2APVA

Crystal structure of the g17e/a52v/s54n/q72h/e80v/l81s/t87s/g96v variant of the murine t cell receptor v beta 8.2 domain
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
109
structure length
109
Chain Sequence
AAVTQSPRNKVAVTGEKVTLSCQQTNNHNNMYWYRQDTGHGLRLIHYSYGVGNTEKGDIPDGYKASRPSHEQFSLILVSATPSQSSVYFCASGVGGTLYFGAGTRLSVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of affinity maturation and intramolecular cooperativity in a protein-protein interaction.
pubmed doi rcsb
molecule keywords T cell receptor beta chain V
source organism Rattus norvegicus
molecule tags Immune system
total genus 32
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 2005-08-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2apvA00
3QIBD 2E6PA 4KDWA 4HT1H 4P59H 4RAHA 3JUZA 2AEPH 1HDMA 2F8OA 1FE8L 2GJJA 3SDDA 1KB9K 4QHNB 1DVFC 3LS4H 3OX8A 1ETZB 5FYKE 3A6BH 2BHYA 3H9HA 5DQ9B 5CD5D 5LAXA 3HZKB 3PDOA 2HT3C 3DI2B 3BN9C 4JN2B 3NGBB 4I3RH 4WUKL 4Y4HD 4Z7VB 4ZDHA 4ZG1A 4L4VD 3BP6B 4HXAL 5F7KC 1E0OB 2FEDD 3ZKSD 2FIKB 5FO7B 5C09B 4XC1H 3V8OA 2VDLH 2LU7A 5IROA 2WUBH 5J06A 1Z9MA 3MFFA 2BC4A 4AL8H 2VLME 1A2YB 2V17L 3BUTA 4HUVA 3IXAA 4AMKL 3WUZA 4PS4H 5DJ2A 4C55A 3ARPA 5D2LE 5D7LE 2FECL 3G6JF 3TCLB 3O4LE 5EZJA 3TO2B 4F8QA 5KS9F 2X9XA 2AP2A 2VLLB 3BPNB 1GH7A 2ZG2A 2ED7A 5GZND 4FMKA 1S9VB 4JQVC 3GRWL 4M7LH 4OM0H 1DLHB 1KLGB 4F7PB 1EFQA 4P46C 3L3KA 4TQEH 3L7FA 4JO4H 2VNCA 1ORSB 4Z0XA 4YLQT 2YKLH 5F7NC 1T04B 4E0RA 4QXWA 1GIGL 5ITFA 4MMZC 5GGSA 3UBXG 2R1WB 3SKJH 2GFBA 3AREA 3MLVL 4QOKB 4EQ2A 4NQUA 2DLIA 4JY6A 1JCKA 2Y06L 4JFQB 3TBSA 3KLSA 3WS6A 4PJ7A 3WNKA 2ADFL 4QHMA 3RWJA 5T1LB 4P2YA 4HWBL 4ZTOL 3MCKA 2D0HA 1NANH 1UH4A 4OCYL 1EIBA 2AI0H 1T5XA 3BHBB 5CEZL 4XH2B 1KF9B 1MCKA 1MRDL 3IXTB 4OBRA 5ESQA 3DURB 4ENED 4ZD3L 5C0GB 4NRYA 4RFEA 1VFAA 2X7LB 3U7WL 3QUXA 4GW4B 5DUPH 4YR6B 4ONHB 5JXAH 4PRAB 3LN4B 4MA1B 1WICA 5JXED 1JRHL 4TVPH 4YDVA 1Q1JL 5JW4N 3AU1A 2EKSA 1KCVL 1A14H 3NAAL 5H2BA 1WT5C 4HIJB 3QCVL 3D9AH 4Y4FC 1GGTA 1U6AL 1YEKL 1CL7H 3V6FA 3TWCL 1T5WA 3LOWA 2HFFB 2J12B 2UUDH 4OZGE 5ESAA 1FFOB 3P9MB 3GSUB 4ORZC 1P4LB 2HAZA 2FATL 1JYVA 1OTSC 4F57L 3CZFA 2CIIA 1DN0A 4PB0L 3OKYA 1AI1L 3EDDA 1JZ5A 5GGTL 4ZXBC 1AXIB 1D5MB 3WS3B 2APTA 4PJAB 4RGNB 3PWVA 3QEGL 5K9KA 3AFLA 1J0IA 5ALCL 5I1EL 3QEHB 3GSWA 1R3IH 1FAKT 3MRGA 3DVFA 2YD7A 3KNBA 5FV2A 1UC6A 4JHWH 2P5WE 3U9PL 4F2MB 4GLRI 4JFZL 4LHQB 1SBSH 3IJYA 4GQ9L 4GW1A 2ZCKL 1N6QH 2JTDA 4APQC 3P4LA 1FIGL 3HPJB 3HG1B 1FPTH 3MBXL 2AEQL 5D7SL 3ALPA 1BVLB 5IVNA 4OTXL 2FBJH 1F11A 1VEPA 4RGOH 1YEHL 5MI0C 3B2UC 3R0NA 2FZ3B 4X6DF 2NXYB 1YN6A 3R1GH 4EZMA 4YAQA 1DCLA 2Z8VC 2NYYC 3GMLA 3UAJD 3MO1B 2YWYA 2VLKB 4J4PA 2X6MA 4M7JL 1OTUD 1XF2A 1GGIH 3L1OH 3EO1B 2JK5A 1DL7H 4U1NA 4MD4B 1JPSH 3T1WA 5DZNA 1N5AA 1J0JA 4OAWA 5CILH 5DUMH 5GGSY 3ULUE 1LE5A 2GHWB 5BRZE 2QLVB 4XGZA 5C70A 2AK4A 4PJIE 3RPIA 4IIQC 5ISZE 2ICWB 5IVXE 3FT4A 1SMOA 1JGUL 5B22A 2VISA 4AT6A 5IWLC 3PWNA 3GGWB 1VPOL 4PTUB 3F5WA 4LHUG 3TYFA 2J8UA 4JGUA 3EYVB 4TTDC 1YNKH 4OZFH 2B1HL 3HE6D 5J1SC 1UB5B 1LD9A 1MCDA 1I8IA 4KMQA 3UTPD 4IRZL 3W0WE 3FMGH 4KK9D 3GRWA 2MCPH 4PRNA 1KLFA 3B9KB 4NN7B 3O45A 4ODSL 4N8PA 5JIKA 3CIQA 3QIUD 3SO3B 4PJDB 2R9HC 2FO4B 4P2OC 4PLKC 4WCYH 2HKHH 4OJFH 4R2GC 2XQYK 3OB8A 2Y7QA 3DNKA 1TIUA 3WHE0 4M1CC 4Y1AD 2VLRA 1OB1B 4X7TB 3RWGA 1C5DB 2E7MA 4HWBA 4R96A 5FKPA 3BPLC 3CSYB 4W81A 4ZFOB 5I71C 1J1XH 4HEPG 2XY1A 1S7RA 5A2IH 5B38G 2V7NA 4NO0A 1NGQH 5EOQL 3X3FH 3O2VL 4HUXB 3L3HB 4MJID 3HS0B 3TM6A 1HHIA 1INDL 1F6LL 1EO8H 4D3CL 2VL4A 8CGTA 5CSZB 3SJVE 2BVQA 3QIBA 3ZKNC 3CPLA 5DC9B 2BX5A 2VRAA 2YRZA 4NQDB 5H94B 3WJLA 4J3WA 3KPOB 3VDBA 1ZA3B 1Q9LB 3IAQA 3MRCA 1R5VB 1P4IL 4FG6D 3GIZL 5IHUH 1KCUH 1X44A 1IC5H 3K81A 4Y4HA 4EDWH 3FFDB 4L4VA 2X5PA 4K7PY 5GGTA 3RNKB 3AM8C 3D0VA 3WNMA 1ZT4A 3FB7A 3MV8B 4I3GA 1Q72H 1IGTB 4Y89A 2HTKD 1G9NH 2K9UA 2DYPD 4FS0A 4OI7A 1B4JL 5J0BA 4QXGH 3UZQA 3BXNA 4Z0BL 1P7HL 4TUOB 2GJ6E 3V0WH 4X6BA 3L3JA 4W6XB 1OQOA 1H0DA 2IAMD 1XF3B 2Q76B 4MZ3A 1IEHA 3H9SB 5CLTA 3BKML 2CDGB 1P2CA 3FZUD 3MUHL 5T5FL 1FL5B 3GJEA 2MQCA 4JN1H 3MV11 3L5XH 1ZK9A 2DICA 2HJKB 3S35H 2OZ4H 4PJ5E 4AZ8A 1PZUB 4L29B 5SWQA 2XZAL 4GRLC 5GS0L 3UMTA 2R1YB 1H3WM 5FUCC 1JZ7A 4XPTH 3QXAB 1INEH 3C8DA 3K8MA 3DVIA 3U0TA 4NO5B 2J6EL 4DVRL 1XGUB 5DHVH 1HYSC 3ORJA 3G9AB 3WL9A 3O6FB 1OAUL 4BKLB 4NC2B 1HSBA 1NCAL 3FL7A 3RX8A 3WO4B 3MLUH 1SJEB 4LCIL 1A3RH 1YEGH 3G04A 1QP1A 4PY8I 1BLNA 4CRPA 4F33B 4XTRD 3P73B 4HZLB 4S0SD 1KJMB 1Q0XH 4LRNH 2DQEL 1Z0MA 5IB3B 1JZ6A 3MRBB 4LNVA 1TZGH 5ETUA 3QULB 4U0RB 3RY4A 3SGEI 4UDTA 5DYOB 5FM8A 3WLWC 2DQHH 4PLNC 5EPMA 3CFJB 5CIPA 3P0YH 1IGJA 4NKDA 1ROWA 3PHQA 2F9BT 4UOW1 3BGAA 3FB5A 4GRMA 1TNMA 4Q2ZB 1YJDC 1NJ9A 4H8WC 3U48A 3KR3H 2PO6D 4I0KA 5CZVL 4J3VA 3RTQA 1DQQB 3FQTA 3CX5K 4MJ5A 4LASH 1HKFA 4IOIA 3BWAA 1AFVL 5AZEH 1HQRB 1BFOB 5EUKB 4CN6A 4G42A 3RWDA 1TVHB 1VADA 2YD6A 4MNQD 1IBGH 4R4BA 3PQYD 1NCCH 3BH8A 1J8KA 5JR1L 3WN5B 3KPRA 2GI7A 1OTTD 2GJZB 3I3EA 5BO1H 5GJSL 3ZT7A 1W72A 5JHLL 2BOBA 4LNRA 2ATPB 3ALXA 4PJXB 4ZS7L 5C0BB 1FYHB 4L4TD 5CEYA 2YPVL 2A1WH 2AEWA 1ZHLB 4RIRA 5F7DB 2G5RA 4GT7A 3QUML 2GTZB 4POZC 4RISH 4WHTA 1S9XA 5FYLH 3NOIA 1G7QA 3AVEA 4QRQB 12E8L 2XG4A 5D7KE 3GKWL 2F8XC 3ZHLA 3MXVH 4LOUD 3FCTB 1T7XA 5I1HL 1N2RA 1GHFL 4HUKB 1KPUB 2G2RB 1BOGB 3NIFE 5ENWA 3TBTB 3K4ZA 1NFIB 1N59A 5JUEL 1U3HD 2YR3A 2DQUL 2F58H 2FX7H 3ARFB 4Z78B 1LNUA 5BS0B 3U36B 3THMH 5JHDB 3Q6FB 2ADGB 2OR9L 5GRVK 4JG1L 1KCRH 1JPFB 4XHQA 5E56A 3CVHH 1A1NA 5ITBH 4MAYB 5EC1B 1EGJL 4XMLH 1LO3L 3HAEA 5F6IC 5E2TH 1EO5A 1HHJA 5EDXA 3C60D 3T3MF 3OZ9H 1S7UB 3OGCA 3BPOC 3CK0L 1Z9LA 5TDNB 2LE9A 2NY0B 3VI4E 4F7CB 4X99A 1LILA 3JWOL 5MP6L 4KRMB 1NLDL 2JCCB 5DA4A 3WS6C 1MI5B 3ZHDA 5TFSL 3QIUA 5FO8A 2BXYA 4TVPD 3BH9B 2R8SH 1AQDA 1D9KC 2VH5L 4MGXA 3WIHL 4XVJH 5IR1A 2VE6B 1BAFH 5EO0A 1TZHA 3LH2L 2QQNH 3BRFA 4Y1AA 3KPSE 2MOVA 1A7PH 1MFEL 1H8NA 4H20H 1XAUA 2VUYA 4O5LH 4M48H 4OCNC 4WI2A 3D2UA 5JOFB 4WUUB 3M1BB 5DHYB 4J1UB 3LDBC 1C1EL 4G9FD 3SBWA 2Y36L 1QLFA 1IGYB 3MV7D 4MJIA 5AYUL 1G7MB 3TA3A 5EIVA 3CX2A 4N9GB 4Z7WB 2P8MA 5TQ0H 4L9DA 3W9DB 4OCWH 4GSDL 4N0YH 1U8LA 1T22B 1MFDH 4OT1H 2A9NH 4YC2B 4PJEE 4LLQB 4HJGB 4NFBA 3BZ4A 5EBLA 3MOBL 1H9VA 1A1OB 4LLWB 4YIQB 4D94A 3IF1B 2EDQA 4JHBA 1AC6A 5HGAB 4S1SH 4XCNB 3EJYC 2XZQL 1IGCH 2G75A 5D7JD 2F53E 4QRRD 1IKNA 3O3AA 1FN4A 2JIXD 2AV1A 4ZUSA 4OV5B 2DYPA 4WFFE 3P30L 1A7QL 1GYAA 1NC4D 5FUCE 2CRIA 2IAMA 4OZHE 2EXWC 4XP1H 4C59B 4S1DD 3WXWL 1B2WH 4XCCL 2A83B 4EUPA 2XT1B 2ARWA 1PLGL 1CFVH 1XCTA 4JKLA 2YN3A 4PYHA 5EUOB 2CUIA 4R97C 4QTHA 5TF1H 4F7EB 4X9IA 5DD6B 2ZUVA 3MJ9H 5JNYB 2IPUK 2GSGB 3EOYG 3G5VB 5D2NE 3GSNA 2X4RB 5I1KL 1K2DB 3NFSH 5HHNA 1LO5B 1INQA 5JIPA 1FYTB 4HIHB 2FIRT 1DANT 1CF8L 4KVCH 3OGOE 4C83A 5IV2A 3DWTA 5SX4H 4J3UA 4Y5YC 1E6OH 4N8CH 1U8QB 4GKSA 2ADJA 4LPVA 4NDMA 2PXYB 1OAQL 1NQBA 4ZSOB 3EJZD 3DIFA 3GBMH 5EBWA 4YXKL 1EGJA 5CUSH 1L7IL 3E6HB 2NY4C 1U36A 1BFVH 1QFUL 1TJGL 4P99A 3VXMD 4F58L 5GS2H 2FD6H 4L3EA 4X6EA 2MQ3A 4Y2DB 5DDHB 1FAIH 5L9DH 2A6DB 15C8L 5KVGL 2IGFL 4I3SL 1MHEB 3TFKC 2NW3A 2WUCL 4GMTH 4YXHL 1MUJB 2WBJA 3LSOA 1QLEH 2YWZA 2XPGB 4NZDA 1K3ZA 1B6UA 3DJ9A 5D6CA 4KK6C 5T1DL 4MWFA 3ARVA 3WIHA 1C12A 2FHBA 1IILE 1U8PA 2VB5A 4QWWD 4ODUA 4KJQD 2YHGA 3TJHD 1V3KA 1I1CA 1U8MA 1PG7X 1A7BA 2W0FA 4Q9CA 1R3JA 5DJ8A 3VI3F 3O6LH 4Y8DC 5KSBF 4GRWB 5DTFB 3P40A 3H42H 2QSQA 5KVFL 1HI6B 3QIBC 4MNQA 5D96C 5I1CL 1XT5A 3QWQB 4CVZA 4R8WL 4FN0A 5IFHL 3UEZA 3T0VA 1RZKH 3WJLC 5F9DC 4MNGA 3AXLA 3MJ7A 1CLZL 3H7LA 3VXOB 1IRAY 4MX7B 4P57A 1ZWIA 1N6VA 5KJRH 4CDHA 5CD5C 1WWCA 4HPOH 5DVNA 4Y4HC 4P4KB 5F21B 4L4TA 1Q9OA 1UACH 3VFOA 4UIKL 3VD7A 5HGBB 5IJVA 5D7IA 2FEDC 5J11B 3FHAA 4K7FA 1T1XB 4PG9B 3FTGB 4UIMB 4KH2A 3HNVH 4ZODA 4BH7A 2Z31D 3ZSTA 1XGQA 2AXFB 3WFBH 1NEZB 4TUJA 2EDYA 3SOBL 1H5BC 1ZHBA 4LSQH 5HGHA 4UBDD 5BVJA 5LG1A 1M7DA 1NAMB 5DQDH 1CFTB 5E08L 5DFTA 2FECI 4D0DA 3QFJB 2DMKA 1KTLA 2ZOLA 3IDXH 2CK2A 5LGJA 1U3HA 3UTQB 4CDGC 5IFAH 3I2CH 2VXTL 5GZNC 5EC2B 3S96A 3W39A 5A40E 3GMPB 2DDQH 1CE1H 5CKAA 1OAKL 4IMLB 5C09D 2BY2A 5IFJA 4PBWD 5SWZB 4M62L 5D1QA 4KDVA 4HF5H 3QQNA 3S34H 3C60A 3UTSE 3SE8L 2C4XA 3E2HC 4KQ4H 3RPKA 3N1QC 4UDUA 1A7OL 3WIIH 1T1YA 1UCTA 4PGDB 4XNXL 2JJTA 1CTNA 4N0UA 1Z3GL 1NSNH 3LKSA 4ODXB 4WI6A 1A22B 1IQWL 4LSUH 2DIBA 1MJUH 1TXKA 4AIZB 3ARGD 1TQCB 4HMDA 2VLJA 4YJZL 1S8DB 4N90D 4A6YB 4XNMA 3ALWA 1VACB 5L2KA 3D0LB 3IETB 3PHOB 3V4PH 4ENEC 2B0SH 5CGMA 4NFCA 4WU7B 1TETH 1MRCL 3HE7B 4X9HA 5JXEC 2X4NB 5CJXC 5J7CC 1MY7A 1MSPA 1JRHI 43CAA 3KLAB 2E8ZA 3VFMB 4GBXB 2NX5E 1QQDB 3TO4B 3HC0B 2FJFA 4BSWB 3GMNA 4IRSB 4G9FA 5B3NA 4BSJA 3MV7A 3ARBB 4IHOB 3ROLA 3N1PC 1WTLA 1G6RB 2FRGP 5FHBL 2E27L 1AD9B 3O3UN 4G6ML 1D3CA 5BJTB 1UADC 4NPYA 3VFGL 5ICXA 3HI1B 5JW4M 5FYLD 4QCIB 3IGAA 2DWDA 3BGFB 1MCLA 5T3ZD 3ZE0F 2HJFB 1D5ZB 1JK8B 2GAZB 3B2VH 5EU7C 3ULSA 2AGJL 4AENA 4JZOB 1EEYB 4U6YB 4IRJB 4F15B 5K9OA 3SKNA 1LK2A 2W60A 4HS6B 5I75C 1ZT7A 1KN2L 4K7PX 5D7JA 3K1KC 1G7PB 2IADA 5GQBA 4WW2A 4Z7NF 2D7OA 4CGTA 5EA0L 5FKAA 3EOBA 2JIXA 4HHAB 4WI7A 4CADB 3KJ6H 1VGEH 5I16B 2I26N 2LTQB 3CGTA 1PDKA 3LPGA 4MQXD 1EK3A 1MIML 3EO9L 3UAJC 2RB8A 2R0ZH 5CZXD 3DBXB 4XBEH 5CWSA 3TJEL 3GUTB 5I76A 1OTUC 1BIIB 2WANA 2UYLB 4LCUA 5FAAA 4ESKA 3MBEB 4HW6A 1F90H 4OF7A 1HIML 4X6CF 1AH1A 3HR6A 3EFFA 1RY7B 5D5MF 4YXLL 3S9DB 2PF6A 2EIZB 4XI5D 2R2EB 2WSKA 4OUUB 4CU6A 2C5DC 3LEYH 3G08A 1DR9A 4HBCL 2BRRL 4M7ZC 1AR1D 3HE6C 2HLFD 4GMSL 5I1AB 3BKCL 4KK9C 2GCYB 4MD5A 2DBLH 2DQDH 1I9IH 2ED8A 5TDPB 3QIUC 5HYSG 2Z92B 2IG2L 2A6IA 5LXGL 1AJ7L 5E00A 5GRXG 2Q6WB 3PV7A 4OCSL 3RJQB 2IFFL 1I9JL 3WKML 4FNLH 4WFEE 1ZVSB 5J3HD 2HG5B 5HI4D 5GIRA 2EE9A 5GHWH 3VD4A 3VXSE 4DVBA 4LGRB 4MCYA 5D2LF 1X5FA 3S4SG 1PJ9A 1A4JA 1M7IB 2XWTA 2PKDA 4MA7L 1OD7A 2O5YL 4FA8A 3BDYL 3O6KL 4XC3H 3OR7B 4LU5H 3IAPA 3R06B 3MZTA 1N8ZA 1DSFH 4H88L 3HZVB 1QLRA 3MACL 1RK1B 4U1KA 1U8HB 4XNUH 2Q8BH 5DJZB 3P4NA 3OKEA 3GB7A 3X12B 1FGVH 4LP4A 4Q58C 4H5SA 4UQ3A 5T3ZL 4RFOH 1NMCB 5DEGA 1ZLWH 3ZYZA 4OGYH 4X0KA 1F4WH 5IUSA 3EOAB 4ELKA 1FO0L 4FABL 1UH3A 4M6OH 3JV4A 4JM2F 4ZMAT 2X4PA 2AKRA 4PJBA 4U3HA 1OP9A 5GRUH 4MZ2A 1GPOH 3QFDA 1S7TB 1YY9D 4I18B 3GHEH 4HCRL 3NFPA 3QDGD 4NHCH 5BZWA 4QY8B 4ZQKB 3OXRA 2AJ3A 1DBKH 1RIUL 1E4JA 1N0XL 3QH3A 2OJZH 5ICZB 4M5ZL 2AJYH 1FCGA 2VDQH 2IBBA 5KAQF 4NWUH 2HTKC 3T4AB 2Z31A 3NCFB 2EDBA 4PD4J 1V7ML 2IAMC 2NLJB 5FYJL 5GSVB 1L7TH 4M6NH 5BMFH 1VESA 4JLRB 3FZUC 3S8WA 4XP9H 2W9EH 4AEIL 1QFPA 2XV6B 4Q0XH 4ZFGL 1A6WH 3K2UH 1H8SA 4FQ2L 1QBLL 2QSTA 5DQ9A 3HZKA 1DQMH 4JN2A 4Z7VA 1NCWL 5J13C 5FDYA 5E1AB 4KRPD 4IEFB 3VE0B 4OZGF 5DS8B 3BP6A 2YA0A 3UP1A 3IS1X 2FIKA 5FO7A 5IMKB 5C09A 3NACH 5BXFA 4XWOD 1T83C 5CJQH 1R5WA 2F54B 4RMTA 3UYPA 3V6OA 2VERN 3P0VH 5E6IB 2HFGL 1ITBB 5GS2D 4NKOA 2AJSL 1QBMH 1Y0LB 4RRPG 1TQBC 4JRXB 3CFEA 1OGAD 1W0YT 3T2QA 3VXUE 3TCLA 1IC4L 1VENA 1DBBH 2UVFA 3TO2A 3PWJA 3V5HB 4HWEH 4XTRC 3MV01 1YY8B 4P2RE 3IFOB 2P5EB 2VLLA 3O9WD 1H8OA 1X5HA 2DF3A 4O51B 4NZRH 2R0LH 4RX4D 5HI5C 4XP6H 1WIPA 2V2XB 1NAMH 1XIWB 4OZIA 4KV5E 2QL1A 1DLHA 1G7JB 1LDPH 2Y6SD 3CSPA 2GKIA 1ORSA 4NM4L 2FL5B 3VFRB 3BFOA 3BMVA 4NZJA 4WO4B 1IAIH 1I1AB 2PO6C 1HNFA 2R1WA 3PP3H 35C8H 1AO7B 1RIHH 4U1SA 2YUZA 4QOKA 4FQQB 2CMRL 4JFQA 5M7QA 4YQXH 1KBGH 3ULUF 2H32B 5T1LA 1MCFA 2XNAB 3PL6C 3QDMB 5IVXF 4ZFOL 5IT2H 3BHBA 4NQEE 1LP9A 4XH2A 1CTOA 3G6JB 3IXTA 1QFWL 3DURA 3GNML 2XQBL 5AYQA 3O3EB 5C0GA 2H3NB 3UYOD 1OT1A 2EDXA 2VAJA 1XZ0A 1OTTC 4GW4A 3VXNB 4YR6A 4ONHA 4OGZA 4PJFA 4PRAA 5KS9B 2A77H 1RUMH 2I9TB 5DRXB 4HKBB 4ODHH 4HIJA 1YDPA 3RVXD 4ERSL 4NYLB 4X7CC 3D18B 2HFFA 3LN9A 4U6VH 3KYNB 4YE4L 4BSVB 5EN2B 4MNHA 3MOQA 3E8UH 1BF8A 5D72H 1MJ7H 3GSUA 1KN4L 2BOCB 3TZVC 4DGIL 1P4LA 2X4SB 4BQ6A 2QQQA 4KRNA 1TJHL 4O4YL 3KS0H 1IL1B 4LOUC 2HN7B 4ZOCA 3BVNB 4F3FB 3CFCL 3PWPB 3CLEH 3HUJE 1BQLL 1Q9WB 1TFHA 1D5MA 3NTCH 3WS3A 3AC0A 4PJAA 1SVZA 2EYRB 3I50H 3QEHA 1U3HC 1IGIL 3S4SB 1MFNA 4LHUD 4DOHE 1CFNB 3O41B 4LCCB 5ANMB 5I8KH 5CP3H 1DQDH 3S3SA 3VGAC 2FX9H 3UTTD 2IJ0C 3RGVC 3ARXA 1WJ3A 3SQOL 2GW5A 2EDLA 1QNZH 5F9OL 3GSVA 2BSED 1YEEH 3IDYC 1ERNA 3BKYL 4BFGA 3U1SH 5B3JE 4CN1A 4NBYB 3MQIA 5C0CB 2OTPA 2AXHA 3C60C 3HG1A 3D87B 3HPJA 2J8OA 2YPKB 5KZCB 3QJFA 1A5FH 3RZCB 1A7RH 2FZ3A 1CLYL 4PJHB 5JA9A 4ZAKC 3MO1A 1J8HB 3C87A 4O2FA 4YDIL 2VLKA 4N9OB 3ARFD 2F8VA 4F37K 4OQTL 1R6VA 3GMOA 2E7HA 4MD4A 5JHDD 2V2TB 5DA0B 1FNAA 1SEQH 5IF0A 1X4XA 3DRTB 1QFHA 4UT9H 1E4WH 1K8DA 1HN1A 5HBBA 1DBMH 4MAYD 2IF7A 5I1IL 5I18H 2ZNWA 2VDMH 4FXKA 3CDGB 4MJIE 5GRZA 3ZDZF 3GGWA 4PTUA 1QO3A 5D71H 4Y19D 1YECL 5E8OB 2YZ8A 3EYVA 4J7RA 3QUYB 5DK0B 4UAOC 1MHPH 3TBWA 1I3GH 1UB5A 1MI5D 4LEOB 3RAJH 1QG3A 4DW2L 4K3DL 2I60H 5J6HB 4OCRL 4PJDA 3V4VL 2FO4A 1ZLSH 4MYWB 5HYJB 1I8LC 5DJ0A 3BUYB 3P9LB 1KXVC 3B6SB 1MWAL 4X6DB 1JPTL 2YD8A 2ADIB 3E3QC 4BZ2L 1EAPB 1OB1A 4X7TA 1CICC 1XGYH 2P8LB 1I7ZB 5IB2A 4P5TB 1C5DA 4NZUH 3LCYA 1QSVA 1L0XA 2VUOA 1BMGA 1QRNB 3CSYA 3ETBF 4ZFOA 4WUUD 1EXUB 1XF5B 4I5BB 5MEPB 1XR8B 2QSCH 2XWJA 4P4RA 1YC8A 3OJMB 1MLBB 7FABL 4HUXA 3L3HA 5T3XH 1OP5H 4QGTA 3H6JA 1UKTA 1FV1A 2RGSA 5CSZA 1OF2B 1R0AL 3IU3B 4PYGA 3WUWG 3V7AG 3VWKB 4UB0L 3NCYP 4NNXB 3LIZH 1MFCL 1WFOA 5H94A 2HRPH 3KPOA 1ZA3A 1Q9LA 2VXVH 2M2DA 3DVNB 4WWKD 1R5VA 1MCWW 3IYLW 4GUPB 3SDXE 1MPAL 3NMEA 3CUPA 4Y8AA 1S5HA 3FFDA 3RNKA 2IPKB 3MV8A 3AMLA 4P2QD 1ZHNB 1WEJH 1IGTA 3FRUA 4RCAA 3BSZL 4YDLB 2N7BA 3FB6B 5HPOA 4OLVL 4M9OA 4TUOA 3NZHH 1JNHB 4M43H 1JJUA 1S7QB 1T20B 4F8TA 1XF3A 5DD5L 3LQAL 1OGAA 1BD2E 1F3JB 1X7QA 1E4XH 3DECA 4WI9A 3EJZC 2CDGA 4LL9A 3AB0B 1FL5A 3PV6B 2BHUA 5DLML 5KVEL 4K8RH 2HJKA 2OK0H 2AEIT 1IFHH 4PJ8B 5DD1L 4XNZB 1TVBB 2R1YA 4RX4A 2ZJSH 5C6TL 4XPFL 4JFYB 1MFBH 2VL5B 3QXAA 4TSAH 3P2TA 3EBAA 4NO5A 4HH8A 2AJUH 3D85B 4FZEL 5IJKA 3J8F7 4JCMA 5DVMA 3O6FA 1QR4A 4BKLA 2C3VB 5ADOH 3NIFF 2FYYB 4MNQE 5D9SB 4I4WB 4XMKH 2X2YA 3HRZB 2A74B 5E6YA 3PQYE 4ONOA 5IMOB 4AEFA 1C5BL 4QWWC 4KJQC 4KUZL 4F33A 1V7NH 4MNGE 5FCUH 3TJHC 1UT9A 3OKOB 2KQNA 3P73A 5EORH 4HZLA 1KJMA 4HC1L 1JGLH 3N85H 5IB3A 1SY6L 3EYOA 3MRBA 4UTAL 2EH7L 1OPGH 3X13B 3IDNB 3IJHB 1S5IH 1MEXH 4L4TE 5DYOA 4HIXH 5D7IE 3P0GB 3WDJA 3MRDB 3N9GL 5J57B 3VI4F 1T7VA 5FOBB 4KVNH 1KJVB 4Q2ZA 2XZZA 1G9NC 3TN0B 2NR6D 2W9DH 2ZSWB 1B6DA 3O2WL 4M1GH 3RY5A 1UWEL 3HR5B 4OFYD 1DQQA 5EZOH 1YNTB 1OAXL 4JEGB 3ZTJG 1UJ3B 4XAKE 3FB8B 5TE4H 2HLAB 3BJ91 3PWUB 3VXRE 4QGYA 5I74C 1FRGH 3D39B 1HQRA 4CW1B 1BFOA 5EUKA 5MEQB 5DQJB 1TVHA 4NT6A 3HMXH 5IEKB 3TESA 1FZOB 3JV0A 2C1OB 3BZFA 4UBDC 3CFIC 5DVOA 2R0KH 5DFVD 2GJZA 3QNZB 1ZV5A 4HFUL 4X4ZA 3CH1B 3KWWB 1EEZB 3RWIB 3U7YL 2ATPA 4PJXA 5C0BA 1K8IB 4R26L 4P4KD 3A6CL 1FORL 5EIIB 2ZUQB 2ENSA 2J4WL 3MPCA 5IP4A 1ZHLA 5F7DA 5D93C 2AJVH 1RJZB 5LBSL 3O0RH 2GTZA 5F7LB 4EDXB 2VDRL 2VSDA 3IT8D 3DX8B 4P2CG 4PLJD 1R3LA 3RL2B 3V6OC 1T0NB 5I19L 2VZ1A 4J3XA 4QRQA 4TVPE 2OQJA 1XFPA 4HFWB 3LKQB 4JGMA 3QO0B 3FCTA 4UT7H 2VDOL 4V1DB 4PJEF 1TVDA 5IQ7H 1O0VA 1KPUA 3NPSB 2G2RA 2EIEA 3QRFM 3TBTA 3QFJD 1NFIA 3QXUA 5INDA 2P1YA 4OI8A 3ARGC 5I1LB 1N5YH 4YPGB 3ARFA 4NSKB 1X9QA 3G5XA 4Z78A 1JYXA 4EEEA 3U36A 5JHDA 2ADGA 1F3DH 3KYKH 3S36L 1UZ8A 1HXYA 1JPFA 3QAZB 5SWZD 3QHZL 5GJTL 25C8L 4MAYA 2XTJD 4U6XB 2Z93B 3OAZH 4G9FE 4PG2A 2PR4L 5HDBE 1PYWB 3MA9L 2ITDB 3MV7E 1S7UA 5C71A 4OZHF 3IDUA 5GGQL 5TDNA 3RU8L 4XPAL 5AD0B 2DMCA 3V52L 4HQQH 4F7CA 1ZLUK 4EBQH 1AQKH 5GGRB 3E3QE 2PTTA 2ZSVB 4WW1B 2JCCA 1SJXA 3V0VB 1KPVB 3UJJL 1MI5A 2DIJA 4MQSB 4FQIL 4YFLF 4PJ9C 3F7YA 4YFLI 2BP3A 3VW3L 1JPGB 4O02H 1JI2A 3MRFB 3BH9A 4JO1H 4GAJL 3SN6N 2CK0H 2LABA 2C7UA 4G8GB 2YOCA 1N3NA 4LF3B 5HHMD 5DI8B 2VE6A 3CVIL 4QRRE 3HE7D 1CLOL 4LAQH 2FLRT 3R8BB 4D9QD 3MNWB 3QXDB 4HC1A 1SY6A 1IAMA 4K9EL 3MRPB 4KXZH 2RFXA 4JM4L 1KIQB 1QSEB 1HWGB 4U2ZA 5KOMC 3VRIB 2HWZH 4WUUA 3M1BA 2R0WL 3PWLB 1WV7T 4IRSD 5TE7H 1G1CA 2B20A 3T0EB 3WNNA 4Y16D 1IGYA 3O8XB 5BV7B 5A2JH 3ARBD 3V6BR 3IJSA 4M7LT 1G7MA 1DBJH 4OLXH 4GLRH 4N9GA 1D6EB 4Z7WA 1DBAH 2UZIL 1BVKB 3T77B 1KOAA 3SKMB 2CDEB 4FFYH 4RBPH 3CFDB 4MQXC 1JMXA 4JQXA 4WV1B 3W9DA 1OARL 4HMEA 5C07B 4LKXB 1T22A 5CZXC 4K94L 1EH9A 4QXTB 4LLQA 2WUBL 3BP4B 2DRUA 4HJGA 1ZLVH 4KKCD 4U2YA 1EHLL 1GSMA 2QBWA 2BVTA 2BY1A 4OLUL 4LLWA 4YIQA 2X1WL 3BAEH 4WWKA 1JHKL 1ADQL 5HGAA 4XCNA 4NHUA 4MQTB 1MFAH 1WBXB 5E9DE 1EX0A 2ZG1A 1HHGB 4P2QA 1FH5H 1HWHB 3VGFA 3VXME 1Z0NA 3HNSH 4Q6IB 1WZKA 2Q8AH 1FNEB 3RA7H 1KG0B 1AR1C 5B39G 4XVTH 1AHWB 4E41E 4P9MH 1KYOK 5KBNC 3ZT5A 1U91A 5L2JB 4EIZC 5TH2B 1R5IB 4XT1C 4LPTA 4Y5VB 5ICYB 2A83A 3RUGA 3VD5A 1WWBX 4JFHE 4TSBL 1EJ6A 5EUOA 2XXCB 2BVPB 4F7EA 5DD6A 2KQMA 1KJ2L 1SMAA 4FFZL 2GSGA 3G5VA 4ZO6A 3TPKA 3DV4B 5J3HC 3NH7H 1JGVH 5HDQH 3OR6B 1MAKA 1LO5A 5HI4C 1IZKA 1AR2A 2H2PD 2B5IB 2X1XR 2IALA 1FYTA 4HIHA 1AIFB 3SY0B 3WD5H 4WI4A 1G9ML 5IGXH 3IKCA 4A6YL 1QTYT 2M1KA 5DJDA 1U8QA 1ZE3C 2W0KA 1VERA 4HUWB 4WTXA 3S5LG 1XMWA 3BKJL 4LLYB 3SO3C 3VJ6B 4G8EB 2WAHA 2AK1H 3ILPB 5DUPL 2D31B 3E6HA 3AROA 4OCLC 3Q5OA 2YK1H 5FUOH 2BFVL 4Y2DA 2VOTA 3GFUA 1QSFE 5DDHA 3W2DH 1TDQA 2A6DA 3D9AL 4KI1A 3FKUS 1I8MB 4OFPA 3RQ3A 5JPMA 5LGHL 1F3DJ 1MHEA 3SE4C 1OAZL 1A47A 5CKGA 3TEUA 4H26B 1MUJA 3DHMA 4MDIB 4EI5B 2QQKL 1EMTL 1P6FA 3Q5TA 4JANA 3RDTD 1MAJA 1G6RL 4JPWH 4OFYA 3S35X 1DEDA 4KHTH 3G5ZB 4K23H 1SHMA 1YPZA 1GC1H 4HD9A 4OFDA 2RCSL 1F4YH 5BVPH 4AIOA 2AS5M 1CZ8H 4LSVH 2RBLA 5DTFA 3KXFB 4B53A 1A6ZB 1NL0L 4GAGH 5F8QC 1K85A 1CGUA 1JV5B 1SBSL 1ZSDB 1NUDA 1T0PB 4O00A 4OIBA 5IOPB 3H7BB 4WI3A 3V6OE 1GGYA 4NQXA 3VXOA 4NP4L 5CJBA 2FBJL 1UM5H 4P4KA 4KRPC 2OM5A 3HZYB 5HGBA 4XP4L 1I7RB 5DR5L 4CUCA 1T1XA 4NC1C 3FTGA 4XWOC 5IIEB 1UXWB 4UIMA 1A9BB 4K8RD 2AXFA 2K1MA 4HWZB 3LHPH 1NEZA 1GGIL 2DL9A 2FJHB 1JPSL 3P4OA 4OZIE 1RMFH 1RZ7L 2I5YL 3MA7B 1NAMA 3VCLB 1VKXB 1CFTA 4EVNB 4I0PD 1FNGB 3QFJA 2EE3A 2ICWI 3O9WC 1VFMA 3ZE2E 5KSBB 3UTQA 5EC2A 1G7HB 2DQCH 3EYSL 4TRPH 4HUUB 1WC7B 5DD0H 2DQIH 4IMLA 2CGRL 2LQRA 4XX1G 1NKOA 5SWZA 2CO6B 2MCPL 1U8NB 5CINH 2Y6SC 5E6ID 1JI1A 1GRWA 3IFNH 5IBLD 2LU4A 3LEXA 2GY7B 1Y6MR 4JRXD 3SGEH 2R29H 5F70A 4ZTPL 1W8NA 5TQ2H 1LP9E 2WMPA 1TITA 3DETD 2ICES 2A38A 3MJ6A 1RUPH 4JPVL 3SGDI 1WISA 5JPNB 4ODXA 1CDIA 1ZEAL 4PJFE 4LCWE 2Q7YB 4PGEB 2VQ1A 4NWTH 5FYLE 5HHPB 4TUKH 3SDCD 1UENA 1QFOA 4AIZA 4X5XB 4KHXH 2R4SL 3OKMB 1S8DA 1EBPA 1U95B 4A6YA 1OW0A 4U0RC 3FN3A 5D1XD 5HDLA 3D0LA 3IETA 1YNLH 3PHOA 1KB5L 2ZP0T 3OB0H 1ZGLA 1F6AB 3L6FA 4WU7A 5LWYH 5C0DB 5HHOD 3GM0A 3HE7A 4WO4D 4NFDA 2X4NA 1I1AD 4W4OA 2B2XH 2P46B 2X4OB 4MAUH 4FQ1L 1MRFH 1AO7D 1AE6H 1GOGA 4Y4KD 1RUQH 1GGCL 1AP2B 1LDSA 3KLAA 4CU8A 4JRWA 3RVXC 3VFMA 1D5BB 5GXBB 4PB9L 4GBXA 1KFAH 1QQDA 3TO4A 3HC0A 4P9HH 5LGKA 4IRSA 4PGCA 3QEUB 4Y16A 3QUKB 3QDMD 2X70A 2NY5H 3ARBA 1DQLH 1JFQH 2HVJA 1CU4H 1M1SA 4M1DH 1AD9A 1AGDB 5DWUL 1CXFA 2VXUL 4RFNB 5BJTA 5EZIL 2V6HA 5GISH 3C6LB 3HI1A 4XXDB 5DMIL 4QCIA 3D69B 3RWCA 1Q72L 3OJDB 5ID1B 3ARQA 5TPWL 3C08H 4G7YH 1D5ZA 3FFCD 1TENA 4RSVA 1D6VL 1JK8A 2F5AL 3NA9L 1NFKA 5E2UH 4JVPA 3V0WL 4Z8FL 1NC2B 4EXKA 3CX5J 5C9JA 4HS6A 3VFNB 1EV2E 2VABB 3QWRD 4PJCE 5MENB 3BN3B 1G7PA 5FGBA 4JY5L 3KPMB 4KWUA 5CHNA 3CDYA 4HHAA 3L5XL 4CADA 3VU2A 5I16A 3AAZA 1WWWX 4L8SA 2W07A 4YH6A 5ADPL 3PWPD 4KAQH 1Y6KR 1QFWM 4OFVA 4F9PC 2WWMD 3GJFK 2DQTL 3HN3A 1XR9A 3JTTB 3GUTA 3ARFC 3QG7H 4JDVB 1BIIA 1X5GA 2OSLB 4QTIH 4MXVE 3M8OL 4B41A 4Y5XB 2CJUL 3MBEA 3FO1B 4ZPVB 4DN3H 1WBYB 2EDFA 5LCVH 3DMMB 5KVDH 3SDYH 1IM9D 3MLUL 1NUNB 4OM1L 1BBJB 1JZ8A 3MUZ1 2E6JA 2EIZA 3IU4H 1OLLA 4PG2C 5M95B 3CDFA 1DDHB 2R2EA 1E6JL 5FUZH 4OUUA 5C1MB 5KZCD 2PETA 3GIVA 5E8PB 1WAAA 2OL3B 4H8WH 4YHKH 1FJ1B 1WFTA 2QKIB 4YHMH 1T21B 4M6AA 4OD3H 3VRLE 1KCSL 3AMKA 1J8HD 2FB4H 3W11D 3V5KB 5FA3B 3X3GH 2GCYA 2W91A 1TJIH 2CLRB 3EW3B 5TDPA 3IS0X 3QHFL 1BZQK 2Z92A 5D1ZB 3RWFB 5CCKH 3MOAH 3QDGE 3T04D 1C8PA 5EOCH 2O5ZL 3WIFB 1ZVSA 2X4TA 2HG5A 1YEFL 4U31A 2YPLD 5DD3L 3MLSL 1PG7H 3HB3D 1TPXC 5I8EB 5DGQA 3QUYD 3MV9D 4EI6B 4IMKA 3OR7A 1S7VB 1JNLL 3R06A 4EN3B 3RDTA 1R24B 5DEFB 1CBVH 4J6RH 4X6CB 4X80L 2BY0A 1RK1A 1U8HA 4GAYB 4WFHE 2HKFL 1MQKL 3ZTJH 5DJZA 3OJ2C 1LO4H 1LO0L 3X12A 5HYJD 5EU6D 3GI9H 1AKJB 5L6YL 3FO0H 4KV5F 1K9TA 3K46A 5IMLB 3PGCA 1J0HA 3QXTA 3EOAA 5DJYB 4OF6A 3SCMB 1PFCA 4LIQL 1T1WB 4K3EL 4NJ9H 3W82A 4TNVF 4NC1E 2V9QA 2APXA 1CR9L 4OGXH 1C5CL 4O58H 4X7SH 3STLB 1S7TA 3F58H 3K8KA 4ELMA 1FHGA 5HHXL 1BHGA 4I18A 3UTOA 3F65A 1QRND 4WWKC 1BJMA 2WIIA 1OGAE 2ATKB 5HY9B 2F74A 4GXVL 4ZQKA 4UU9B 4XP5L 1BEYH 1YEJH 2B1AL 5ICZA 5HPMB 3MLZH 2HYMA 5D2LB 3I3DA 4W4NA 5D7LB 5JQ6H 3RY6A 3LD8B 3T4AA 3B5HA 1A6TB 3O4LB 5IEHB 1U8IB 3MNVA 5IVOA 2YUWA 4MD0A 5TE6L 5GS1B 1UWGL 5C0FB 3VWKD 5JLZB 2WP3O 4P23B 1NGYB 4DEPB 2ED9A 2NLJA 1NGPH 1XEDA 5GSVA 3CAFA 4Z9KB 2DD8H 4KPHH 1I7TB 4JLRA 1OCWL 2XZCH 2WLYA 1J7VR 3F8UB 3NN8B 1EEUA 2Q3ZA 3B9AA 1J86A 2VXQH 4I0PA 5GRJL 3DUSB 3U4BL 4UV7H 1XGPB 1ZMYA 4M7KL 5E1AA 2Z4QB 3VE0A 3QUZD 3LV3A 4JM2B 4QHUB 2H8PA 5IMKA 1X5JA 2E9IA 4MVBD 5EFIA 3UJTH 1NBYB 1EZVY 1B3JA 2F54A 3UYRH 2FWOA 1GL4B 5E6IA 4M4RA 4Q7DA 5I1JH 3FHQA 1CXLA 5HXMA 1Y0LA 4IJ3C 4JRXA 2JF1A 4UINL 2VAAB 2NTFA 4KZDL 3WYRA 5T33H 1U8JB 2NY2D 5I8CB 2VDNL 1A0QL 2Y72A 3V5HA 2WM0A 3IKKA 2YD1A 1YY8A 3IFOA 1CGWA 3SDCA 3QYCA 4FQXB 5I15L 2JJWA 4O51A 4WVRA 3NABL 3FQNB 5EWIL 4DTGL 2Y07H 3QQ4B 4V2BA 5B3JF 3ULVH 5DMJB 2ZWLT 1ZT1A 1XIWA 4YNYB 5D1XA 2ZOKB 1L6ZA 1G7JA 2DTML 4JQIH 3D85D 3MJ8B 2DTSA 3OG4B 3RGHA 2FL5A 1VA9A 3VFRA 5HHOA 4X8JB 2NR6C 4TNWF 4WO4A 3DXAD 5CD3B 1I1AA 3VG0H 4J3TA 3CCHA 3DO7A 2R1XB 4JY4B 1AO7A 3DROB 1J12A 1CS6A 4OZGB 4FQQA 4PUBL 5TQ0L 4PGBB 4D8PB 1FE8H 3LS5L 4KU1A 1FBIL 3C6SB 2H32A 4TNVK 2GK0A 4PRDB 4RMRA 2XNAA 3FT3B 4UUJB 3QDMA 3ARDB 3EDKA 1HK6A 3SPVB 3UTTE 2P7TA 3G6JA 1RZIB 4WUKH 5DC4B 4CVUA 3QCUL 2H3NA 1MY5A 4PRPE 5DFVC 1A6UH 4HXAH 4K7PH 3UDWA 3VXNA 4AEHL 5KS9A 2P5WB 3A67H 4KMTL 5EOCJ 3U30B 3IDIB 4YZFE 2I9TA 5DRXA 4DJMA 4JDZB 2NXZD 4DWHA 3C5ZD 3ZYIA 5JORB 2V17H 5E99L 5A16B 4AMKH 5KSUB 1NPUA 3TIDB 2ZUTA 3QO1B 3D18A 1JTTA 3ZDYE 3QWRA 4BSVA 5EN2A 3MLYL 3SDAC 3D3VB 4PLJC 4K07A 3UC0L 5HYSA 2BOCA 3PGDB 2X4SA 4UV4L 5L8JB 4K71B 1IL1A 3UTZA 4F3FA 3BVNA 3PWPA 2R69L 1Q9WA 1RIVL 4YBQD 3WFCH 1KPRB 3R8QA 1D5XB 3GRWH 3NFSL 4WY7L 2EYRA 5KG9A 3S4SA 4PJIB 5SX5K 5I73C 5ISZB 4Y19E 5F9AC 3L95B 1JHLL 1CFNA 3O41A 4LCCA 5ANMA 4X4YB 1U93B 2OJEB 3QDJD 4MSWB 4K2UL 1KCLA 3EDEA 2VN4A 4N8CL 2UZYB 2IFGA 4KROB 5E4EB 1IM9A 2ERJC 4NM8L 4G6AC 3MLVH 2XTJC 3QQ9D 5AEAA 5DRWB 2Y06H 4I8DA 5C0CA 1EJOL 1ND0B 2YPKA 4LKCB 4QHLB 2NW2B 3W0WB 2BVYA 3W9EB 2ADFH 1P1ZA 4V1DD 4HWBH 5CJOL 4ZTOH 4DKEL 3RZCA 4CJ0A 3Q1SL 3VGDA 5JMRA 2FD6L 2B4CL 2YSSB 1CIUA 4PJHA 1IGML 1J8HA 5CEZH 3GMMB 1MRDH 3SDXF 3U7WH 3BDBA 4YHLH 4R7DB 1BGXL 3QUMB 4KI5D 4QRPB 1C08B 3FQWB 2V2TA 2B39A 1Q1JH 2XG5A 3DRTA 4TNWK 2EDJA 1I1FB 3KJ4C 2R15A 4FTVD 3NAAH 2D2OA 4Z18A 3QCVH 3X17A 1H3GA 1U6AH 1YEKH 5TJWK 1REIA 2Y5EA 3TWCH 4DN4L 3CDGA 5I17B 2F19L 4IOSD 1DLFL 3O6LL 3SO5A 1DVFB 3QUYA 2FCBA 3LKOB 1VGKB 5DK0A 1EFXB 1XGTB 1RUKL 1Z9OA 2BNQD 2FATH 3CC5B 4X4XB 3QPQD 4LEOA 4PB0H 1AI1H 1QR1B 4TULL 5GGTH 5J6HA 2N56A 4NO3B 4Y16C 1RZKL 3IDGB 3K2MC 3ARBC 5HYJA 4G8IA 2XN9D 5EU6A 4DZBB 5ALCH 3BUYA 5I1EH 3GHBL 5KJRL 3EYFA 4G8GD 2NY3B 1JWUB 1OQXA 4X6DA 2ADIA 1NAKH 4LPUA 3U9PH 1DQJA 3QCTL 4JFZH 2Q87A 1EAPA 3ELAT 4CVXB 5FK9A 1A9EA 3MMEB 2Q20A 4P2QE 4GQ9H 1OSZB 5F7MC 3OAYK 4FP8L 2P8LA 1I7ZA 1RVFL 2EC8A 2ZCKH 5FV1L 4P5TA 4JZNB 3HNVL 1JGDB 5GRVL 3VD3A 1FIGH 1QSED 2P8PB 5FGCE 1QRNA 3MBXH 3LRHA 2AEQH 5D7SH 4LLAA 4AJ0A 1URLA 4OTXH 1XF5A 4I5BA 1MELA 4NCC2 4RRPA 1YEHH 1XR8A 1A8JH 2GJ6B 1V5JA 3RUGE 4KY1L 5D7IF 4DFHA 2IH3B 2COQA 4ORGA 3DUUB 3FQRB 4YHPB 4P46B 3QG6B 4L8SC 1MJJB 2RAMA 4GW5B 1A4KB 4NUGL 5IFAL 1NGZB 1AGFA 1OF2A 3IU3A 4W6YB 1K4DB 5I66B 5KOVC 2YD9A 1KENL 2DDQL 5C07D 3VWKA 2QHLA 1XF1A 4PJ5B 1T7ZA 3FOLA 5JZ7D 3QXVA 4NNXA 4QRUA 3P4MB 2MCG1 4NNYA 3VFUB 1JGUH 1FG9C 3DVNA 1IMHC 3TNNA 2IMMA 3JWDL 4GUPA 5J1AA 1PSKL 4GKNB 2B1HH 3QUZA 3VDCA 1V8HA 2VC2L 3S36X 2IPKA 2MKLC 4IRZH 2H2PC 3CMOL 3I75B 5CIPH 5FECB 3D25B 4NOBA 2AW2A 4ODSH 5T1KB 1DFBL 1UCBL 1T0MB 1HH9B 3VFPB 1JNHA 3UPCA 1S7QA 2ZKHH 1T20A 2B7DT 3WJJA 2VKXA 5K9QG 1CD1B 1T89A 4X6FB 5IHLB 1F3JA 2BRQA 3IDMA 2MWCA 1NANI 1CN4A 4RNRB 3PV6A 4Y4FB 4XNQB 5F7EL 2HFEB 4KK8D 1ACZA 1Z9SA 4ZUUB 5JO5A 4S1QL 5SWSE 1JWSB 1TVBA 1TCRA 5GZOD 2DI7A 1YPZE 2BNRE 4JFYA 4U1MA 3LPWA 3SGKC 2M26A 4X7FC 2I07B 5HGDB 3M17A 3D85A 1QHPA 5EOQH 1U8KB 3O2VH 1CL7I 1F42A 5CGYC 3RDTC 4NJAL 1T1ZB 2C3VA 2FYYA 1INDH 2X1PA 3T65B 1J5OL 4XMPL 5D9SA 1U9KA 4D3CH 1XCQB 2A74A 2DI9A 1G84A 4TSCH 1DN2A 5I1DB 4O9HL 5EU3B 4MB3A 3RIAF 5INCB 3WNOA 5C0JB 3X13A 3IDNA 3IJHA 5FF6B 5HDBF 1ACYL 3K0WA 1P4IH 3GIZH 2X41A 4YUEL 3T2NL 3VFVB 5IHZA 1JZ4A 5BV7L 4OD1L 5FOBA 1RK0B 3VGGA 3UCRA 3QWOB 4YFEA 4HDIB 5MERB 3C5ZA 1B4JH 1R3HA 4JHAH 3SQBA 4Z0BH 4C4KO 4LVHC 5JMOC 1UJ3A 3ARED 2ZPKL 3FB8A 1MVUA 2HLAA 2C26A 3PWUA 4M93C 2EDOA 5EO1B 3HAEH 4Q9RL 3D39A 3BKMH 4CW1A 4PR5A 5T5FH 4IIQB 4K8RC 4DGVL 5MEQA 3FOMB 3KXFD 5DQJA 5L88L 1RJLA 3RRQA 5DMKB 2CLVB 3CJJA 3VXPB 4DCQB 5IEKA 4P5KB 1FZOA 2C1OA 5GS0H 3P11L 2EZ0C 2XTJE 2YRPA 5E6ZA 3CH1A 1KEGL 1KXTB 1RURL 4I0PC 5GGVL 1EEZA 3BZEB 3RWIA 1SYSB 2J6EH 2DLFL 4DVRH 4JCLA 5C86A 1FVDB 3QDJA 1OAUH 4P2OB 1NCAH 4JFXB 3BP5A 1CXEA 1RJZA 4R2GB 4LCIH 4EDXA 5L7XL 1IGFL 4W70A 3DX8A 3BJLA 1T0NA 5E6IC 5IBLC 3MCLL 3JVGA 5FO9B 5I6XC 4HFWA 3S88L 3WXVL 1S7WA 3LKQA 2DQEH 4DAGL 3PUCA 1FQ9C 3QO0A 3ULVD 4M61B 1CI5A 3DETC 4V1DA 2J3SA 4PRHB 5HHME 2X44D 3BPLB 1OWRM 1AY1L 3UPRB 3VA2C 3KHOA 3SDCC 1RZ8B 1KIRB 5CBEB 3OPZL 4YPGA 4D9QE 4NSKA 3P77A 3FQXB 4YHNA 4U1JB 5JW5B 3KPSB 5D1XC 1N0LA 5CZVH 2DWEB 3MRLA 1Q0YL 1NEUA 4FTVA 3C09C 4D0CB 2UUDK 4U6XA 4TOYL 2OP4L 3PNWB 4XAWL 1RFDL 4OLYL 4U1IB 2R2HA 3RIAK 1AFVH 2QTEA 2CR6A 5AD0A 5KN5B 4LP5A 4Y4KC 3MGAA 3UJIL 5GGRA 1F4WL 3OAYH 2ZSVA 4WW1A 1MREL 5C0RL 3ZL4L 4I1NB 3V0VA 1KPVA 5D6DA 4LSPL 3L3GB 5JR1H 3VRJB 4N1CA 4J4PD 1JPGA 2A6KB 2BK8A 3MRFA 5GJSH 3C5JB 1U3YA 5JHLH 4ZS7H 4MXWL 43C9B 4G8GA 4PJEB 1Z5LB 1F4HA 2YPVH 4N5EC 4RQQA 4ZUVB 1P9MC 4D9LL 2FSEB 1T7YA 3CH8A 1YUHB 3MNWA 3QXDA 3MREA 4EUPH 1DANU 4MA3B 1CFQB 1HYRC 2F53B 3FT2B 3IB4A 3MRPA 4Z7UE 4XXCA 2YN5A 1KIQA 12E8H 1QSEA 1IC7H 3VRIA 3GKWH 5C0EA 1FNHA 4N0RA 2BDNL 1F45A 3DX7B 1WF5A 1NBQA 3PWLA 2ZCHL 4OCXL 2GYSA 3GSNH 5FM4A 1GHFH 2YXFA 4S11A 4PLOB 3O8XA 3CMGA 2W65B 4PBXA 4Q0XL 4HXBL 5JUEH 4OZHB 2DQUH 1D6EA 4ZUWB 3T2PA 4FOMA 5ID0B 1BVKA 2CDEA 2OR9H 3C6LD 4Z7NE 5C07A 2ZUWA 1IEBB 4JG1H 2WWMC 1YMME 4QXTA 3GBNH 3NACL 1OL0A 4ZS6D 2VLRD 3OAUL 1EGJH 3BP4A 1LO3H 4H25B 4ONGL 5D2NB 1WAAE 3U2SB 1GGBH 3CK0H 5JQHC 2E7LA 2K7QA 1YEIH 1WBXA 3U0WH 5CEZD 4PBVC 3JWOH 5MP6H 1NLDH 1HHGA 1KT2B 3DYPA 4X4ME 3WEXB 1WCBB 5DGRA 1M05A 2WZPD 3ROOB 1GZQB 5TFSH 1HNGA 5D5ME 1FNEA 3L3IB 5DVKA 1RJCA 3T1FB 1AHWA 2VH5H 3WIHH 3MCG1 5L2JA 5HVHC 1JF1B 4LBEB 4DK3A 1R5IA 1LEKB 4Y5VA 3LH2H 3C8KB 5T3XE 1PKQE 2ESVB 3HC4L 4YK4C 5GGRY 1UKSA 4GJTB 3CNKA 3NIDE 1RIHL 4KQ3L 4HMCA 6FABL 5HVWA 1RZJL 3BEVB 4YHZH 4OZIF 3HB3C 3C2AL 3TC9A 1C1EH 1AIFA 3PF2A 2Y36H 3QUYC 3TP4A 2WWKT 3S7GA 1CD8A 1NCNA 3RWHB 3EKCA 3I9GL 4G7VL 1AXTL 2QADC 2VQUA 4HKXB 4HUWA 3ZE2F 3HZMB 2DIAA 1J05B 3HI5L 4LLYA 3MUJA 2C3GA 5JA8B 4G8EA 4OF3A 1U3ZA 3ILPA 4GSDH 2D31A 5D1ZD 4ELME 4XVUD 5GRYA 4DQOL 2A77L 5JDSB 3K1DA 3MLXL 3G9VA 5KSVB 3MUGB 4HJ0D 1M6OB 4JRYD 3MOBH 4YGAB 1FZJB 3U46B 1WBZB 3M07A 3I6GB 3IXAB 2XRAL 4PP2A 4I48B 5F93C 1I8MA 1U42A 3FRPG 1LP9F 4U6VL 5E7BA 2H2SD 4Z77B 4EI5A 2MFNA 2LVCA 4PJFF 1DUYB 1BVZA 3LRGA 5C3TA 1XF4B 2KKQA 3G5ZA 1A7QH 3SEPA 3ZSSA 2F5BL 3OKKB 4ONFH 4S1RL 1YN7B 3ZHKA 1EERB 3GSOB 4J3SA 3RL1B 2QHRL 4D2NA 3INUL 3WHE1 4POUB 4ZFFB 4HS3B 2H1PL 3WXWH 1T3FB 4XNYL 3H8NA 3I02B 3KXFA 1PLGH 5A2FA 5F6IB 3UX9B 2D7TL 5I8KL 4DKFH 5C0ND 1A6ZA 4GFTB 3VWKC 3BPOB 4E0RB 1JV5A 5DRZB 5E5MB 3C2SA 2GFBB 3H7BA 5IW6B 5I1KH 5CSGA 1QBAA 4YEFA 3JWNC 4JY6B 5F3HB 5GGVY 4L9LC 1CF8H 1HCFX 4HX1A 2KZ1B 3RTQD 3MCKB 1A7RL 1AXSB 2G5BA 3QUZC 5IK3B 3UTSB 4NRXB 1I7RA 1X6LA 3ZKMD 1D9KB 1T5XB 2OMNA 4MVBC 5D7LD 5FM5O 1FO0B 5IIEA 1UXWA 1OAQH 3HC3L 1A9BA 4NRYB 4YXKH 1VFAB 4HWZA 1L7IH 1LGVA 4KDTA 2SEBB 3H3PL 3WJJC 3Q6GL 1QFUH 1TJGH 4F58H 3MA7A 5C0AE 1CLCA 2NY2C 3VCLA 2EKSB 3KPQB 4LEXL 5H2BB 4KZEH 3KPRD 4EVNA 5KVGH 4YDKL 1FNGA 5HHOE 1ZTXL 2YXMA 2IGFH 1RZGA 4RA0C 5KSBA 3LDBB 2WUCH 4PJCF 2OL3L 4R0LA 32C2B 1G7HA 2HFTA 4HUUA 5KSAD 1WC7A 1CFSB 2GY5A 1I75A 2DJUA 4RAUB 1MIEL 5T1DH 1CGTA 1GC1C 1SYVB 1EUTA 3PXJA 4OBSA 1U8NA 4LVOC 1MLCA 1VHPA 4MLSA 2O93L 3QDME 4JFFE 3PP4L 1Y18B 2NX5B 2E7CA 4B7LA 2RQ8A 3ET9F 5C08E 2O61A 3GSWB 4M9PA 3O11B 4BA8A 2FJGB 3JUYA 3WSQL 3KNBB 5KVFH 4MXVF 2HT2D 5I1CH 1MAML 2Q7YA 4PGEA 3H9ZA 1EEQA 4R8WH 5IFHH 3IJYB 4FQXD 3CU1A 4X5XA 3F12B 5JOPE 3ESUF 3FFCE 5GRWA 5HTSA 3OKMA 1CLZH 2WLZA 4NZUL 1QPXA 1Z2KA 3LKRB 5F9WC 4YX2L 5IVZB 4W68A 2YUXA 1F6AA 4UIKH 1YN6B 5C0DA 4X7DC 2DLTA 4R7NB 1X5AA 3VRLF 3J7HA 3QRGL 4UILL 3OKNB 2NXZC 1A6AB 2X4OA 3C5ZC 3GMQB 3S3PA 5FYKL 1DEEB 1XH3B 3L9RB 2H45A 3BISA 1RUAL 1D5BA 1VSCA 3GJFB 5GS0D 4M8QB 5B39A 4Z7QE 4OAWB 4R97B 3QEUA 4ZNCD 3QUKA 3D5OF 5E08H 1GAFL 3BZDA 3DOSA 1CGXA 3OSKA 2J7LA 1IJ9A 2VXTH 2A9ML 4HPYL 4YBQC 1MCJA 3OHXB 3MNZB 3QI9D 4Y5YB 3C6LA 4XXDA 1OAKH 2X05A 2XKUA 3D69A 1I8IB 3OJDA 5ID1A 1NCBL 5ACZB 4NGHL 3SE8H 3U6RB 1CGVA 4L3AA 4XBGB 4G6JH 2NY4B 1NC2A 4OLZL 2G60L 3D2UD 1A7OH 1F02I 2VABA 1ED3B 4XNXH 1E4XL 3PDGA 5MENA 4JB9L 3S5LA 5SX4I 3D3VD 1Z3GH 3QQ9C 1IQWH 5F9JB 4RDQG 3UBXI 3JVGC 1NCUA 5FYJU 2H41A 3TA3D 4JFED 4ODWB 5DEZA 4R96B 2YPLE 3RI5F 4HGWB 3MZGB 1VEOA 5L0QC 3A6OA 4JDVA 1OM3L 3MGOB 2OSLA 3MV9E 4RZCB 1MRCH 5T5NG 4KI5C 3RHWF 3FO1A 4ZPVA 3VXSB 3WFDL 1HHIB 5K93A 2YC1B 4PV9B 4XMKL 1BBJA 4GG8A 5FHAL 1ZANL 1FZMB 3QIBB 1DDHA 1V7NL 4P9HC 5D96B 3VFWB 1XGRB 5EU6E 3W0WD 1MCOL 2OBGA 2YEZA 1B0WA 2NY5C 3W81A 4F7TB 5E8PA 2HVKB 3O2DL 5I30L 1MEXL 1Q94B 3CZJA 5DUBB 1T21A 2HTLD 5ALBL 1I3VA 4JREC 4KC3B 5FA3A 3V5KA 5D6DC 5FHBH 2CRMA 2E27H 3QPQC 4G6MH 1BZ7A 2CLRA 3ZDZE 4LCYB 5K59E 2H26B 4NN5B 4QRPD 3VFGH 5D1ZA 3FB7B 1JP5A 1RZFL 3RWFA 1JZ3A 1L9NA 1G7LB 4JKPH 4JRYA 2ORBL 3WIFA 4LGPB 5F1NB 4I2XA 2AGJH 3GKZA 1KELL 2DLGA 5LQBL 1H0DB 1H5BB 5I8EA 4LSDA 4XPHH 1KN2H 3WHXB 1AD0B 4EI6A 1EFXD 1S7VA 5EA0H 4XXCC 4H1LB 2Z9TA 4LQFL 1R24A 4X6CA 4JR9L 1P5UA 4GAYA 1BZ9A 5F1SA 1LO2L 1MIMH 2AABL 3EO9H 3TPUB 3IAGC 1EUUA 1G0YR 2V7HB 3TJEH 2FGZA 5IMLA 2NY3D 4WENB 3B9VA 2Y4SA 3ARUA 5BW7A 2O5XL 3VH8G 5DJYA 1NLBL 3SCMA 4L3ED 3OWEA 1T1WA 1HIMH 3OJVC 3E2HB 4HWNA 1YA5A 2R2CA 2BJML 2DQJL 4KTYA 4YXLH 5JZ7C 1KACB 3WFEL 3STLA 2FBOJ 4IS6B 4YGVA 3C8HA 1N7ML 3KPNB 2YMXL 5HJ3B 2WBJD 2ATKA 5HY9A 2E7LC 1JF6A 4UU9A 5F72S 2BRRH 3VXTB 4AQOA 1WFNA 2CLZB 2GJ6D 3T08A 5HPMA 2GT9A 1MWAB 5LKNA 3ULUL 4GMSH 5D2LA 2K3TA 3BKCH 1CGSL 5D7LA 1KJ3L 3VXUB 3RI5K 3S37L 1A6TA 3O4LA 4JFOB 4MA8L 1N5YL 1U8IA 3U9UA 1AJ7H 2JB5L 5GS1A 1NJ9B 4P2RB 5JLZA 4YZFF 3RHWK 4NQVB 2BMKB 4OCSH 1LHZA 1VFOA 2IFFH 3VXQA 1I7TA 5HHQA 1I9JH 4MQ7A 3SDDC 3WKMH 2GUOB 2CKBB 3DXAE 4MA7H 4U1GC 3ZDYF 2O5YH 3DUHA 3BDYH 3O6KH 1M4KA 2Z4QA 4XRCB 2E3VA 5KSAA 4G6KL 1RHHB 4EBQL 4JM2A 4QHUA 4H88H 5I2IA 2E8YA 3Q3GB 4JFDD 3MACH 3G6DL 5A3ID 2D7MA 3PABA 5FXCH 5J12C 4BZYA 1FP5A 4JGJA 5IROC 4UZGA 5KANG 4XCYA 1UWXH 4UOJA 5T3ZH 1MOEA 1W72B 5I9QB 5I1GL 1FO0H 4FABH 3VMNA 5CS7A 3BQUB 4CKVX 1F4XL 2D4FA 4NQEB 1BFSA 2JCCF 3FO2B 4FQXA 5F88B 3OXSB 5I75B 5J6GB 4BQCA 4URTB 3FQNA 2MQ0A 3QQ4A 2AJZB 1RULL 3TT1L 4YNYA 3O2DA 4U7MA 4HCRH 3VWJD 3BOVA 4LPYA 2ZOKA 2PYEE 5AWNL 4OSUL 1HZHL 4BUGA 4RMUA 1RIUH 1T4KB 1N2RB 1N0XH 3MJ8A 5D1QD 1MJ8L 3NZ8B 3MRNB 4M5ZH 4YFDB 4WFGE 4X8JA 4OQ1A 5ENWB 1E4KA 1U92B 2W1NA 5CD3A 3BIKB 1DBJL 4OLXL 4POYA 2R1XA 2KZWA 4JY4A 2X4QB 4OZGA 4JKKA 3X11A 1V7MH 4PGBA 3AREC 4PJGE 4D8PA 4WIQA 5FYJH 4TTGA 3VA6A 3C6SA 1A1NB 1UJTA 3NFNB 4PRDA 3HUJB 3FT3A 4UUJA 4AEIH 4ZFGH 2VLJD 4LPCA 2N1KA 3ARDA 1NEZG 3QDJE 5DVLA 2OTUB 2J6EA 1QBLH 3SPVA 1PEWA 2K7PA 4XVSL 1BM3L 1RZIA 5L2KD 1NCWH 1CE6B 4DOHB 1PD6A 4L4JA 4M7ZB 4XPBL 2VQTA 3QI9A 4X99B 4KJPD 1JNNL 2NYYD 3QUXC 3HE6B 4JDZA 4DUWA 3W5NA 1FH5L 5JORA 1OLZA 3HNSL 2HFGH 4P0DA 4V1DE 3U82B 5A16A 3QIUB 1PZ5B 4XWGL 5KSUA 5FO8B 3TIDA 3QPXL 2OXGA 1JMZA 2AJSH 3QO1A 4QXUL 3RA7L 2JJSA 1MCRA 1IC4H 2AV7B 5HVGB 3D3VA 3ZT6A 1F58L 3ZTNL 5EO0B 1I3RB 5DF0A 4KI5E 4KDTC 3KG5A 1QVOB 3IFPB 1LWRA 1YMHA 3ULVC 3MYJB 4JDTL 4FTVE 4JFEA 1N4XL 4TTDD 1WZMA 1KPRA 4NZTL 2V9RA 5C3LD 4KGJA 1IQDB 3P3YA 4ZYKA 2OXHA 2D7NA 2X09A 3BESR 3MJGX 4PJIA 1TCMA 4R0LC 3L95A 1BIHA 5E70A 4X4YA 1U93A 1BQUA 3QEQD 3RUGF 2BNQE 4U3XA 4PD4K 1SEBB 5EOTB 3V7AE 2CUHA 5B8CA 5IKCB 5DRNB 2CMRH 4G3YH 3TLRA 4KGLA 4QHLA 2XN9E 3W0WA 3W9EA 5IM7B 3ZKXB 2VZVA 1KC5L 4Q6YA 1U2CA 2AQ1A 5FUOL 3EOTL 3UZVB 3CXHK 4PRHD 1J1OL 3VGHA 2YSSA 3VH8B 4C56D 5E1HB 1HCVA 1BX2A 3GMMA 1HINL 1OAYL 1QFWH 4BQ9A 3GNMH 4Q9QL 3OF6D 4R7DA 3VG9C 1I8KB 4J4PC 4HK3N 3QUMA 1ZA6B 1WTGT 4LFHD 2VDKL 4QRPA 3FQWA 1GVIA 5C2UB 3KPSD 1I1FA 4ZUTA 5C6WH 1NFDA 2E9JA 2DS4A 4QEGA 1G7IA 4ERSH 3IFLL 1KEML 3UPAA 1T03L 2IAMB 4YE4H 3O81A 4L3CB 2PW1A 1DVFA 3V5DB 3LKOA 3BP7B 1VGKA 4OZ4B 1UKQA 1EFXA 5EO9B 1KN4H 1K3IA 1LVEA 4DGIH 4ZOAA 1TJHH 3WV0A 5BQ7A 3CC5A 3NCJL 2FGWL 4O4YH 2BSTB 4X4XA 1LK3L 1YQVH 1QR1A 3CFCH 4R6UA 1BQLH 2BXZA 3RBSA 3RVVC 1YPZF 2EE2A 4PRID 5HHNB 4DZBA 2MPAL 4FZ8L 4HJJL 2MHAB 4UTBL 1IGIH 5TGBB 3MYZA 1JWUA 4HWUA 5IV2B 1MCCA 2Y1VA 1I3UA 3GBLA 3EFDH 3SQOH 1TQBB 5F9OH 4CVXA 4GKSB 3MMEA 1UYWL 2CUMA 1OSZA 5E7FA 3SDXB 1DE4B 4ZS6C 2ADJB 3PXHA 3BKYH 5HHVH 4JZNA 1JGDA 4LRIA 5EBWB 1JVKA 4A2MA 2P8PA 1PX4A 2EO9A 1L0YA 1CDBA 3TYGL 2VXSL 1CLYH 2GJ6A 2GITB 5DK2B 3AGVA 3WCYA 4YDIH 4CNIB 1BD2B 2JELL 4HUNB 3DUUA 4YHPA 3QG6A 4OKVB 1MJJA 4OQTH 5A2LH 1A4KA 4NN6C 1NGZA 5I66A 1K4DA 2AXGB 2DQCL 1EO7A 2CXKA 5D6CB 4PJ5A 4KRLB 1UM6L 3DVGB 2PO6B 3P4MA 1C12B 1U8PB 4CMHC 2LV4A 3VFUA 3DHJA 1B88A 5DJ8B 4PGJA 1II4E 4GKNA 3PL6B 1RUPL 1NCDL 1AGCB 4NQCB 4IOFD 5IB5A 4MNQB 3I75A 5FECA 3QIWD 4JFDA 3D25A 1ZLWK 4NWTL 3PQYB 4TUKL 4K3DH 2VMFA 3BI9X 1T0MA 4OCRH 3V4VH 1HH9A 4E5XB 3VFPA 1MF2L 2ICWJ 2VDPL 1F8TL 1OP3K 1CD1A 2VO5A 4X6FA 5DZLA 4Q74A 2FR4B 4B7IA 4GG6B 1A64A 1JPTH 4RGMC 4LLMB 1EPFA 1QSZA 1UB6B 4RNRA 1Q9OB 2WINB 3VFSB 3DPBA 4Y4FA 4XNQA 1MCPL 4XVUC 2HFEA 2ESVD 5D7IB 2GTWB 2Q3AA 4UNUA 1WGOA 1FDLH 3DTXA 5CBAB 1JWSA 2L7JA 3G5YB 3E1F1 2QJDA 4I13B 3TZVB 2FH8A 3VWJA 4XPGL 2EDHA 3Q0HA 5HGDA 4HBQA 2H2SC 4PJ7E 1KTRL 1IKFL 4PREB 1U8KA 7FABH 2XTLA 1T1ZA 4D0DB 5DJAB 1KTLB 1L6XA 3VXRB 1XCQA 3LKNB 1R0AH 1V3JA 5EU3A 5I8OL 4KFZC 3VGAB 3N50A 7CGTA 1KJ2B 2EDTA 1MQ8A 3RGVB 4AM0B 4YBLB 2IH1B 1JTPA 5E8EB 5INCA 2XWBB 3ESVF 4Z5RB 1MFCH 1VFUA 1BQHB 2WK2A 3C08L 5GSRB 5C0JA 3IDYB 2EECA 5MHSD 3U4EA 3RFZC 5C0NC 3TIEB 3VFVA 4IM8A 1MPAH 1T1YB 2OS7A 3O3DB 4JO3L 1RK0A 1S3KH 1FL3B 2ARJA 4ZAKB 4I77L 4HDIA 5MERA 3BSZH 3ULVE 4OLVH 1HXMB 2R23A 5HGGS 3RTQC 3EHBD 1FFRA 2YBRB 4JJ5B 3CFBB 4BK5A 4XNMB 4QOKD 3RX5A 4E42B 3LQAH 4KTEL 3ZKMC 4U1HA 3LD8C 5EO1A 3K80A 4LLVB 4RAVB 2VTFA 3FOMA 5T1LD 3DX6A 4MB5A 5DLMH 5KVEH 2CLVA 4DCQA 4DKDC 5GS1C 2KPNA 4P5KA 5IWLA 4DN3L 4U1LB 4JAMB 5DD1H 5JW4Q 4L8BB 4DZ8B 4UAOB 5C6TH 4XPFH 4Z7UF 4XBPB 3ABZA 1FNLA 2P48B 3BZEA 1SYSA 1WZLA 3PP3K 2A73B 4Y7MA 3GI8L 3QNYB 4FZEH 3GMNB 1ULVA 4G9FB 5IBTL 2UWEA 3V6ZA 5KSAC 1YJDL 5EU5B 4YO0B 3QEQA 3UTSD 4P2OA 4H8WL 2WIMA 3FAWA 4JFXA 4ZOBA 2XY2A 4D0BA 1C5BH 1KIUA 4KUZH 1VB9A 4NPYB 5FO9A 2APBA 4HC1H 1CICB 1SY6H 4UTAH 2EH7H 4M61A 1TZIB 1WVZA 2Z35B 4PRHA 4QHKJ 1WAAF 1J0KA 2AK4E 3ULSB 1UXSA 2HT2C 4C56A 4AENB 1KTDB 3UPRA 2A6JB 4RGND 1RZ8A 5CBEA 4FQXC 1PVHA 3N9GH 3OF6A 4X5LA 3GSXB 2CKNA 2P42B 3FQXA 2PTUA 3AS0A 4QRRB 2J8UE 3PDDA 3KPSA 3O2WH 1CBVL 1UWEH 2DWEA 5DMGD 1HHKB 1I9RL 5F1KC 4D0CA 1PQZA 2ZUUA 2MSPA 3TV3L 5FYJD 5F96L 1NC4B 4U1IA 4EOWL 2MTPA 2NX5D 3HG1D 3R0MA 4NO2B 1CK0L 3MRRB 3OBAA 2MKWA 4JO2L 4X83A 1LE9B 4U3CA 4LCUB 5GS0C 2NXYD 3L3GA 3EJYD 3CU7A 4OCMC 4OZFB 5L8KB 3VRJA 2VLKD 2VLRE 3NIDF 2A6KA 3AM8A 5E2VL 4PRIA 3K4AA 3C5JA 3HFML 3U7YH 43C9A 4C54A 4R26H 4PJEA 1Z5LA 3A6CH 1FORH 1YYLL 1T2QL 3N06B 2J88L 2PYFB 1FFPA 2J4WH 1YEJL 3QI9C 1IAKB 4ZUVA 1WZ1H 4LVNC 3QQ3B 2D03L 5LBSH 2IBZY 5HYQA 5J56B 2FSEA 5E94B 2VDRH 4OKDA 1YUHA 1IEAA 4HKZB 1N6UA 4FQPA 5E9DB 4ELMF 3WLBB 5C9KA 2JJSC 3DX7A 1RSFA 3VXMB 2VDOH 3EO0B 1BPVA 3HMWL 4NNPL 2XKNB 1GJIA 3B9KD 1KB5B 4E41B 3SBWC 3BRDA 2W0LA 1E4XI 4OZHA 4ZOEA 2XQYG 2X4UA 3MC0A 4K71C 4ZUWA 2XWTB 5DMYA 3TA3C 3VDAA 3M45A 1A3LH 1IEBA 3S36H 4L4VE 3QHZH 5GJTH 1NKRA 1QLRB 3ES6B 1OP3H 3UYRL 4H25A 5D2NA 2PR4H 2FHCA 2RIKA 3SKOB 4HLJA 4LSTL 3U2SA 3QBTB 2NY4D 5I1JL 4M02A 5GGQH 3RU8H 4XPAH 4MJ6A 1MCSA 4FG6C 3V52H 3K74B 3CLFL 4YHYC 5T33L 4X0KB 1KIPB 5B8CC 1HILB 1FLTX 1WK0A 1KT2A 3LEVL 3WEXA 1WCBA 1IKNC 3JV4B 3QIWA 3UJJH 4XCFL 1LEIB 3ROOA 4FQIH 1GZQA 1ZVYA 1EHNA 4JRYE 4QKXB 4U49A 4OB5L 5F89B 1NDMA 3T1FA 4GAJH 1B0RB 4I2XE 2V5TA 2HTLC 4KK6D 5AG8A 1FNSL 3AS3A 1JF1A 3MXWL 4LBEA 1LEKA 4QHNA 4WFED 3CVIH 1QSFB 4NQDD 3C8KA 3QH3B 2ESVA 1V3LA 3VXSD 1CLOH 1ETZA 5KVMC 4GRWH 5E8DL 3QZWG 5DC0A 5I74B 3VG0L 5FM5M 4K9EH 4JM4H 3MX0A 1HKLL 4OF0A 3BEVA 1OP5K 4DK6A 2R0WH 3MV8D 5CEXB 5TDOB 3RWHA 1A2YA 2X10A 2E9WA 8FABB 2X42A 5DHVB 4HKXA 2UZIH 4FQCL 3HZMA 4XX1E 1J05A 4R9HA 3H9SD 2YD2A 4DGYL 1A6UL 1OARH 3ARWA 4K7PL 2VR5A 2D4DA 2Y5TB 3A67L 4ZO8A 5JDSA 3GO1H 4K94H 3UO1H 5D93B 5BXFB 4BFIB 5KSVA 3MUGA 4XB8A 1M6OA 1R5WB 2NY3C 1GZPB 3FN9A 1EHLH 1FZJA 3U46A 1WBZA 4OLUH 2B8OT 3I6GA 2VR4A 2L0DA 4JVWA 1JHKH 4BUHA 1ADQH 4IDJL 4JPKL 4NKOB 1S9VA 1QYGL 2EH8H 4I48A 5FIEA 3CFEB 3NCEB 3JWOC 4Z77A 1P7QB 1KLGA 4F7PA 4LRIC 3PWJB 4F37F 1DZBA 2R56L 1IT9L 1DUYA 5FCSH 1JBJA 3R4DA 2WBJC 3O6FD 1N64L 1OSPL 2C3WA 2IANB 3ARGB 3KYAA 1T04A 4Q9BA 1XF4A 5GPRA 3OKKA 2CIKB 1ORQB 1YN7A 3KPRE 3WFCL 3RKPA 3T3PF 4OZIB 3GSOA 3RL1A 1U0QA 3BE1L 4ZFFA 4HS3A 1T3FA 3W5MA 1Q38A 2DLEA 3I02A 4KUCD 3QJHB 4JPIB 5GS3A 4TSBH 3SE3A 4KMLB 5EU7E 1MCIA 2OTWB 1KJ2H 5DRZA 5E5MA 4FFZH 2FX8L 4JFPB 3BRGC 2YA2A 5IW6A 4U1SB 3SE9L 3H9YA 3H0TB 2X7LA 4LARL 5ILTL 5F3HA 3JBG7 1PEZA 1DUZB 3VGEA 3LN4A 2UV3A 4Z7QF 3NPZB 1YYML 4WEBL 3EYUL 2RHEA 1G9MH 3OKDB 1H3TA 4PJ9B 1V3MA 4X5WB 4A6YH 4CU7A 2Z8SA 3NIGE 1AXSA 1FG2B 3UTSA 5IK3A 4K3JL 4NRXA 2JJUA 1D9KA 4DUVA 1HSAB 2AJXL 1LP9B 1FO0A 3VXUD 3BKJH 2VZTA 5A3IC 1FFNB 1XZ0B 4U0QB 4YHLL 4PJFB 3U0PB 4LCWB 2SEBA 4P2RD 2NY7L 1FFOA 2IMNA 2QV2A 3P9MA 2WBWB 4FQLL 2BFVH 4R4FL 3KPQA 4HCRA 1F2XK 1YDPB 4WTZG 3L3DB 4MHHI 1PGRB 4PJHF 3FN0L 4FRWA 5LGHH 1RJYB 3NCCB 1OAZH 4M5YL 5C2BH 5CP7B 5DJ6B 32C2A 3BEWB 2DB8A 4MNHB 1WIUA 5C0BD 2QQKH 1EMTH 1CFSA 1G6RH 1J10A 3VWJC 4RAUA 1ZVHA 3HI6L 3OG6B 4F2MA 1SYVA 3UTPE 5C7XL 3FJTA 4KXZI 1KNOB 1FSKC 5D1QC 4S10A 2RCSH 3NCYS 4BZ1L 3CVHB 1Y18A 2NX5A 4UT6H 3ISWA 3O11A 1BVLA 5AAMA 2FJGA 1G0DA 2JJTC 1NL0H 1NAKL 1VCAA 3BQUD 4NQED 1H3XA 1W2KT 4LSRH 1L4IA 4Y1AE 3GSVB 4N8VB 3F12A 1F5WA 2NPLX 4NP4H 3LKRA 2J1KA 3EO1A 5IVZA 5BS0D 4MS8D 5AZ2H 2XA8H 4X8XA 3WFHB 3QJFB 5CLWA 3D3VE 4XP4H 4KJPC 5DR5H 4HIIB 4R7NA 2ICWA 1PG7W 3UXFA 4HAFA 3OKNA 4O2FB 1A6AA 3AS2A 4PJCB 2WW8A 3GMQA 1JF5A 1DEEA 1XH3A 4JFEE 5K59F 2NY0D 3GMOB 4YWGL 3L9RA 3GJFA 5SV3A 4M8QA 1RZ7H 4UI2A 2I5YH 5IF0B 3DSFL 2BSRB 4JE4B 4G6FB 4Z7OE 1K8DB 3EYQD 4RWYL 1IE5A 3B9KA 3WBDA 1DQTA 2DN7A 2FDBP 4FXKB 3S37X 3MRMB 1QO3B 3QZWB 3MODH 3OAZK 3EYSH 4WI5A 1MHCB 2CDFB 3CXDL 4WNQB 3OHXA 3MNZA 4Y5YA 3TBWB 1K6QL 2CGRH 4TPRL 3V2AR 5ACZA 1JHTB 5I0ZA 3GSRB 3U6RA 3ARYA 4XBGA 5J1TC 2ZKHL 5E0QA 5DJ0B 4U7SA 4ZTPH 5HYEA 1G9EA 1SQ2N 1ED3A 2N4IA 1SM3L 4JPVH 2OLDA 4R90L 1ZEAH 5H8DA 5D7JC 5F9JA 4QRPE 1HOCB 1NGXB 3BYYA 1HEZB 4LAJH 2CKBL 4WW2C 5JW3H 4P3CL 5FA4B 3HS0A 4YDJB 2R4SH 5IB2B 1NFDE 2Q1EA 4ODWA 3E0GA 3QP3A 1NBVL 2QEJA 3LQMA 1A6VL 1KB5H 3QDGB 4HGWA 4Z95L 3FRPA 3RVUD 3TT3H 5D70L 3MGOA 2XWJB 4P4RB 4WEMB 4NQDA 4RZCA 4S1DC 4HULB 4CJ1A 3VXSA 1W72L 2YC1A 5JTWA 4FQ1H 4PV9A 3LPFA 1FV1B 5KW9L 1GGCH 3L5IA 4TSCL 1FZMA 3BW9B 4PB9H 3H2WA 3VFWA 5F3BB 1XGRA 3EDJA 4GO6B 3OV6A 1IAOB 2XXMB 4F7TA 2DQFB 2HVKA 4RBPK 4E9LA 4KTDL 3L7EB 1Q94A 4IDLA 5DUBA 1RI8A 2Z91B 2KBGA 4L3EE 2L7UA 4J8RB 2AAVA 2XFXB 2ZCLL 5DWUH 2Q76A 2VXUH 3GDBA 1ZLVK 4G9DB 3H9SA 4LCYA 3LZFL 3CUPB 4PRBB 5EZIH 1TMCB 1S5HB 2H26A 4KRPB 3UBXB 5DMIH 3E6FB 4AH2B 3MRQB 5TPWH 3FRUB 1G7LA 2IPUG 1D6VH 2F5AH 2OI9C 3NA9H 4JHAL 4L29A 2NMSA 5F1NA 4NQTA 4QF1B 3ZMRA 1MCEA 4Z8FH 4ODVL 4OGAD 5J9PB 1H5BA 3GMRB 1OGAB 1X7QB 2P43B 3WHXA 5EU4B 1FYTD 3BT2L 1O5DT 4JY5H 1AD0A 1HHHB 4AIXA 3B3IB 4H1LA 1S7XB 1XGUA 1UM4L 2R4RL 4OQTA 4L8DB 3O9WB 3V4UL 1K5NB 5ADPH 5CJ8A 1SJEA 2PXYD 5K33A 5D8JH 3TPUA 1M7XA 4Y0GA 5F7WC 1P84J 1NMBL 2DQTH 2V7HA 3NVQA 1ZGLP 3M8OH 1MCNA 2CJUH 4Y2DD 2APWA 2RR3A 2C4FT 3QULA 4JFDE 3PIQB 4OM1H 5F1IB 3CFJA 5D2NC 3MRKB 4CMMB 4IS6A 3H3KA 2AQ3A 1E6JH 5EULV 3KPNA 5HJ3A 4I9WD 4PJGF 3K3QA 2ARJQ 4G8FB 4YHOL 3EYOB 3VXTA 2CLZA 5HI5D 4YEEA 1H3PL 3BPCB 1KCSH 1MWAA 4IOFC 5K9JL 1BD2D 3QIWC 1FLRL 1C7TA 1FGNH 3VXUA 2J5LC 4JFOA 2MJWA 3QHFH 4L5FL 4P5MB 4M6ML 2Z31C 2IPTL 4P2RA 4NQVA 3UROR 2BMKA 5JXEA 4IBLT 2HH0H 4ODTH 5CJXA 5DT1L 1W0VB 2O5ZH 1EHAA 2V5RA 1YEFH 2GUOA 3WN5A 5DD3H 3MLSH 3TH2T 1MNUH 2H32H 5DJXB 3L5WB 1NMAH 5KTEL 2CKBA 1U3JA 4XCEB 4JG0L 3PL6D 4XRCA 1JNLH 1CXKA 3NGBC 5DXWA 1RHHA 4NQCD 1FL6B 4KI5F 1CD9B 4NT6B 4X80H 3Q3GA 4N0UE 1B4RA 3EZJB 4J3OC 1MCBA 3BZFB 2HKFH 1MQKH 2DMBA 1D5IL 1LO0H 3HNTH 2VLJE 5L6YH 2HMID 5L2KE 3AS1A 4FQJH 4LHUB 4LDEB 2EICA 4WWID 3QDHA 5FOJA 4LIQH 1B9ZA 3BQUA 3UTTB 4K3EH 1A1MB 5BOZG 3QDAA 4NQEA