBH 4MDJA 2ED6A 1ZHLB 3GPEA 2WNWA 3MV8E 2HKHL 4FQ1H 4HUWA 4X6DB 1AY1H 4CSTA 5EIIB 3X1FA 3VGFA 3RAJL 1SQ2N 2F5BL 4MAYC 4ZMOA 1IQDB 3APFA 2OL3A 2OQJB 1XF3B 1HI6B 3G5YB 3WUZA 3MLTB 4FI8A 3GPSA 2H3XC 1NFIB 1FG2B 3HJEA 4HHGA 1G9ML 1CL7L 3F01A 1V10A 4F37K 1F45A 1SUJA 4LZKA 5EN2A 4XNBA 4KI5E 4G43B 3ZIMA 3RG1C 1MFEH 3AXIA 3HZMB 2IALA 4UYQA 3ARBA 1ZA3B 3QDMA 2NXYC 5AB2A 5HGHA 4ILDA 5IWLC 1KLUA 2LTQB 3MV9E 4KO9A 4EN3C 1VGKA 3MUUA 1A0QH 4EBQL 3WS6A 3HMXL 4F58L 1HEJC 3R1GL 4PLNC 3OJVC 1QZ1A 4F33A 1ZGLM 5LGJB 1GGYA 4YHZH 4MNQE 4N8CL 4JO4H 3T8XB 3BO8A 1FZJB 3FU6A 5C8JA 2ZOKB 2FHFA 1RK0A 1E65A 1XGYL 2FSEB 1YQ2A 4MS8C 1EVUA 1XCQB 4LRIA 4FXGA 1WH0A 1HQ4A 2P5EA 3FB5A 1HH6A 1MN4A 2RTTA 4AQEB 1F6AB 2B59B 5L2KA 2HKAA 3MLRL 2V8MA 5DRWB 2OMXA 4YDMA 3AWEA 3EYQD 1OF0A 1WEJH 3QDJB 2EH7H 2YQGA 3NIFF 2CR3A 2PW2A 4J2QA 1FRGL 1BAGA 2LW3A 3LS4H 4LSUL 4NHUB 4WUUA 1YCSA 4F2ME 1G9EA 1INDH 4JFFE 5C2UB 1YEKH 2M26A 3Q1EA 1CD0A 4HU8A 4JO1L 4MNHB 2KLSA 2ZG1A 3GTNA 1BECA 4DO5A 4Y1AE 3ZDXF 1EWHA 3NSYA 2Y22A 3JWDH 4HS3A 5A2LH 4BQ6A 1VFMA 4JEGB 4XN4A 1FAKT 2OI9C 1AS7A 2ZUQB 3GLZA 3MSPA 3X1BA 5IG7B 1QSFB 5PAZA 3I6KB 2UY7B 4ZMLA 2EDNA 2A6JA 2FYYB 4O58L 1IGML 1X5KA 3RWEA 4R26H 1BX2A 4S2SB 4MJ5B 1LEGA 5FGBC 1IBYA 3H0TB 4URTB 1C7SA 3VI3E 5GZOA 4PI0A 2ODIA 3X11A 2PUQT 1AY1L 4PD4K 5GGSY 5EB9A 1XH3A 1T22B 1ZVHA 2EXWD 4C56A 4LSVL 1XF3A 4ODBD 4AIZA 1T1YB 1HXMB 2CJUH 1FZKA 3IDJB 3FN9A 3DPBA 4KNUA 1H15B 2OKMA 2EZ0C 4IJ3B 2EZ0D 4JFFA 3CQFA 4FA6A 1BJMA 3EBAA 2R2BB 3BVNA 5F7EL 3UYRH 4HWZB 3ZR5A 2LABA 4JO2L 4RFNC 1RIUH 1LXMA 5B4MC 3BAKA 5D71H 4U1JB 4YHNA 1OT2A 3DYPA 5BV7H 2RA1A 3DECA 3TOPA 1OAKL 5LGJA 2OXHA 1QVOA 4G8IA 1WVZA 3CZJA 4HW6A 3AB0B 1K2DA 4GAGL 1CFVL 5IMOA 2R2HA 1IM9D 1MWAB 3HLAB 2N7AA 5ISZD 4QRTA 3UYPA 4PGEA 3GMQB 1FSKB 5FO8B 1HYSC 1FORH 4NZ8A 1INQA 2AXFA 4AVIA 3FOMB 5IEHA 3BKJH 4HUUB 3LDBC 3WKMH 5G5DA 1S7SB 5ID1A 3TBYA 3AS1A 2HH0L 5CZKA 1AC6A 2J25A 1WT5C 2N4IA 3O3DB 2VL5B 4QRQA 4CAGA 3OF6A 1TPXC 2ATKA 1KB5L 4KKRA 4ZX3A 1EVTC 2AVGA 4NQXB 2VT0A 2XPGB 4RISH 1TKWA 2DQUL 3PG2A 2XZZA 1G7HB 1A7QH 1CK0L 2BIIA 1JV5A 4EDWL 3H54A 2OM5A 3EZJB 4IRZL 1AIZA 2IIJA 4HXAL 2FBRA 4JM2F 3U46A 1NINA 4Y0GA 1AE6H 2E8YA 2NTSP 1U8OA 3KDMB 4Z7VE 2VN4A 4HCRH 5DZNA 3VWJB 1WCBB 5B8CA 3O6ML 5I1GH 3VXUD 4Y2DB 5E6SB 4X5XA 1SQMA 3VXRE 3HBPA 1K5WA 5ANMB 5C0GA 4RMRA 3V6OE 4PWHA 1RKRA 1V55B 5EU3A 4JM2D 1RSYA 3PGFH 5F7DA 4LCWB 2QQNH 2A2QT 5F7NC 2NSXA 4GBXB 3W9EB 1QW9A 5CNHA 1NGXA 3DBXA 4P5TD 3UGEA 2ZP9A 3ZE0E 1ZLUK 5HHQB 1JF5A 3QC5X 4PY8I 1A6PA 4BZ1L 1U4FA 4Z7WB 1QO3B 1NKOA 5E8NA 3OLIA 3FT3A 5EOCH 2J8UB 2VE6B 4KDWA 5I74C 4OZGA 3BVXA 5F9OL 3LRGA 5CJQH 3CU1A 4KMTL 2VN3A 1ZVSB 4FQXD 3VVWA 1AGEA 4B41A 3L7FB 1XAKA 2WY3B 3UC2A 1PCSA 1NMBL 4JFQA 3GIVB 1QVOB 4G8IB 2I24N 4E9RA 3IMVA 3L3JA 3TNNA 1Y6MR 1XCXA 4QHUA 4X8JB 4K3JH 4PP1C 3ZZSA 5JPMB 5KSBB 3HZMA 4L4TB 3SBRA 4P48A 3HI6H 3MOAH 1U8KB 1EMTH 3B9EA 5IW1B 3SKOB 4ADIA 1XCWA 2RCSH 5EU7E 3DX4A 2QQKH 1JI2A 3I50L 4UT9H 4LSSH 1EDYA 4YHOH 8PAZA 5IVNA 1ROWA 4QDGA 1D5BB 3AQDA 3N42F 3Q2LA 4IHOA 1IE4A 3ESVF 3PXLA 5FYLH 3TO4D 3UBXB 3LZFH 1KFGA 3D4ZA 3PHQB 3LKPA 5D6CB 5D7JB 4RGMC 5GRWA 4BSJA 2LR4A 4TF4A 1K9TA 5DUMH 2MOGA 2Q0ZX 4PRHB 4E5XG 4M8QB 3US1A 3C75A 2H2SC 3T0DA 3A4AA 2Q10A 1BVLB 2F53D 1T5XB 1ZTMA 4KU1A 4NN5B 5IQ9A 3VXUA 4ZMTA 2F54B 1C9SA 1F4HA 2O26U 3BVUA 1E3XA 1RUPH 1WTLA 5E2TL 3PFUA 2EDFA 4GPVA 5GJTH 1OGAA 2Z9TA 3WLBA 3MROB 3X1NA 3EGDA 1XX9C 3EOAB 3MPCA 2ADYA 3J2PA 3VB9A 3SDXA 2WB1A 4NO0D 4QHLB 2YMOA 4HKXB 2IG2L 3NABH 1BOGA 4MNHA 1WIOA 4CMMA 5LDSA 2VDQB 1ZHKA 5I1CH 1DR9A 1HYRC 4Q8BA 4UCFA 1T5KA 3LPWA 2JV6A 5CP3A 2WBKA 5KBKA 2ZAGA 4ZFZA 3M8OL 4ADGA 3MU3A 1P7KB 4MD0A 4M9OA 2ZYSA 3F6LA 5LGKA 5I6PA 5T33L 1JZ5A 4ODVH 2YWZA 1GPOH 1V54B 2J1ZA 4L3EE 3T2OA 4KV5E 4WSKA 4JY5L 4DN3L 3GLDA 5GGVY 5TGBB 2VJ8A 3SKJH 2BK8A 5DJYA 5CFAA 5DK2B 2ESVB 5ALBH 3SKMA 3SPCA 3UZVA 1AR2A 2R23B 3VCLA 1R1CA 5E9DE 3CFUA 3ASNB 3QNZA 4XCEB 1MH5B 1Q94A 2RIKA 2X1PA 3WEXB 3HAEA 3G5VA 3P4NB 5ETUB 4ZUVB 2Q76A 4JM4L 4QHUB 5D6DA 2QELA 3KXFE 3D4GA 5F7FA 5C07E 3WNNA 5CINH 4NN5C 3FQRB 5CIPB 2XQYA 4FQJH 3TM6A 3IS0X 3N9GH 2NW2B 1R3LB 4P3CH 1VJSA 4AIXA 4NS0A 1FN4A 4W9FC 1I4FB 4XOBA 3U1SL 4Z7AA 5C6PB 5LNEA 2YUZA 1JWUB 3CSBA 3DKHA 3F7KA 5CM1A 3TYFA 3O3BA 1FYTA 1MRFL 1JNJA 1KB9K 3EYUL 3QXVA 4Z3IA 3BUPA 3P3TA 4W93A 4ZUTA 4AIEA 1BA9A 4JFPA 3NH7H 2OQJA 3FO9B 4UV7L 1PX8A 2EYRB 3RVXD 2BFVH 1CTOA 2C4FT 2K45A 5HJ3B 4FL4B 2R51A 1UADC 1V7NL 1FNSL 2DQJL 4WO4B 5D1ZA 1LNUB 3G5ZA 3I6LE 4HHAB 5T1LB 4OFQA 3QNYA 5AAMC 3R7RA 5EDSA 2PYEB 1EXUB 2R2CA 5DD0H 1NCIA 3UH8A 4ENZA 1JGDB 5BJTB 2GCYB 1F4XH 3NESA 1S7TA 4PV8A 1V7ML 4O02B 4HKXA 15C8L 4IRJA 1IAOB 2ZSWB 2XX1A 2YPLA 3EJPA 3PL6D 3Q0HA 4EF3A 5C0BB 4W9GC 3DO3A 2YBRA 4G6ML 4KY1L 5EEVA 1RD6A 4RNRA 1IC5L 2V5TA 1AQDB 3B5HA 5EBLA 3SOBL 3KLKA 3ARGA 4Z7NB 1KCVH 1L9PA 1BVKA 2AV7B 3QEHB 4OD1H 2ICEB 4E9LA 4NJ9H 4P5MA 3TNMA 3ES6A 3CFDA 4I77L 5DD1L 1RZ7L 1RUPL 4HH9B 5HYQA 2YS4A 1KGXA 5CEYB 1EZVX 5TGBA 3EOTL 1X5IA 3BAYA 3LEVH 2PCYA 3B8SA 5I66A 2J1YA 3PQYB 4OLVL 4TSCH 1IGYA 4HQQH 1A9BA 2D7TH 3KYNB 3LD8B 2F8VA 3BQUB 3NYKA 5K9KB 2DIEA 1CL7I 3O2VL 3BN9C 1OAKH 3LKRB 1YVLA 1S4IA 1WFUA 4FNRA 3VI3A 3ZSSA 1N6QH 4BCZA 3MV7E 3X1GA 5C7XL 5I1AA 3MRRB 2HMIC 1X6LA 2RCSL 2YD5A 3HFMH 3V4VA 4QGTA 3DROB 2Q87A 1WK0A 2FH8A 3TFBA 2ITDB 3QJQB 3FTYA 1L9NA 5I73C 4JDEA 4OCXH 5J6GB 1R5IA 4KMQA 4G6JL 1JNLH 4RWHA 2WQSA 4OFIA 5BMFH 5C8JB 4X8JA 4BK8A 1WAPA 3KJ6H 4AT6A 1N2RA 2FTAA 3BKJL 1AZUA 4ATTA 2WKGA 3QISA 3UBXI 1QSEA 4WIQA 2DZEA 4X4YA 3DUHA 3QUZB 4BFGA 4BQCA 1B0GA 4K7FA 4L37A 3FQYA 4LEEA 2QBWA 3K6OA 5IVZB 1NTDA 4HIJA 1OHQA 4AQ8C 4I9WE 3UJIL 1DJWA 1YYCA 1ZTXH 2CIKA 3NZHH 1JZ6A 1J5IA 4TVPL 5CU9A 5GSRB 1MREH 4KXBA 5HHOD 4J1UB 1IAKA 2BSBA 1BZDA 5AW6B 4HPYH 4YN3A 3EH1A 3KL3A 3W81A 5EULV 5FEBA 1KJMB 2XC8A 4FZ8H 3OHXB 4TVUA 5FFLA 2J5WA 5KS9F 3RWCB 2CO2A 2J55A 2WB7A 4ERSH 5EEXA 4N8PA 4JZJB 3D0LB 1A6VL 2RHEA 1PLCA 3LRKA 5T8IA 5IMLB 2F1BA 1H6UA 4BKSC 4HUVA 4Q6IB 4HGWA 3T0XA 1JPST 3OKLA 1I7TB 4G42A 2EP6A 5J13C 2COVD 1VGEH 3U4KA 4P9ML 2IWGA 4C56B 1LO3H 4R26L 3FTWA 4ZFZB 3KYNA 3QRBA 4PJIF 2E6PA 4BZ1H 1NCBH 3VYNA 2HFFB 3QYMA 2DW5A 3NEEA 1RK7A 3V8OA 4NO3B 4OJEH 4NXSA 4AG4H 5DUPH 2XV6B 4OFDA 2XA3A 1ZLSH 4U1KA 4P4KC 4HYTB 5BXFA 4WV1A 2FL5B 1AD9B 1I1RA 3B9KA 3RWJB 2VDKB 2KYIA 3NSFA 3MJ8A 4V1DD 1R5IB 1S6NA 3D30A 3VXTB 3B6SA 3IDIB 4FG6C 2R15A 1MJ8L 3VFRB 4MWFA 1A4JA 4Y9GA 1I8UA 2GW5A 3QZNA 5F3HA 4ONHA 2ZT9C 3CC5A 3GTTA 2EH8L 3POCA 1O6TA 4JO5A 5HYIA 2FIKA 2JIXA 5BO1L 2BP5M 2QVIA 1OARH 2HX7A 4KKCD 3FU7B 5E2UH 2HFGL 4PGCB 4BV1A 5DQDL 5G2NA 2V5SA 4UV4H 4DGUA 2VDQL 3QGVA 2Z4QA 1UVQA 1UACL 2LFGA 3SY6A 5B3JE 2CDEB 2ZWSA 2HH0H 4YUEL 3PHOB 4EBQH 5B39A 1W2KT 1T89A 2W94A 1P5UB 4U1GB 3CFKA 4LLQA 5EO0B 2BOCB 2P8PB 3S37X 3V2AR 1SHWA 4R8WH 4X4XA 2E7CA 2E27L 2XZQL 2DYPA 3H7BA 2OSLB 3IMWA 1B0WA 1SNRA 3S3BB 1U92B 4PG2A 5FR3A 2VC2B 2UZYB 3IKKA 5E00B 1KTRL 3O8XB 4NHCL 1S9YB 3P2TA 1RZ7H 1G6VK 4AUJA 1D5BA 1NQBA 5AYUL 1QSED 1DLHA 4WGWB 5D7EA 4MYWB 4RX4A 1AHWA 2WLNA 4AGMA 3U2IA 1D5RA 3QDAA 3DVIA 2CNYA 4H8WL 4AUYA 1QBBA 5KSAB 3MLVH 1H3WM 1NGXB 4D9RE 1KB9J 2J6EL 1ZT7A 4XR8C 1DFBH 5TPWL 5FGBA 3PAUA 3T1WA 1X5MA 4JQXA 2BIHA 3BCDA 3HVDA 3PWLA 1ODAA 1HK6A 1QEWB 2ICWB 4UTBA 1U95B 2ODHA 3OAUH 5C0CB 2HAZA 4BFKA 3QXWA 3IKCA 4YOKA 1NCNA 4N8VB 2ZCLH 3OB0H 3EUUA 5I19H 5MEPB 3HOGA 3LZQA 3TN0B 1TTGA 3NPSB 3GDCA 5DRXA 4PYHA 4HV8B 1EHAA 2WYZA 1UM5H 1JHKL 4XPHH 1U30A 2RJMA 4DGVL 5L7XH 3BHBA 4FYTA 4GI8A 4PY8J 2P44B 5F97E 2NX5B 2WLIA 7FABL 2DQFB 4GEIA 3TIEA 4OT1H 1ZDSA 1KYOJ 3U1QA 3QW9A 2HLAA 4IU3B 3GLEA 2H2PC 1YNLH 4J4PD 4DQAA 3FRPG 1U8NB 1Q0YL 2V9RA 1QSZA 2BOBA 4NPYB 5I5IA 1ZE3H 4JDVA 2YPKA 5JIDA 4HJEA 2F1AA 4PU2A 2BOLA 2VMFA 2ZTBA 3T2PA 1S9WA 2XN2A 2W0LA 4B7IA 1HAWA 2OPCA 1JPTL 1SYVA 1UT2A 3WY1A 2DV6A 1TJHH 3BH9A 2C8NA 3AVEA 1AANA 2HWZL 3QJHA 4NUPA 2C9VA 3APMA 1ETB1 2CDEA 2G5BB 2Z8WC 1LO5B 3CHOA 3KLLA 5JW3H 1U8CA 3VQ2C 5KUKA 1QHQA 1G7IA 3P73A 2NQCA 5D7LA 2CQVA 3ELAT 4GNKB 1UKTA 4IBUA 2UZIH 4KHXH 4X6EA 3AT0A 2CDGB 4OM1L 5DXWA 1I9JL 4UIMB 2OXGB 2OYMA 4DVBB 2CMRL 2W95A 1KLGB 4HJ0C 4GO9A 4KDTC 1TTUA 5ISZA 3Q8FA 4OLEA 4JFVA 3RPIA 3AY2A 4OZHA 3SDAB 4XVSH 1ZY9A 1RK1B 1F58L 3BXNB 1A7PH 1N7MH 4CMMB 2QKIC 2V2XB 2CLRB 3TT3L 4DUXA 1A21A 3IT8D 3ILQD 1DQQB 4AQ8A 1MFAL 3TO4C 4FS0A 2OW7A 1OM3L 3T2NH 4D7PA 2M83A 3RY6A 4A7GA 3P9WB 3KJ6L 4KJYB 4IHBA 2IEPA 4I77H 5DD1H 5HGAB 3TBBA 2C3XA 1IBZA 3TC9A 2EDOA 1XT5A 2X4SB 1DCLA 2GJ6B 3VI3F 4NQTA 5FHBL 5GRUL 2Q2EB 2XYBA 2PO6A 3IK2A 4KK9D 4PVMA 1R19A 4RA0C 4DFIA 4JN2A 3VMNA 2HVJB 2ERJB 5GSVB 1C5BL 3D18B 4NYLA 1LO2H 4UOW0 4ELKB 3ARGD 5BS0E 4CADA 1YEEH 4I1NB 2ZKHL 4WFED 1RFDL 1SXAA 2EE6A 1D5ZB 4DUWA 3GSVB 1FGNH 1KMGA 1E50A 1PFCA 2WLZA 3NN8B 2ZXBA 3SDYL 3UTSD 3RFZB 1CF1A 2VR9A 1SJHA 2VQ1B 1ZS8B 3JQOB 3MV11 1A9VA 4AL8L 4K3DH 3VSTA 2VISB 1YJDL 3B9KD 4NCC1 5BRZD 4PLJC 2B0SH 1KYDA 1SOXA 2X9XA 4QHMA 4KTDH 4RIRB 1CDBA 5E6RB 3X14A 5JORB 3H3PL 4JM0A 4U6TA 1S7WB 3MLUL 3MRFA 4N22A 4WUUD 1AP2B 4IBTA 3VXRD 1L9RA 3FB8B 4E0RB 1GIGH 1NMBH 1PY4A 2EIKB 1PW3A 2F15A 2ICES 4EIGB 2HTKC