2APWA

Crystal structure of the g17e/a52v/s54n/k66e/e80v/l81s/t87s/g96v variant of the murine t cell receptor v beta 8.2 domain
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
109
structure length
109
Chain Sequence
AAVTQSPRNKVAVTGEKVTLSCQQTNNHNNMYWYRQDTGHGLRLIHYSYGVGNTEKGDIPDGYEASRPSQEQFSLILVSATPSQSSVYFCASGVGGTLYFGAGTRLSVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords T cell receptor beta chain V
publication title Structural basis of affinity maturation and intramolecular cooperativity in a protein-protein interaction.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 33
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 2005-08-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2apwA00
4FQCL 2J5LC 4TSAH 1CZ8H 5KVEH 5JW4Q 4JPWL 4EBQL 4UILH 3A67H 2ZKHH 3B9AA 2EO9A 2FDBP 2X42A 3U7YL 4GG6B 5IW1B 5D2LA 2W60B 3SKMB 2H32H 4NO0D 4LSDA 4RWYH 5DUBA 4PJ5B 3UPCA 5CJBA 1W8NA 1YJDH 3PL6D 4GMSH 4PJXF 2BVYA 4X99B 2DQJH 4WFED 2GAZA 5CGMA 2YD8A 5I15H 1F2XK 3MLPA 2A74B 3I6LD 4OQTA 2BSTB 4OZHE 2IH1B 3F7VA 2WM0A 1Z6JT 1EEQA 4OLXL 4QY8A 2VDMH 3GNMH 1NKRA 4Y19D 4D2NA 3OF6D 3VG0L 4M1CD 3MFFB 1Q0YL 3CMOL 3VCLA 2Z0BA 4P23C 3WFBL 4X80L 4DCQB 2XFXB 3OQ3B 2VMFA 4ZDHB 4QLRA 1IGTA 4YHOH 5D1ZB 2YD1A 2CMRH 1SMOA 1FHGA 2QQNH 2EH8H 3STZB 2B4CH 5F44A 4X6DA 4G6FD 3NTCL 2EO1A 1KTLA 1FAKT 4P2RB 1VENA 4JHAH 2RAMA 5F96L 3MV7A 4LSTL 1F02I 1JVKA 4OFVA 4TUJB 4CVZA 2VDQL 4I8DA 2I9LB 5ALCH 3OR6B 3BRDA 5J3HC 5KVMC 4HGWA 5ENWB 3NIFF 3TJHC 5T1LA 3U30B 1SY6A 2H2SD 4LLWA 2X4UB 4G80B 4HUWB 2DQEL 4HF5H 4PS4H 1BGXL 4RQQA 4ZPTA 2HT3C 4YR6A 3QJFA 5I2IA 3LAFA 4N0CC 5HJ3A 1YN7B 4NSKA 4NFCA 3O11B 5DYOB 1J0YA 3RWEA 2LE9A 3H7LA 4PJGA 3E8UL 4IOFC 4NRYA 1EA9C 4PJIF 4ZFOL 2VXQL 3RPIA 4EOWH 4GAJH 4NQCD 3VXOA 4CW1A 1OVZA 3RNQB 2Z8VC 1BIHA 4PTUA 3FQXA 4HLJA 1FNLA 4RISL 1T83C 1DQDL 3BN9C 2IPKB 4I48A 4C56D 3QUXC 3BSZL 2XXCB 5BJTA 4PJFE 5I19H 1KBGL 1LO0H 2CIKB 4X9IA 1MREL 3FMGL 2XI9A 2JKXA 4B7IA 4S11A 3RTQC 5TF1H 3QHFH 3MNZB 4U31A 1MVFA 1DQLL 3CK0H 3VXMB 3DRQA 2WBJA 1FNSL 4ZAKC 4XCEB 4XH2A 3D69A 5E8DH 5FA3A 2E9JA 5L2JB 2VZOA 1I3RA 3P4NB 3VXRA 4MDJB 4KJPC 5CILH 3BMWA 3DGGB 3VDBA 3ARFD 1XR8B 1GGBH 3T3MF 3K1KC 5F7KC 3ULSB 4HS3B 3TIEA 1CT8B 5GS1A 2EE6A 1G7QB 4MNGB 5E6YA 2CLRB 5FO9B 3CFJA 4PFEA 4PRHB 2VDNH 4M9OA 1GZPA 4DFIA 5LGKA 4JO3L 3S35H 1QR4A 3CIQA 4M61B 2L7UA 5F3HA 3SJVB 1T04B 3WNMA 4G8FA 1I8IB 4FMKA 4FZEH 1GC1C 4ZSOA 1REIA 3PWPB 4MHHG 2KH2B 1QSFA 4OQTL 1TETL 5ICYB 3EJZC 4FABH 4U0QB 1L7IL 3C08L 4MYWB 4PIRF 1AIFA 5KOMC 1TVBB 3MJ9H 5D7JB 4GW1A 2IWGA 1QRNB 1MLCB 2ZPKH 2R1WB 4LSPH 5JORB 4XNMB 1XGPB 4OBRA 1YC7A 4L5FL 2FSEA 4H88H 4OM0H 1NUGA 1G7PA 5A2JH 1A14L 2IANE 4UT7L 3NA9L 2YR3A 3C5JA 1FNEA 1WWBX 4G8IA 3MBED 3BEWA 3FFDB 5KSBE 1ZTXH 3CDFA 1QFUL 1LD9B 3O4LE 3TT1H 4N90E 5I1AA 3S8WA 4EVNB 5IVNA 1RK1B 3MFGB 1I9IH 3QO1A 5IQ9B 4F9LC 2BVUA 2VWEC 1J0ZA 3HE6C 3W11C 5CBEB 4NZUH 3NZ8A 5KVDL 2AXGA 3DUUB 1SY6L 1WGOA 3BISA 4IOIA 3DV4B 3FHQA 2APWA 3QCUL 3SGJA 1T0NB 3VFPB 1TZHA 1LEKB 5ITBL 3RGHA 1KN4H 1IC5L 3MRLB 2VDLH 4YZFE 4HD9A 5IB4B 4OLEA 4X0KB 4ZPVA 4C58B 1IEHA 4WGVB 4ZD3L 4U2YA 5F7MC 2R29L 4XPTL 1W0WA 2CDFB 2JELL 4P48A 4CVXB 4Z7OF 5ALBL 3DHJA 3LIZH 4RDQG 4FQHA 1NBVL 3ALWA 1WV7T 4FQ2L 1TZIB 4ORZC 3ET9F 3LV3A 4ZO6A 3HLAA 4ZUVA 3FL7A 4NGHH 2BNQD 5FO7A 2BFVL 4MMXC 15C8L 2J8UA 3V7MA 1T1WB 5IVOA 3TH4T 1L9MA 5CD5D 2ARJB 4O5LH 2YWYA 1P69B 3C5SB 4RGNB 3BDBA 4UTBH 3QIWC 4Y16A 1BQHA 1PKQA 3KGRA 4JZJA 1JRHI 2JIXA 3TNMA 4CKVX 1ZGLM 1B0RA 5GGVL 5I76B 4NUGH 4PRPD 2GUOA 2ZNWA 3T8XA 1KPVB 3CPLB 3QFJD 1KPRA 3OKKA 4HMDA 5DVKA 4LOUC 4PJAB 1T0PB 4MNQB 5DFWH 3NAAH 3PQYB 4UNTA 1WFOA 1NANH 4OLWL 4NO2A 1IVLA 3QDJD 1J5OH 4P46A 3SY0A 3G5VB 4XNUH 3CDGA 5D7IF 4P9HL 3ULVF 3FZUC 4QNPF 2Y23A 2AK4E 4P2OB 5MEPB 2YUXA 3EJYC 4M02A 2QQLH 4JRXA 1OB1B 2GK0A 3OKOB 4ZOBA 3VFOA 2EXYC 3U0WL 1KG0B 2PW2A 4WO4C 2Z92B 3OL2A 2CLZB 3RUGB 5MENB 1XEDA 1IKFL 1NBZA 3KYMB 4JRYE 1X9QA 5DEGB 4YGVA 2J6EH 3TBVA 1CXLA 4U1NB 1LO3H 1XGTB 1V3LA 5D1XB 1WZ1L 1A1NB 1NDMB 2DM3A 5EBLA 1NCBH 5C07B 1U8QB 3GSUA 3KPRB 1FJ1B 2MPAH 5DK2B 4TQEH 5T1DH 3R06B 4M6AA 3DIFA 3CFCH 4OGAD 3ARGD 3FRUA 5LGJA 3JBG7 3LDBC 4KZEL 5GSVB 1CICC 2NZ9C 2ZWLT 4TUOA 2QV2A 1PAMA 1FZJA 3QXAA 3BKYL 1RUAL 1BFVL 1PG7X 5MEQA 4YC2C 1QPPA 3I6KB 4FXKA 5FHAL 4C83B 4UDTA 1KN2H 1S9VA 4OZFH 3TP4A 3L3GA 1JRHL 3OAZK 1HKFA 1KGCE 1NAMA 2LV4A 3C9NB 1T2JA 4DVRH 4OZGE 1RUPL 3MACH 4X7DC 5DLML 4XPFL 4DN3H 1P4IH 2WIIB 4Y5VB 4LSVH 1CFNA 3KPSD 4UDUB 2ITCA 4GXVL 4GXUM 3KS0H 4AY0A 5SX5H 4NFBA 3K8LA 3L3OB 1U8OB 3ARDD 4KKBC 3VI4E 5EU5B 4NDMA 5SWSD 3ZTJH 3NPZB 2QHLA 4ZUSB 4JFOB 3E6HA 3ULUH 1EK3A 4N0YL 1OAUL 4JY5H 3TFKC 1YY9D 3LRGA 3SDDA 3B3IA 4X7TA 3KJ6L 1Q1JL 1YMMA 3OV6A 5FHBL 4MSWA 2YPLB 5E4EB 5A1AA 4P4KB 3I2CH 1CFSA 4Y1AA 4F3FB 4ZXBA 3UTSE 2IBZX 3LSOB 1UWXH 3FB8B 3CFBB 5GGSA 3LPGA 3FKUS 1JF1A 1T20A 3ROLA 1IAII 2AQ2A 1BQLH 4LHUG 1G7HB 3G6DH 4DGVH 2E27H 3KYKL 5TDNA 1ZV5A 4X6BA 3IJYA 4W4NA 1U8NB 4GAGL 3NCJH 2H2PC 5CP3H 5EBWB 1DANT 1R5WB 1I8KA 4HEME 3STLB 1HXYB 3GMRB 4J3VA 5GGQH 2FGWL 2RIKA 2EIEA 4HXBL 2I26N 3KR3L 1U8KA 4WEMB 2Q3AA 5T3ZH 2J3SA 1HHGB 1OWWA 1YEJL 2P7TB 1WIUA 1AR2A 1RUKL 4V1DD 5EA0L 4L9LA 2EYRA 4HUNB 1K4DB 1EHLH 5D2NB 3ARYA 5BS0D 3KPLB 4ENED 3D3VD 2PW1B 4BA8A 5IR1B 1CD0A 3KYOA 2EEAA 4YHKH 1OP5K 2BNRA 3MLRH 3LQMA 3RL1A 1G7IA 1ZLVK 2OP4L 2RFXB 5DFVC 2C7UB 4M1DH 4W4OA 2ZCLH 3JTTB 5DRWA 1MQKL 3I6GA 4NQDD 4XXCA 4Z7UE 5HYFA 1U8LA 3JWOH 2R4SH 3PWVB 4DKEL 4QRPD 1HOCB 1BEYL 5IHBA 4WCYL 2GTZA 1R3IH 5H35B 2FJGA 5EZLA 1J8HE 4KQ3H 4X5LA 4O58L 5SX5K 3BO8B 4JFEE 2PTTB 4KHXH 5L7XL 3PGFL 4Y4FB 5IVXB 1UB5B 1H8SA 2HH0H 1HSAA 3LKOA 1NSNH 2ZUQC 4MNHB 3ZE0F 3E6FB 3IDNA 3HC0A 5SWSB 2E8ZA 1EMTL 2ESVD 3F6IA 3C8KA 2K7PA 5IEHA 2FB4L 1IAIL 2D9QB 2F54B 4IJ3B 1T1ZB 1EFXA 3W9DB 2CLVA 1KNOA 1NAML 1IM9D 4MAYD 5DVOA 1D9KC 3LEXB 4XC3H 1FYHB 3UYOD 5FM5M 2ZSWB 1JNJA 3V2AR 4ELMA 5FYLE 5E2UH 1EX0A 1YQVL 4KRNA 5DD5H 2BRRH 4TNVK 5CKAA 4O51A 1URLA 1CBVH 1V7NH 3CLFL 2V5MA 3B2UC 1NGYB 4D0DA 1IKNC 2R0ZH 2ATKB 3AS2A 4HJJH 2VABB 3I02A 2DYPD 4HLZH 2YEZB 3BD3A 1QSED 3MC0A 5T33L 3C5ZC 4NRZB 1NCDH 5DD3L 5DJ8B 1U8HB 3VXSA 4APQD 3BESR 1HEZB 1WT5A 3W2DH 1AFVH 1G6RA 1CXKA 3EDFA 1DP0A 4LLVA 5F93C 4R0LA 2PXYB 4R6UA 4HZLB 1C12A 4MQ7B 1I7UA 4J6RH 3BP4B 1I7RB 4RZCA 4U1IB 4MX7B 1BD2E 4HFUL 3MLTA 2I07B 1WCBB 1SVZA 4LVNC 1YNLH 2CGRL 3F7PC 4XBEL 3WFZA 3KWWA 4NHCH 3V0VB 4TTGA 4X6CF 2VLRD 1KSRA 3BW9B 4F33A 3S88H 2LTQC 1LK2A 2FR4A 5AYUH 3TC9A 4QWWC 2HKFH 3HUJA 3O8XB 2X40A 5BZWB 1CDBA 3LN4A 4Q6IC 2GJ6E 2NMSA 1ZA3A 5C08A 3TPUB 1UZ8B 2OR9L 3VG9C 5CCKL 1A7PL 2ICWI 2XZQH 4GSDL 4RGMB 3VWKB 6FABH 4KMLB 3B4NA 3MGTB 2P8MA 2R1YB 3FFCA 1SJHA 1F6AB 5D1QD 5GS2D 4JM2B 2FX9H 4PRDB 12E8H 1JGUH 4H5SB 5KZCD 5MEOB 4FQXD 1CDGA 1TMCB 3DTXB 3M1BB 4TTDD 3DX7B 5EU7E 5IVXA 1MCCA 4LLMA 3ARRA 3I75A 5ISZA 1EVTC 4ODHL 2NTFB 4G8GE 1I1YB 1R3JA 4OTXL 2CJUL 3SGDH 3MJGX 4GW4B 2ZUVA 3TVMD 5JO5A 1EGJA 4I0CC 3VMOA 5E2TH 3QQ4A 1FV1B 4LSRH 3V9FA 2VQUA 3WMSA 1NEZA 4U1GC 2H6PA 3GI9H 4DKFH 1XGRB 3VI3F 1AGCA 2AABH 4KMTH 5IV2B 2D03H 1RJZB 3RDTA 2COQA 4LNVA 4XP9L 5CJXA 1EHXA 4P2QB 1P1ZB 5M94B 1I9RL 3QWRD 4N0UB 1KCRH 2BSSA 4Q74A 1OAZL 4FQ1H 3DO3A 3JVGA 3WUWA 2VRAA 1C08B 1XR9A 1TJGH 3UO1H 4JPIA 1E4XI 3KPPA 1SQ2N 4UB0H 1MY5A 1QZ1A 1AI1L 3CFEA 2ICCA 5DRNB 1UKTA 1VACB 1F4XL 3D0VA 3KNBA 5A16B 1FSKB 5IMLB 3VW3L 5ANMB 4ODSL 4XPBH 3N06B 1JMXA 3C60C 5LQBH 4LQFL 5DVNA 2X89A 4PRBA 1MJUL 4ORGB 5D7LA 1GGCH 2E7MA 4TUKH 4NO3B 1JHKL 4NQEE 4UUJB 1A0QH 5I1HH 4HH9A 5I8EA 1Y6MR 2C1PB 2BC4A 3TO4B 4GBXD 3X11A 2IAMC 1DCLA 1G6RL 2R2HA 3I9GH 2VH5H 3MRCB 3K74B 3HI5H 2VQTA 1AJ7H 2Y6SD 3RL2A 25C8L 3H9SA 5J13C 2ADIB 1XT5A 3AC0A 3BI9X 4NKIL 4KJYA 1YEIL 5CBAA 1YQ2A 2W9EL 1X5LA 1CL7I 3O6ML 5JHLH 1J18A 1PDKA 2DDQL 1GPOL 2FL5A 3QIBA 5KW9H 1EUTA 4I3RL 1H3XA 4XGZB 4NKOB 2DLFH 2AJ3A 4KI5D 4M93B 3UYPA 4M5YL 3CSBA 2XZAL 3FT2B 3WIHA 2FX8L 4LHUB 2NR6C 4ZFOB 3OKNA 3MV7D 3DUSA 4ISVA 1OGAB 4PRIA 3MSPA 4ZG1A 5B38G 4N0FA 4YX2H 5JW5A 4KXZI 4PJDE 1FVCB 5E8NA 2QQKH 3R0NA 2EXWC 3VFWA 4DWHA 4MD5A 3ZDXF 5FUZH 4PJXB 1HYSD 4K9EH 1JI1A 4MAUL 1BQHG 1NUNB 1N64H 3S9DB 5D7KE 1OSZB 1GVIA 2OTPA 4R7DB 1F4HA 2AJVH 1QP1A 3OMZA 1V3MA 4HIJA 4O2EB 1N8ZA 2Z9TA 3K2UH 3MGOA 2B2XH 2FWOB 4MA7L 1MCKA 2NY4B 4OGZA 5LAXB 1BBJA 1MRCH 4AZ8A 1EGJL 3PJSA 4OD2B 5I9QC 4AG4H 4RNRB 4DGIL 1FG2B 3G5YB 4GQ9H 2WLYA 2OTUA 4QHLB 3FO0L 4PP1D 1MF2H 3LOWA 3CMGA 2NX5A 5D2LB 4U6VL 4G6JL 4PJ7A 3D2UA 2DMBA 2WBJD 1WWWX 2JJTC 4UIKH 5EOQH 2IFFL 3CDYA 3BN3B 5ACZB 1L9NA 2GK2A 4G5ZL 3MXVL 3G6AA 1KB5A 3EOTL 4BUHA 1CL7L 4L4VD 3D5OF 4EI5B 2EH7H 4NKDA 5HDBE 4MWFA 3A6OA 4I77L 3N9GH 1I9EA 1WISA 3QI9B 4U1KA 4LSUL 1KOAA 1S7XA 1S5IL 3FB7A 4PJ9D 4XCFH 4U1MB 2RHEA 1I9JL 3MO1A 5FIEA 2MKWA 3SDAC 3HNSH 4QF1A 1MJ7H 3QUKA 4PJIB 1IGTB 5JIKA 1DZBA 1QR1A 3D48R 4NC1E 1QFWL 3HI6L 1GXEA 3O6LL 2XQBL 4HUKB 2BHUA 2C4XA 2GT9B 4YFLI 3VXQA 4OZHA 1KEGL 5K59F 4I5BA 4I18C 3IDJA 4WV1C 3MYJB 4MA3A 5B3JF 4NZTH 1FL3B 5CJQL 2X09A 1RULL 3LB6C 4HGWB 1HNGA 1FDLL 1G7MA 2XTJE 5T1LB 5TDOA 1I7ZB 3DV6B 3ES6B 3KPMB 1WAAA 1H3GA 4K3DH 4RQQB 5I2IB 3FO1B 1IGML 3IAGC 5BCAA 1GOHA 3RHWK 5HJ3B 3WEXA 1Z2KA 1A7RH 3MYZA 4QHKJ 2EYTB 3V4UH 1MCFA 4NRYB 5ILTL 3WIHL 4WY7L 5GRWA 2D2OA 3RPIB 1A9BB 5T3XH 2VXUL 5ERWA 4JVWA 3CZFA 4FP8H 4WFHE 4JKPH 3F58L 3FB6A 3OB8A 4JHWL 5D6DA 4AT6A 4HZAA 4K7FB 3QXWA 4IDJH 4UV7L 5DK0B 1MFBL 3FHAA 3BD4A 1JPTL 1KELH 4UBDC 2BVQA 1RUQL 5HGAA 3U36B 3AY4C 3DSFH 1AO7D 3F7YB 2F74B 3DX6A 1T1YB 2KQMA 1AGFB 4FQLH 4XI5C 5IUSA 3D69B 1UM5H 3DOSA 3HG1B 4XC1L 3T2NL 4F58L 4FNLH 3VXRB 4HKBB 3DMMC 4U6HA 1O7SA 3E2HC 1E27B 4RGNC 5LGHH 2AEPL 3X13A 5CJ5A 1H3PH 1SM3H 3MRKA 1B0WA 3TIEB 3ZDZE 5GS1B 4PJFA 1N4XH 2IBGA 4FG6D 2O61A 4BYHA 3EGSB 4X6EA 3PWNB 4XVUC 1D5ZA 1S7SA 4FTVE 3SGEH 4G43A 1I1AA 3DETC 3RIFK 2ZUUA 2VZVA 1NMCC 3GMNA 4GKSB 1IC1A 1G9MH 4CVUA 4K2UH 4A2LA 4Y16D 1DUZA 4ZSOB 3D9AL 3WBDA 1KB5L 5L2KB 2H8PB 2YMXH 1QSFB 1AIFB 3W0WB 1P5VA 5JUEH 2OXHA 4PRAA 3PGCA 1VEPA 3REVB 4GW1B 1P7QD 3MV9E 4OZ4A 5EOCJ 1QLFB 4WGWB 2PTUA 2FSEB 4Y4HC 1HHJA 2NY5C 4P46D 5EIQA 3VXUE 4D3CL 5B4MD 3B9KC 3UJTL 3C5JB 3UEZA 1RZJL 4CGTA 2VKXA 4G8IB 2Y7QB 3QIUA 4LARL 3H0TA 4JRXD 3OR7A 4HHAA 1CE1L 5E70A 2WIMA 1T0MA 2AJXH 1RIHH 2V17L 3QO1B 5DGRA 3RVUD 2DN7A 2D7QA 2XY2A 1DLHB 1SEBB 3QEGH 4GKNB 3DNKA 4JY4A 3NZ8B 4MA1C 2HJKB 2AXGB 2HLAA 2IANA 4Z7QF 5GGVY 5IBTL 5EDXA 4DJMA 5FB8A 3WFEL 3SE3A 2YD9A 3GEWB 3IDGA 3KXFE 2EKJA 3WS3A 3O4LA 3JUYA 5D93B 4KUCF 4WRLA 3OHXA 3HZVA 4JKLA 5DS8A 2AGJH 4R90H 3S36L 4OSUH 2ICEB 5D71L 1PZ5B 1W0WB 3FO9B 5I66B 1CN4A 3F5WB 1DBAH 4KZDL 4R96A 5D7IB 1BX2B 3FB5A 4G7YH 3RGVA 3ZKND 1J86A 2V5RA 5IB5B 5E5MA 4Y4KB 5LG1A 5C09B 1TFHA 4M7KH 4BQ6A 1XZ0B 1LE9B 1ZHBA 4NZRH 3BQUA 5DTFB 5B38B 1BVZA 3BDXA 3ULUE 1SYSA 3GKWH 1FORL 5DD0L 4OUUB 3R8BB 3TBTB 1TQBC 1UEMA 1ADQA 1M71B 2MCG1 1B0GA 3LZFH 1JTPA 5JLZA 1BQHB 1PKQB 4XPGL 4K23L 2JIXB 4FQCH 4MB4A 3SHSA 2LQRA 5KJRH 3H2WA 3T8XB 2PYEA 1KPRB 4GUPA 4TPRH 3RY6A 1B90A 1R0AH 3WNKA 3TCLA 1OAXL 1UJ3C 1ZS8A 1F3JB 1PEWA 3MRDB 5HI4C 3AREA 4HMEA 4AIZA 5E0QA 4NO2B 1YMMD 2EC8A 35C8H 3U79A 5CUSL 3EO1B 4OCSL 4Y1AD 1J0IA 4GG6E 3UJIL 1HINL 2BP3A 4UINL 3CDGB 2Y36L 4MQTB 4PLKD 4X4XA 3TO2A 4BELD 1MHPL 3PDOB 5DMGD 3BWUC 1TVHB 1S7WA 2A0LC 4OFPA 5EO0A 5T3ZE 5DUMH 2EYSA 3SE8L 2I5YL 1HXMA 3GJEB 3VG0H 3LVEA 3ZE2F 3EOBA 1CQKA 4DN4L 3CMOH 4XVTL 4X80H 1JGVH 2DQGL 3MRHA 5D96B 4H26A 3JV4B 3S96A 1RJLB 4MJIA 3K4AA 1P6FA 2V5TA 3W9EA 4J3UA 2CR3A 1ZWIA 4L8BA 5IMMA 5EPMA 5C2BH 1BECA 3HE7D 3DYPA 5C0BD 1AD0A 3QZWG 2N56A 3NTCH 5EBLB 3VFTB 3OKEA 4QRUB 5DMYA 5F96H 2FO1A 2VDQH 2VDOL 3WUWG 3C09B 3OXSB 3QPXL 3RP1A 1WICA 4QO1A 2QJDA 4FQJL 4P2RE 2BNRD 1VFAA 3QG7L 1EAPA 3MLXL 1CVSC 4XNZC 5FYKL 5HVWA 1JBJA 3QXAB 2BVOA 2DQEH 3RVVD 3JZ7A 5HHXL 2IPUK 4F7MA 1MPAH 2VKWA 1B4JH 4JG1L 3P11L 1INEL 1U36A 3GJFA 4E41E 2IH3B 2NXZD 1FH5L 1YEDB 4X4ZA 5CSZA 4ZS6C 1IMHC 3BGAA 1JPFB 3GMMA 1N59B 1QSVA 3IRZA 1CTOA 1GIGL 1U2HA 1DTUA 2BVEA 3AXLB 4DZBA 2ITCB 1DEEB 1JGLL 2FH6A 2JB6B 1AR1D 3C6LA 2WWMD 4KDWA 4RISH 2DQTL 2BCKB 3OJDB 2MHAB 5C6TL 1UZ6E 4RAHA 3BSZH 5DQDL 4NDMB 5DEZA 3Q3GA 1KBGH 3FMGH 3HI1B 2Q76A 4F15B 5EWIL 4BQ8A 1HQRB 1JPSL 1VESA 4FFWC 3TT3L 2EDFA 2W0KA 2CUHA 1EFXD 3BPLC 3SKNA 1R6VA 4XP1L 3SDDB 4OZGA 3GB7B 5D9SB 2XZCL 4K3GA 4KKAD 4CDGC 3U1SH 2DQIL 3S35X 2WUBL 4ZXBB 1WF5A 4RGOL 1H15A 1T22A 1DJSA 4P0DA 4FXLA 2R8SL 1U8IA 1A7NL 1ADQL 2MQ0A 2GY5A 3MCLH 4GRLC 2JB5H 1CDHA 4UI2A 4WFEE 4OKVB 1EEZA 5TDNB 2DL9A 2VIRB 5EU4B 3VDAA 1R3LA 4RMWA 4F7PA 4YHLL 2EE3A 2N1KA 4IRSA 1MCNA 4WI5A 2WANA 1KV3A 3VXSD 3DO7A 1INQA 2GSIA 4F57L 1F45A 4Q9RL 1MEXH 4LNRA 3UTSA 4D8PA 5I1IL 3SDXF 1LO2L 4HBQA 4L9LB 2EYRB 3H42H 2DLEA 2ADGB 3OBAA 4G9DB 1H0DB 1TETH 5KS9F 5L8KB 3RVTD 2JF1A 1L7IH 5F9JA 3SJVE 4M7LL 1UVQA 1U41A 1S7TB 4WUKL 3WFDL 4JQXC 1IBGH 2VOTA 4BSWA 1V3JA 1DBKL 1X5FA 3PWPE 5A40E 2Q7NA 5HDQL 3RL1B 2R2EB 4LRIC 5F7LB 4TULH 3TCXA 3QUYA 1A14H 5DRWB 5IM7B 2ZJSL 3UBXA 3BH8A 4D0CA 1QRNE 1U8LB 4HS6A 1FL5A 3NA9H 5FYJL 2IALA 2OM5A 1G9EA 1VFMA 4OCYL 5JOEA 1JTOA 1XCTA 3OX8A 1CLZL 4I9WD 4MXQD 5I6XC 4QRSA 3H3PH 3T0EC 4KUZL 1XIWA 2V2XA 2OL3A 1II4E 1HSAB 1BVKA 5CSGA 3O9WA 4HKZA 4GRWF 3ALXA 2I9TA 1SY6H 2QADC 3IDNB 5JDSA 4ZOAA 5GGSY 4ZUWB 3Q6GL 3S37L 2G2RA 1UENA 4Z7UA 2D0GA 1MWAA 4UTAH 1OW0C 3QCUH 4MCZA 4M8QB 4U6YA 3BPOB 4PV8A 4M6ML 3L6FA 2YPKB 3WIFB 3LS4L 4NQXA 3F12A 1N0XL 3CDCA 4XXDA 1J8HA 2PUQT 4KVCL 4X7EC 4JFEA 4XRCB 4POYA 2DF3A 5IESL 2FO4A 1F13A 4YDIH 4KJWC 3UBXI 3RDTD 5FUOL 4CN6A 2FRGP 5C0EA 1BZ9A 3ZKSD 1R5VB 4FQ2H 2Z4QB 5AG8A 5I8CA 1EHNA 4R2GB 3TYGL 2YRLA 4L8CB 2JK5A 1KF9B 1EBAA 5CINL 4ZS7H 5C9JA 1G6RB 3DECA 2A83A 4KTYA 4LLVB 4NJAL 4NQTA 1CLYL 4W6YB 3WUZA 5BW7A 5HHNB 4JFHE 3ARBC 2EE2A 1G7JB 1JZ7A 1BMGA 4X7CC 1MFEL 3G9VA 2X89D 2VXSL 2NY3C 3IJHA 4FFYL 5D7LD 4HUXA 3D18B 4ZQKA 3QDGA 3V7AG 2DJSA 4XP6H 4NNYA 1DQML 4K3JH 3WN5A 2MFNA 1OAQL 3HUJB 4OLWH 1SYVA 1WQVT 1A6AA 5HHPA 4Z76A 3RTQA 2YSSB 3I3BA 4PJAE 5C08B 3D0LA 5HY9A 5CIPA 2X6MA 5J11C 3PV6B 3CH8A 1JF6A 3U2SA 3FFCB 1IEBA 3H9SD 2XA8L 2XWBB 2YZ1A 3GK8L 5E8OA 1BD2A 5DZOA 3HPJA 4HFWB 4NPYA 2OI9B 2YRZA 3U0PB 3WL9B 3QJHA 1S7UB 5TF0A 3MLWH 1IKFH 3OKYA 1F11B 3QIBD 2NQCA 3MRBA 4U1LB 4LLMB 1H3VA 1T7VA 2Y4SA 2GJ6A 3WS6C 1HZHL 5ISZB 1A2YB 3RUGE 5JXAH 1DBBL 1D5MA 1R3JB 1R3HA 4L8DB 2XN9D 3WFHB 5A2KH 3NIGE 5F3BA 4JDZA 4OD1H 4PRID 5C0NC 1ZSDB 4HUVA 2KZ1B 2H6PB 2AV7B 2X1WL 5C07E 3KPRE 4ELKA 4F80A 4DEPC 1EAJA 3NVQA 2OL3L 4LCWB 3QZWB 2EIDA 1BFVH 4MCYA 3GMLB 4YEFA 5GPRA 3UPRA 2AAVA 4G8GA 4WHYG 2HJLA 2XT1B 4N9GA 5D7SH 1MWAL 3WUWB 1XR9B 2X1XR 3C2AH 4OB5L 4PG2C 1D5XA 1X5XA 4JPIB 4OGXL 2H1PH 5DJ2A 4C4KO 3KPPB 3MNVA 4JKWA 1HHKA 1DDHB 1S9YB 4GXVH 3P4OB 4JPVH 3D0VB 4NC1C 4OIIL 3KNBB 1ZEAH 2VL5B 1A5FL 1A6PA 1FE8L 1E6JL 3QCTL 3V95A 2YPVL 4Z5RB 3IDIB 1I1FB 2AK1L 2NX5D 5H8DA 3WLBA 4A6YB 1RI8A 4F9LA 1H9VA 3QBTB 4POZD 3D2UD 4H0IA 3R4DA 2F53A 1OAUH 4OIAA 4YDKH 4K8RH 5GRVK 3ZYIA 3FO2A 3Q48A 1CIDA 4KC3B 2H32A 4KJQD 5I8EB 5SX4H 2R56H 4TVSa 2YKLL 3B2VL 1K8DB 1IEAA 1QA9B 2D0FA 3QUZB 2ICWJ 3OKMA 2BDNH 4XNXL 1DN0A 3SO3C 1VSCA 2XRAL 2UV3A 3PWLB 1P5UA 2YPLE 3QDJE 4W70A 5FYLL 1Q9OB 3SQBA 4WI8A 5JOFB 2K1MA 4UQ3A 2Z31A 4I13B 2P46B 1A6VL 4WU5A 1S9XA 4U3XA 4U7MA 2WINB 4KJYB 3HC3L 4GAGH 3TYFB 4PG9A 4KKLD 2FL5B 2BMKB 3I85A 1BVLB 3IFPA 4HEPG 3FONA 3UTTA 3SDCB 2FJHA 2AJ3B 2W07A 2P24B 4XBPA 1YEJH 3LD8C 3AMLA 1OP3K 4LGSB 4BUGA 1MUJA 3PP3H 4HGMA 4MJ5A 5DJZA 4FS0A 3DUSB 3V8CA 2AEIT 1PZUB 3WDIA 2P49B 4UT6L 5C86A 4NFDA 4PGBB 1B2WH 3N85H 1CDJA 5T3XE 3SKOB 4LBEA 5DRXA 4FMFA 2A6IB 4XCYA 5I1GL 3GBNL 3WXVL 4BQBA 2OP4H 4YDVA 5D2NE 3JV6B 4JO2H 1EZVY 2NY6C 5FV2A 3HR6A 4M6OL 3QPQC 1KJMA 4HIJB 5HXMA 4X5XA 5E99H 1GGTA 5GS0H 4DKEH 2EDKA 1DVFC 3MV8B 3MZTA 4QRQB 4AH2B 1ORQA 2W1NA 4WTZA 4P57B 1BBJB 3QQ3A 4WUUB 5HGBA 5L7XH 3RNKA 4PJDA 3U9PL 1QRKA 4PJEA 1NQBA 5IF0B 5DDHA 5C0RH 1FVDB 1G9NL 1QSZA 3W81A 5C0DA 5GZOD 5DA0B 5IVXE 4YEEA 1BHGA 5E24E 3SE9L 2HWZL 3EYQD 1VFOA 1RHHB 3FOLA 2FB4H 2DKUA 4PBWD 4X4YA 4K7PL 1AHWC 4OI7A 5SWSE 4YHYB 1NC4A 1BBDH 5IMKA 4JQVC 1QYGL 4M3KB 2VLLA 2F54E 3EDEA 4QTHA 4YBLB 2L7JA 1YQVH 4PJBF 1BOGB 1FVEB 3NACH 1BF2A 2NY7L 1AKJB 3BKML 5D72L 4P5MB 1T5XB 1VGKA 3FB7B 3AGVA 1OOAA 8FABA 3IETB 3WKNA 1CICA 2CKBA 1KCUL 5CJ8A 3MRJA 4LFHG 3QUKB 4U1JB 5T33H 1JYNA 1I1AD 1S7QA 3C8DA 4AQOA 1HH6A 4UILL 3A67L 5KN5B 4EN3A 1Q9WA 3GSOA 3PP3K 3C6SA 4WI3A 4NQVA 4JHZA 2XKUA 3ROOB 3HPLA 1YJDL 4BFIB 2LU7A 3TZVD 1S7VA 1YC8A 1S78D 3LKNB 4BZ2H 3L7FA 3VFUB 4MA3B 5I15L 2CK0L 1QFOA 5KSAA 2OSLA 4HFUH 1O0VA 2CGRH 4S1SH 4XBEH 3VXNA 1G7MB 2VDML 5C0CB 5ETUB 5GHWL 4M7ZC 3MJ9A 5HGGS 1YN6B 1WBZA 4PJCA 3T0AA 4I0PC 4LCIL 4ALAH 5J9PB 5CCKH 3GMOB 4YHOL 2HT4D 1ZK9A 3P9WB 3QIUD 2CMRL 1K6QL 2QQNL 4AEIH 1MHCA 2IMMA 2B4CL 3CFKB 3KLSA 4JY6A 3CZFB 5F9WC 5FYKD 5DA4A 1TENA 1ZGLA 2OZ4H 4M4RA 5DJXB 2APTA 5E2WH 3RKDC 4AT6B 5DC4B 3MV11 4M9PA 5GGRA 2IAND 3ULVC 4YBQD 4ODHH 4DUWA 4YDJA 5HGAB 3Q5TA 1N7ML 3SN6N 4HF5L 5I74B 2GITA 5C0JB 3QNZB 3O4LD 3MRGB 4OCXH 5CEXA 4JPKH 4N90D 4U6HB 3TN0A 3GM0A 5JW4N 4JB9L 2V6HA 3GRWH 1T89C 5D5MF 2I24N 1NGXB 1ED3B 2JCCF 4UU9B 4YXKL 1Q9LA 4R4FL 2X4SB 2CUMA 4GAJL 1PEZA 3F6LA 5EUOF 2O61B 3IB4A 3DXAB 3RGVD 3MA7A 3BHBB 3MQIA 3MRFA 1JL8A 3T0BA 5HSFA 2IBZY 3TF7C 1DUYA 3S5LA 3O6FD 4ZFFA 5F7UA 4G43B 4WW2A 3BQUD 2X4TB 4MVBD 1Z9MA 2NY0D 5I19L 1HNFA 1LO0L 5IP4A 4P2QE 3RZCC 1RZFH 4N0UE 2J88L 5HYQB 3TNNA 1RV6X 3ZT7A 5TF1L 3QHFL 1EHAA 3TV3L 1DUZB 1QSEE 2CD0A 3CK0L 4ZTPH 2DM2A 1LEGB 3RIAK 1AGDA 3VW3H 1MAMH 5E8DL 4ODSH 1XF4A 4JDTH 3FAWA 3TIDB 3PABB 3T2PA 3TA3C 1HILA 5CILL 2PYED 4L8SB 1V5JA 3BOVA 5BV7B 4PJHF 1GGBL 4YHPB 4NKMB 4OZ4B 1JHKH 4WFGE 5ANME 4U3HA 3VGDA 2CKBL 4BZYA 4FTVA 4O00A 3ZE1F 3ARED 1WC7A 4P5TB 4HIIA 4XP5L 3JWDH 4K94C 3WNNA 1A3LH 2OJEB 4KTEL 4QCIB 4PGCA 2CRIA 1T1XA 3AB0B 4G9FA 1G6RH 1EPFA 3CC5A 2GJZA 2NYYD 3VWJD 2NY2B 5HYSG 1D9KA 1T0MB 4L4TB 4FZEL 1TVDA 1H8NA 1WVZA 2XXMB 4MJID 1ZA6A 2W9EH 3LRSA 5FKAA 3MV9A 1JGDB 2AJZB 2BHZA 1GPOH 3OXRB 4PTTA 1IKNA 1S8DA 3UP1A 3MJ9L 3VXUA 5K9KB 4EDXA 1UWEL 4E5XA 1A22B 4YAQA 3MTRA 2ZPKL 4FA8A 4RIRA 5FB8B 3RFZC 4M43L 1PX4A 2XZAH 1C16B 2AK4D 2J6EA 5JR1L 4OV6F 4OM0L 3LKPA 3MPCA 2RGSA 2PO6C 4MQXC 2ADFH 3ESVF 5EU6A 3HZVB 2X4OB 2UWEF 1OQOA 5FO8A 3VFGL 3WXWL 3QWOA 3QNXA 1ZTXL 3AUVA 4JRYD 2GSGB 3G6JA 1NANI 3TT1L 1OGAE 1E4KC 1U95A 3LEVL 2NY1D 5DT1L 4N8VA 1Y0LA 4HULB 1A1OA 3DSNA 3PL6C 3RGVB 3UTPE 4MXVF 3HZMA 3MR9A 4PJXE 4NZUL 3X3GH 1Q8MA 3KXFA 3T3PF 3D39A 1NGZA 1ZLUK 2ADJB 4Q6IA 4OZFA 4YIQA 4RFEB 3QNYA 4M1CC 1NC2A 1EGJH 1WWAX 3C6LD 3IF1B 1KN4L 2VDLL 3FO0H 5AG9A 4GUPB 1U3HD 3OB0H 5DMIH 1ZLSL 5JXED 5C0AA 4IIQC 1ZS8B 2Q86B 3VXPA 3T04D 1KGCD 1IAMA 5T5FL 4AIZB 5EC2B 2IQAB 4R97B 4KH2A 5D2LE 3ZKMD 4LCCB 3ZYOA 2Y25A 3IFLH 1VFBA 4CMHC 3FQUA 4JLRB 1S7WB 3GHBL 4I77H 4WU7A 4LMQE 3SCMA 4U1HA 3L5IA 4FXGA 3BRGC 1YECH 2H2SC 4O5LL 3NIFE 3TM6A 3CH1B 1YUHA 4YFLF 2BVPB 4EUPG 4A6YH 4IRSD 3W9EB 1UH4A 3LQAC 1A47A 1WZKA 5CP3A 3BZ4B 1ACZA 2UVEA 4HPYL 7FABH 5J6HB 1QFWH 5FGSA 5IW1A 3VFRB 3HI6H 4I4WB 1PY4A 4Z7WF 3UTSD 2XQBH 3SKMA 4PJ5A 4PJIE 1C5DA 3NAAL 5IIEB 5EULV 2NW2B 2BY0A 4OT1H 5DQ9B 3GZKA 2WP3O 4XNUL 4WI2A 4KI5E 3QYCA 1CG9B 3BYTA 2BSTA 3ME0A 2C3GA 2IH1A 3EUUA 4NM4H 1EAPB 5I1DA 1G1YA 5BOZG 3DRTB 3MFFA 1SMAA 3QUYD 3Q1SL 1W0YT 4XNYL 4ZDHA 3G5ZB 5D1ZA 3ARFC 4XHJD 3LN5B 2D4DA 5CSZB 2J6EL 3OGOE 5FKPB 3EKCA 4TVPL 3RWCB 1LO3L 2LVEA 4JFXA 5J8OA 2VXUH 1XIWD 1Q72H 3T3ME 1MI5B 3L3HA 4Z95H 2MPAL 3O9WD 4TQEL 4CL7A 1IGYB 3SE4C 2G9HB 3QUML 4TUJA 2V7HB 3I50H 3P30H 5DSCB 2I9LA 3IJSB 1MFBH 2O5YH 3ILQD 1JPTH 5ENWA 3SDXB 1I8MB 1KLGA 5K9OB 4WVRA 1NUFA 3I3DA 5KS9B 3MLVH 2X4UA 4G80A 1G1CA 1DE4B 1HN1A 1WFUA 1MSPA 1J8HD 2E7HA 4XC1H 3SBWC 3T2NH 4F58H 4JFED 1KN2L 5DYOA 3OWEA 4N9OB 3TBSB 1U8IB 4IRZH 2UYLB 3BRFA 3MACL 1CGUA 2FBOJ 1J05B 4J8RB 2X4PB 1SEQL 3HG1E 3VXRE 4JM4L 2CO7B 3RJDA 1PJ9A 1A64A 2WWKO 5E94A 5F9OH 4J1UA 1WZMA 1FFOA 2QBWA 1ZANH 3CVIL 1PQZB 5DJYB 5TPWL 1D5IH 1NLBH 2IC2A 2IPKA 1NCTA 2CDEB 4S1DD 3CCHB 2CIKA 2XG5A 4LPCA 3MBEC 1HK6A 4IRJD 5GISH 4MLSA 5M95B 4B50A 1X4YA 3MNZA 3VXMA 2FATL 5FYLD 1T21B 5MI0C 3D9AH 4HH8A 1P53A 4XCEA 4GRWB 4PLOB 4G8EB 5SWZB 3O2WH 1TXKA 1T2QH 5L2JA 3QDMB 3P4NA 1UVQB 3FCTB 4MDJA 1UCTA 3VDCA 4ZSOE 3MRPB 3DGGA 1HSBA 3U4EB 5J06A 3QDGD 5L2KE 1U3ZA 4HPOL 1QSFE 3EYOB 1BQLL 2J5LB 3ULSA 2C3WA 3QSKB 1CT8A 3KYAA 2DQFB 4QXGH 3KPOB 3IXAB 4MNGA 2CLRA 3BH9B 4HS6B 3VD4A 4PRHA 1PG7W 2F19H 1W8OA 2IALB 2JJTA 1HWGB 5E8EB 1XCTB 4PB0L 3KG5A 4M61A 4QXTB 1QVOA 3SJVA 1CE1H 1T04A 1BD2D 1I8IA 4P5KB 2V17H 3PWPA 1QHOA 3WDHA 2HLFC 5ICYA 4XWOD 2X7LB 4HAFA 2GI7A 2F58H 4P23B 2CDGA 1H3WM 2GJ6D 1TVBA 5B8CC 5JDSB 5D7JA 5INCB 3SDAA 4YHKL 5IBTH 1W0VB 1QRNA 1MWAB 1MLCA 2R1WA 5CD5C 1IFHH 3DGCR 4XNMA 5JORA 3WFEH 4PV8B 5HYSB 1AXTH 3AM8C 3L6FB 3V5DA 4IEFB 4M1DL 2FECL 3DJ9A 2VC2L 4XXDB 4NWUL 5ADOH 3Q5OA 3JWOL 3S36H 2R4SL 5D71H 3NZHH 1GAFH 1QBLH 4MS8D 3FFDA 1W72A 1AP2B 5EOTB 1LD9A 2CH8A 4PGEB 4H1LA 4EVNA 3U7WH 4O02L 4JFYA 5IQ9A 5CLWA 4G8GD 3K8KA 4P59L 4BH7B 5TGBA 2NPLX 5CBEA 2J1KA 4ETQB 1VGEH 2EKSB 5D7IE 2P5WB 2X70A 3DUUA 5DC0A 5EU3B 4QNPE 1FORH 5DD0H 3DV4A 4L3CB 3ARWA 4KHTL 5E1AA 5IFAL 5KSBF 5C09E 2A83B 1T0NA 3VFPA 2Y5EA 5IQ7L 4Y5YC 1NFDF 2HRPL 4NM8L 3MRLA 4LIQL 5IB4A 4HG4K 4X0KA 3IS1X 4HK0A 3IJHB 4OJFH 2A77H 3KAAA 1M7IB 5E2UL 1RPQA 1PKQE 5DD5L 5JHDB 2BRRL 3ZHKA 4NNYB 1OAXH 2NXYD 2CDFA 3SGDI 1CBVL 3QUXB 3MJ6A 4EI6A 3VFVB 4HJJL 5CUSH 2DLGA 5FXCH 4UOJA 1TZIA 5HHPB 1ZXQA 4Z76B 1ZHNB 3RTQB 5IW6B 4LPUA 5SV3A 4OGAC 4XBGA 3ARGC 1OL0A 4ZAKB 3QHTC 1T1WA 1BF8A 3MRRB 2Z31D 2EZ0D 1FLRL 3IFOA 3DMMA 5E8OB 2ARJA 4DN4H 4CVWA 1AFVL 4XVTH 3C5SA 4NPYB 4EDWH 1YEGH 2VL4A 4WHYH 3MOAH 3SGKC 4B5EA 5BV7H 5GJTL 4NQED 4J6RL 4JRXE 5I76A 4CU6A 3UTTD 1NMAL 4OCLC 2ED7A 4JFZH 4UAOC 1R3HB 4MNQA 1P4BH 3PQYA 4Y5XC 2HKFL 4OAWB 2QEJA 5F3BB 4JDZB 3V6ZB 2AKRB 3ARDC 2HFFB 3RQ3A 2VDOH 4EUPB 3O3EB 3QPXH 5E1HB 2XZQL 1T3FA 1MFAH 4FQJH 6FABL 3L5XL 3FQRB 4P2OA 5MEPA 3MLXH 2WUCL 3RU8L 4PB9L 3IFNH 1OB1A 3OKOA 5FYKH 4ZYKB 1IQWH 1IILE 2ZUYA 4MCYB 3ARTA 2E7LA 1YY9C 4KRPD 2Z92A 2FX9L 3L5WA 2CLZA 4CBPA 1MCWW 3RUGA 12E8L 1JGUL 2LAAA 5MENA 3GIVA 2VO5A 3KYMA 4KK6C 4N9GB 4NN7C 1FH5H 1UXWB 5EUKB 5DEGA 1LWRA 2CPCA 2JJSC 5TE6L 5FUCC 4U1SB 5E6IB 3QT2A 4U1NA 1XGTA 1Z5LA 2ERJC 5J4MA 1JWMB 4XAKE 1S9KC 2YD7A 5D1XA 1JGLH 1A1NA 1NDMA 2J8OA 2E5EA 3KPRA 1FJ1A 2CUIA 2DQTH 5HBBA 5E9DB 4AJ0A 1YEEH 3UZEA 5DK2A 1MJJA 5C6TH 3R06A 4LSRL 1IZKA 1W72L 2VERN 4LPXA 1X6NA 5D7KD 3WLBB 5A43C 1B6UA 3GI9L 1IC7L 5GSVA 4P3DB 4DKFL 5K93A 2AABL 1JPSH 2D03L 3HE6B 3MCKB 4HIHB 2NW3B 3TT3H 2F53B 4YE4H 1XMWA 5I30H 1LMKA 1FCCA 4RBPK 4GH7B 3S3SA 3I6KA 1NC4D 2DQIH 4JFFA 2WUBH 5A2LH 1ZLWK 3QO0A 4C83A 4PJ8D 1MRDL 5IG7B 1ADQH 3C9NA 4FQ1L 4F7TA 4KGJA 4ENEC 4TSBL 1BP3B 3UO1L 5AEAA 2WIIA 4Y5VA 4WU5B 3V4PH 4UB0L 1S9XB 3JXAA 1HIMH 4UDUA 1MCIA 3RHWF 3O2VL 3GI8L 3L3OA 1U8OA 2R2CA 1A21A 1VERA 4HV8A 5EOCH 5EU5A 5LQBL 4RA0C 2CXKA 1ES0B 5TE4H 4EN3D 2YA0A 2CO6B 3WNPA 3CFIC 2EC9U 2EDWA 1F8TL 4LDEB 4TUKL 1MCDA 4XBPB 1PKOA 4JFOA 5DJAA 5T1KA 4ZUSA 1BZ7B 5I1IH 4X8XA 1SBSL 1CWVA 4MJ5B 1A0QL 4XHQA 5I1HL 4LASH 2HRLA 2YPLA 3VGAC 4P4KA 5ECJE 5KSAD 4F3FA 2VE6B 1YY8B 2MWCA 3WFDH 1DBKH 3QIWB 1EO7A 3QEUA 5DRXB 2VH5L 4PLJD 3ZE0E 3HI5L 3UROR 1AJ7L 5ITFB 3V6BR 1E0OB 4OF8A 1KTDB 2E6JA 4NT6B 3N1QC 1U8NA 4MAYC 5EBWA 2VDKH 1UJ3A 4BQCA 4Q9QH 3EDKA 3STLA 1HXYA 2M2DA 3GMRA 5FYJH 5DO2D 5KW9L 2IJ0C 5DJ0B 1U8JB 3OAYK 3SEPA 1ORQB 1CLZH 1T7XA 2DLFL 1YA5A 1HHGA 5HGBB 3RNKB 3W82A 2P7TA 4EJ1C 4BSJA 2XTJD 4H8WH 4PJEB 5EB9A 4AEFA 4KWUA 3RIFF 3NGBC 1F42A 4YX2L 3EAKA 3G9AB 2VUOA 4WO4B 5SV4A 4APQC 3Q6GH 1PD6A 5IR1A 4X5WB 4ZO8A 5FUZL 5FM5O 2OJZH 1BAFH 2X1OA 1TTUA 3FOLB 4K9EL 1XGYH 2RFXA 1A7BA 1Y18A 1N64L 3LS4H 3JTTA 3ARZA 3TN0D 4KVCH 2R69L 2W0LA 2NY5L 2ICWB 4WFHD 4CUCA 2C9AA 3K2UL 4ONFL 5FCSH 3PWVA 4QTHB 1X4ZA 1HOCA 4J3OC 5H35A 5FUOH 1KCSH 1VGKB 2IBBA 3BO8A 2PTTA 1EEYB 4AG4L 2WLZA 3LDBB 1NGQL 4Y4FA 1PYWB 1CICB 1TJHH 1UB5A 1IAKB 2CKBB 4LF3A 3MRJB 2RB8A 3TYGH 4L3EB 3EYUL 5DURD 1WBYB 1A7QH 1OCWL 2A38A 4YC2B 4P99A 3E6FA 4N5ED 1Q9WB 4Y7MA 3GSOB 5DXWA 3D85B 5GZND 2QSVA 4NQVB 2IPTH 4NHUB 5D1QC 5BZDB 3HPLB 1CLYH 4UIKL 5EOQL 3W9DA 3HFML 4FQXC 4I3GA 4JFDB 4UV4L 3Q5YA 4TTDC 1NLDH 3P40A 4G3YL 1ODAA 4P9MH 5EO1B 4MHHI 4Z9KB 1DQMH 4FTVD 1K8IB 1R5IB 4WNQB 1BJ8A 1NGYA 4Q7DA 5JQ6L 1GGYA 4XCFL 2ATKA 4PJCB 1JMZA 4JZNA 4GJTB 2KBGA 3BKCL 3TVMC 3HNSL 2YEZA 4MLIA 2JCCB 1MJ7L 3OJVC 3HUJE 4G9FD 3FTGB 5DJ8A 1U8HA 3DVGA 5EUOB 5IGXL 3V6OE 1D9KD 1Q0XH 4GRWH 2XA8H 5C08E 3VI3E 5LXGL 4KROD 2PCPB 2PXYA 4F8QA 3MV9D 1ZGLB 4Y2DD 3MLZH 3SGEI 4MQ7A 4I9WE 3FFCE 3BP4A 5JW3L 2X5PA 4U1IA 4NZTL 3IVKB 3VXUD 2I07A 1WCBA 1T7ZA 1HZHH 3V0VA 4YDJB 4EXPX 5DI8B 1I8LA 3SOBL 3O8XA 1N26A 5EU6D 5ISZE 3FQWA 4GRMB 4YXLL 4PJHB 1A7RL 2E8YA 3TPUA 5F7FA 5I18H 4ODXB 3VWKA 3V4UL 3O3DB 2HKHH 4OGYL 1G0XA 4KK5D 3MGTA 2V2WA 3NCBB 1RZKC 4CDHA 1CQYA 2R1YA 5T3XL 1F6AA 1A02N 5F89B 1S5HB 4JQXA 2BSRB 1FIGL 1A6ZB 4JKPL 4JM2A 4YHMH 3SKJH 3MA7B 3RZWA 1WCQA 4PRDA 4KPHL 4GBXC 1DUYB 1OLLA 2DTMH 5MEOA 1OAKL 3H7BB 3VMNA 3X3FH 3KXFD 3DTXA 3D39D 3M1BA 3DX7A 4RRPG 1MWAH 4IDJL 1CFQB 4OB5H 1X5JA 5I1KH 1HI6B 1KELL 2WBKA 4OGXH 4WWKD 2NTFA 1U91B 1NC2D 3DSFL 1I1YA 2Y6SC 3ESUF 4KV5F 2OLDA 4W6XB 1KIUA 3FN9A 4FQLL 5DR5L 4GW4A 4LU5H 1UM5L 2Z93A 5GRUL 1MCOH 3V5KB 2UUDH 1FE8H 1FV1A 3QG6B 1HILB 2AK1H 2ZG2A 5LCVL 4J4PD 5LGHL 3MREA 4UMGA 5GIRB 5C0AD 2VZ3A 3NOIA 1XGRA 1SM3L 5IV2A 4KI5C 5C7XH 1RJZA 2Y5TB 2ZUQB 2DB8A 1L0YA 4Q2ZB 3ULUD 2UWEB 1WC7B 5D7LE 3IU4H 2YKLH 3B2VH 1ZT7A 3EIFA 1OD9A 5JIPA 4Z77A 1KIPB 5GGRY 3SCMD 2XRAH 1YNKL 3ARVA 5JOPD 1D9KB 1CFVH 4QOKA 5F7EL 1HYSC 1FL6B 1G9ML 1A6VH 4LLUB 5DRNA 1VACA 6CGTA 3KPNB 3T4AB 5ANMA 1A6TB 2B39A 2FYYB 4PTTB 3VU2A 3WV0A 4N8CL 3UTOA 1NDGB 4EDXB 4JN1H 4ORGA 4E5XB 4PJ5D 4NO3A 4H1LG 4U7KA 1XH3A 3C5ZB 3GBMH 5T3ZD 3ILPA 3LQZB 4HKJA 5DHVB 2C1PA 4WHDA 3U82B 4UT6H 4LKXB 4PP1C 4YO0B 1UCBH 3QUMB 3QWOB 3QNXB 5J1SC 3MRCA 2ZUXA 3G6JB 2MMXA 2R0WH 4JAMB 3DX8B 3GBNH 3L3KA 2LVCA 2WBJC 2A1WL 2AJXL 1UADC 4LVNB 2ADIA 1RIHL 1FAIH 1JUFB 5E00B 1J8KA 1VEOA 3P73A 4NN6C 2LTQB 1AXSB 5TDPA 5IROC 5D1ZD 5JPMB 3O3UN 2LFGA 5F7YC 3DI2B 4LAJH 4Q6IB 4XGZA 4NKOA 2ZOLB 4YIQB 1UGNA 1H3TA 5C0IB 3QNYB 4OCMC 3VG9B 3X17A 3FT2A 4PJ9C 4LPYA 4LHUA 4P2RD 4EUPH 1FYTB 3MV8E 1GC1H 2LABA 5EORH 1K4CA 2AGJL 4WUUE 4Z7WB 4R90L 5CHNA 4XP4H 1FVCA 4P9HC 3RA7H 2CQVA 3SE9H 5IKCB 2HWZH 1EO8L 4PJXA 1DBAL 2OMNA 4QYOA 4K7PH 3MRQB 4PY8I 1OSZA 4G7YL 4NRXB 1V7MH 5EC1B 3RAJH 1NEUA 5JNYB 3OKLA 4L29A 2X9WA 5K59E 4M7KL 5F7DA 1QYGH 3VD3A 4YWGH 1YYLL 4OLYH 4NZRL 1FNHA 1ULVA 2FWOA 2NY7H 4KKNA 3BKMH 5D72H 3MV01 4QKXB 1ZT4B 4ONHA 3OKDB 4U1GB 2DL2A 4OD2A 4RNRA 1FG2A 2HAZA 3G5YA 3AFLA 4QHLA 5KJRL 2WBWB 4NCC1 3JTSB 4TPRL 4H20H 1R0AL 4IMKA 5DRZA 3PIQB 5CEZL 1E4WH 1OAYH 3VXMD 1C5BL 1C5DB 3CX5K 4NCC2 2RBLA 35C8L 2O26U 1WK0A 3VA2C 4PG2A 4MJ6B 5ACZA 3ZDYE 5EIIB 2QR0B 3HZYB 2CK0H 3HTLX 2Y9RT 4GT7A 4EI5A 3HAEG 1FGVH 5JQHC 3VFMA 5DUML 3QI9A 5I1DB 5GHWH 5IBLD 3SGJC 3ZYZA 3C60B 2ID5A 4DVBB 4U1MA 3MOQA 4LCIH 1JGVL 3DVNA 5ESAB 4LLYB 2BHYA 5HYEA 3BP5A 4PRHD 5C0CE 2GKIA 4PJIA 4LK4A 3GSVA 1WAAE 1XF5B 5C2BL 1A3QA 1K6QH 3SJVD 4JFXB 3TESA 5FGBC 2GT9A 3PWPD 2VLKA 1LNUB 2IAMB 2OX5A 3L3HB 4FG6C 3V6FB 4N0RA 3O3AB 3GSRB 1B3JA 1UKSA 5B21A 3MYJA 3V7AE 5J13B 3MJ7B 4QTIH 1FL3A 4S0TD 5D7JD 5AZEL 4AL8H 2KL6A 2R15A 1RMFH 3GSQB 1QRND 1KLGB 3EO9H 3TH3T 3QQNA 3CGTA 1I7ZA 3DV6A 4NOBA 4NWTL 1CD1A 2P5EA 3ES6A 3MJ8B 1N7MH 3KPMA 4Y16C 2Q8AH 1MFNA 3FO1A 4JZJC 4X7FC 1ZMYA 2X1QA 1MPAL 1JPGB 5IB3B 3UAJD 4DK6A 5J56B 1B4JL 1JV5B 2EYTA 1KIQB 4P3WA 4JB9H 1OTTD 1UYWL 4YXKH 1CU4L 2APFA 1CFTB 2HA1A 2XTLA 1P4LA 4R4FH 1XGQB 1A9BA 1CDCA 3E3QE 2NNAB 5AAWA 4J2XA 5E94B 4J1UB 4P46C 1FFOB 4WJ5B 5B4MC 5TE7H 4K7FA 3BIKA 5DK0A 2IFGA 3DXAE 4LVEA 4YK4C 2J88H 3DHMA 3FAXA 4KDTC 3L1OH 3U36A 4TRPL 3TV3H 1KUMA 3F7YA 5ID1B 2F74A 3FQNB 1FO0B 3ORJA 1DVFA 1T1YA 1AGFA 4XPHL 3RVUC 4J23A 4NZDA 4XVSH 1P9MC 3U1SL 5D6CB 1YPZF 3HG1A 3GMQB 4BK5A 4HKBA 3HR5B 1E27A 1HSBB 1INDL 2AQ1A 5I9QB 4G42A 5DGQA 4ZO9A 1R3KB 3MCLL 2JB5L 4BQ9A 2CKBH 4Z7QE 1R24B 3BGMB 1FPTH 3LMJL 3WIIH 3EGSA 2FHBA 4X98A 4XP5H 3U48A 3U46B 1CXIA 5HI3D 3PWNA 4KTEH 1KXQE 4JFHD 9CGTA 3KHOA 4OBSA 5LKNA 1EBPA 1QVOB 3HMXH 4JJ5A 1MEXL 4GKSA 4S10A 4LLQB 2Z35B 5IT2H 4RGND 4P3CH 1ZVSB 4Z7NE 1MCBA 4FFVD 5L2KA 2H8PA 5CKGA 4RAVA 3ZKNC 3H42L 4LLDA 2AEQH 5DVMA 1X6LA 4XPAH 3QCVH 5F6IC 3W0WA 4L4TE 2CDGB 1IBGL 1A7OL 1S7RA 1UWEH 2VSDA 5FYKE 3REVA 3SDAB 4MNQD 4MD4B 1KFAH 4M43H 1NFDB 1QLFA 3PQYD 5JR1H 3V5DB 1IC4L 1CVRA 4TULL 3L7EA 4KVNH 4DGYH 5E6IC 4Z0BL 4K71C 1HCFX 1DSFH 3CU7A 3VFGH 3WXWH 4YNYB 2Y7QA 3NN8B 4P2OD 1X7QB 3KLHD 1W72B 4I18B 5HGHB 2DKMA 4WV1B 3LEVH 3H3PL 3VGGA 1NUDA 4H1LB 5DT1H 4JFYB 3OZ9L 3BXNB 1WFNA 5CWSB 2QKIA 5MEND 1DLHA 1SEBA 3H9YA 5TGBB 2XG4A 4C4KT 4GKNA 4JR9H 1GGIL 5DMGC 2HJKA 2X70B 3B6SB 5MP6L 4OCWL 4NBXB 2YD4A 4UTAL 5E1AB 3N1PC 5D1XD 1RK0A 4CRPA 3LKSB 5C07D 3KPRD 3ZE2E 1OP9A 4CJ0A 1JNNH 1EZVX 1BQSA 4ODVH 3KJ4C 4HK0B 2ICEA 3HE7C 1ZLSH 4YDIL 1T7YA 1PZ5A 3FO9A 5I66A 5T5FH 3F5WA 3T0XA 4EI6B 4ZFGL 1NGPL 1JPST 5D7IA 5DMJB 1BX2A 3VMPA 2PYEE 4AQ1B 3BZFB 4AK1A 3HMWH 4F7EB 1LDPH 5IB5A 4Y4KA 5C09A 4QGTA 5C9KA 4XBGB 1N3NA 1XZ0A 4MQSB 1LE9A 3GHBH 3WHXB 1QQDB 5DTFA 3UPAA 5B38A 2M1KA 3OAZH 1TCRB 3BP6B 4OUUA 5SWQA 2BJML 1TITA 3IFOB 1RIUH 3DMMB 4ZS7L 1M71A 3TBTA 3E2HB 3RVVC 4Z0XA 1T89A 1UQSA 4POUB 4XXCC 4Q9CA 1N2RB 2JE8A 5HPMA 2NXZC 4OV5B 1S3KL 4HPYH 1LDSA 4MJIE 4XP6L 3WJLC 5IHZB 5I71C 1TNNA 2HVJA 4K3JL 1F3JA 3MRDA 1S9WA 2YD2A 4NIKB 5I75C 2EDEA 1AR1C 4YDLC 2VQ1B 1L7TL 2WWMC 2YPLD 4PREB 3EO1A 4P4KD 1NMCB 5FYJE 1P7HL 2FX7H 1FFRA 4BJLA 5I1CH 4X9GA 1MH5A 3LRHA 1MCHA 1T3FB 2Z8SA 3PDOA 1LVEA 1OWRM 1NCAH 2IPUG 3WDJA 4M7LT 1TVHA 3O3BB 3PHSA 5C2UB 3QQ9D 3GJEA 3CXDL 4JRWA 3SPVB 2WNGA 2EDBA 5F7HA 3TA3A 5SX4I 1JYXA 3Q1SH 4PV9B 1LO4H 3L5WB 4XNYH 5A2FA 2HT2D 3JV4A 1RJLA 3QEHB 4KKAC 4U3CA 5HHMB 5BVJB 3MLWL 3GIVB 1OF2B 2GYSA 8CGTA 4Y4HB 1YYMH 4RX4A 3HAEB 4TVPH 2XZZA 3B9KB 2EDLA 1Z5LB 5JXAL 4FQPA 5DHVH 3VRJB 1AQDB 3VFTA 5T3XD 4QRUA 5JIHA 3NFPA 3NCYP 1MJJB 4OD1L 3QUMH 1WLHA 3OXSA 5DFTA 1MI5E 3RWHA 1BJ1J 2VZ1A 5EN2B 4MA1B 1XF3B 1OP5H 4R0LC 2XACC 1UFUA 2XA3A 1QPXA 1ZLVH 43C9B 3SDXE 4JFFB 1N5AA 3RVTC 3QO0B 3HA0A 3UCRA 5GSRA 5KS9E 3DYMA 3PNWB 4MB5A 4PP2B 5D7SL 2IH3A 1VHPA 4F7TB 1YEDA 3ZHDA 3C2AL 5JHLL 1KXVC 1JPFA 1JGEA 1N59A 1SEQH 2H1PL 1K2DB 2CK2A 4JM4H 2EDYA 3AXLA 4Y4FD 3T1FB 1X5ZA 1DEEA 4JPVL 2JB6A 1ZOXA 4WENB 5E2JA 1ZEAL 2BCKA 3OJDA 3CVIH 2EICA 2MHAA 2Y07L 1BLNB 5TPWH 4RFNC 3NCCB 4HV8B 1NCUA 3PL6A 3TJEL 3HI1A 3MODH 4HT1H 3VFSA 4NP4L 1MJ8L 1HQRA 4MXQC 5DJAB 5T1KB 3ULVL 2FATH 4YDKL 2F54D 1ORSA 4HCRH 2Y72A 4K8RL 5I8KL 1FNGB 3GB7A 4U33A 2YRPA 5D9SA 5FDWB 5HTSA 2R56L 4TSCH 4Y19A 1TQBB 1KPUB 1RU9H 4DOHB 1LO5B 1UZ6F 2BDNL 3QEUB 3BPNC 4HPOH 4GRWE 5SWZE 1HKLH 4LP4A 2X4NB 3QDME 4OKVA 2ENYA 2VIRA 4IMLB 5EU4A 4RFOL 5JA8B 5KTEL 1UJ3B 2WQRA 3CVHA 1PSKH 4CU7A 4LKCB 4HUMB 2FHCA 2FGZA 5DEFA 1QBML 4E42A 2A6DB 4PB0H 5M7QA 2YBRB 3DVFA 3RDTC 2ZG3A 5CJXC 5F72S 5FOJA 1RJCA 3KLAB 3S36X 2D7MA 2PXYD 4DUXA 1A6UH 2ADGA 1QHPA 1H0DA 4G9DA 2AXHA 4Q6YA 1S7TA 4JJHA 4HX1B 2OZ4A 1WBXA 1B2WL 3N85L 1AGBB 4PGZA 1BFSA 2DBJA 2R2EA 2I27N 1LE5B 3RIAF 3O8XD 1Y18B 1HDMA 4N5UA 4YH6A 4JO2L 3B8YA 2VC2H 1VEMA 5IM7A 5GRXG 4NWUH 5L0QC 2VLJB 5E99L 1HE7A 5DJCB 5MHSE 5EIVA 1IT9L 3VWKD 5GS0L 4LSSL 1IGCL 1SJEB 5IEKB 4LCYB 4BH8B 3GRWA 5EBGA 4JM2D 2BOCA 4O02H 4OZIF 4LF3B 4U7SA 4P59H 5B39A 2OR8A 1GGUA 5C0RL 2FH8A 4XNZB 4YGAB 3FOMB 3MBXH 2HMID 2P1YA 2VAAB 4ZUWA 3V8OA 1EIBA 4KHTH 5IFAH 4M8QA 2YPKA 3WIFA 5IQ7H 2P5WE 2HRPH 2VJXA 2DQHL 4NM8H 4LIQH 3QIBC 1BBDL 1GH7A 2P48B 2ZCKL 4XRCA 1GZQB 4X6CA 4H25B 1MY7A 4NOFA 3TGXA 3MLUH 1I3UA 4ODUB 3RY5A 3NACL 4PR5B 2A2QT 5EZIH 3TWCH 4FFZH 5ID0B 3NIDF 4P2QD 3ZYJA 4JZNB 4NQSB 2X4QB 7CGTA 1R5VA 4F7CA 2Z4QA 2Q1EA 3QDGE 5JHDE 5BVPL 2VR5A 4L8CA 3BPLB 2HN7B 1RUMH 2AXFB 3AROA 3DVGB 5J6GB 1FO0H 1FZMA 4J3WA 5HI5D 1FLRH 1ZHLA 3AS3A 1HYRC 1QLRB 5HHNA 4WFGD 5CJOH 4GRLB 1G7JA 4KRLB 4OLUL 5GJTH 2V9RA 5ICZB 4BZ2L 4QGYA 4OFKA 5DQJB 1NMAH 1QLEL 4WFFE 1EERB 3QEQB 4S1SL 5GRJH 3D18A 4QRRB 3L3DB 5CGYD 3GSNB 3CVHL 4HWUA 3TO4D 3V6OA 2MKLC 3FQWB 1FZKB 5CZXD 4ALAL 3VH8G 2YSSA 4IBLT 2ZUSA 5KSUA 1CDYA 1XCQA 1N0LA 3L5XH 3PV6A 3QB7C 3ARPA 4POZC 2V2WB 4AEIL 2WUCH 3RU8H 4PB9H 4HJ0D 4M03A 3UDWC 1U93A 2XWBA 2VR9A 4HFWA 3BE1L 3U0PA 5J12C 2GCYB 3WL9A 4KJQC 1CGXA 1S7UA 2OZ4L 2DI7A 5E2WL 1F11A 4U1LA 3RBSA 4NZJA 4PJAF 3LQAL 5HVGB 5TE6H 1JYWA 1A2YA 1HHIB 3EYVA 4L8DA 4LHUD 4ZNEE 2A6KB 5EO9A 3WFHA 4DAGH 1K5NA 2Z93B 5TQ0H 4L1DA 3OPZH 4OCXL 5I6XB 1OGAD 4JPKL 5FECB 3HC4H 3T0EB 2QTEA 3VRLE 1W72H 1ZSDA 4LVOC 4LL9A 2AV7A 3MREB 3GRWL 2MQCA 1IC7H 3UTPD 1RZJC 4H1LH 1QTYT 5E9DE 5EZJA 3GGWB 4LCWA 2W0FB 2V7NB 3QZWA 2X2YA 1JYVA 3IDYC 4MJ4A 2EIBA 2QADB 3GMLA 2ARWA 2VWEE 3P0YH 1ZT7B 4AIOA 2R0KL 2V2TB 4X7SH 1MRDH 2F53E 1DLFH 1CTNA 5E4IA 3AM8A 4Z77B 1JZ8A 2DKSA 4TSBH 1RZFL 2NY4D 1X5YA 4QOKB 4YHIB 1DDHA 4ZTPL 1S9YA 3P4OA 3QFJA 4JVUA 3O2VH 3GI8H 4ZFZB 1MAML 2VL5A 1JZ3A 2DQUH 4JDTL 4D0BB 3MXWH 4N1EA 2A9MH 1DBMH 4Z5RA 3IDIA 1I1FA 4A6YA 4HK3N 2YC1A 2AJSH 2BRQA 1F8TH 4CADB 2AP2A 1JHTB 4Q97A 1ETZB 2WP3T 43CAB 1XH3B 3R1GH 1SBSH 3QRGH 1F97A 5DD6B 3ILPB 3UTTE 2OQJA 4HKJB 4LPVA 5D6DC 3JWDL 4O4YH 1A3LL 1K8DA 1QA9A 3QUZA 4EI5D 5GZOC 1IE5A 1RIVH 3RJQB 3UYRL 3QI9D 3ARBB 3PWLA 3L5HA 1KJ2A 5FCUH 5JOFA 1Q9OA 3EYQC 3L3KB 1XF1A 3N1GC 2NY3B 4HG4J 1IGIL 2WINA 3TYFA 2C4FT 3S37X 3P73B 1U8PB 5TDPB 2F8OA 2BMKA 1BVLA 4OI8A 5K33A 1U42A 1RZ8B 4KKCD 2OTWB 2Q8BH 3SDCA 3MCG1 1CGVA 2P24A 1OARL 5C71A 1ZHKA 1UWGH 1CXEA 5J11B 2AV1B 4WHTB 1K4CB 2ADFL 5CHNB 1I1AC 1QFWI 2OR7A 4PGBA 5T1LD 4PJEE 2Z8RA 3SKOA 1BREA 3SGKA 2A6IA 4HGKC 2IF7A 3ZKXC 1AD9A 4QYOB 3JV6A 4JCMA 3TZVC 2OYPA 2XPGA 4YJZL 5FK9B 2R69H 3OKLB 1S78C 4L29B 2NY5H 3HAEH 5E6ZA 5F7DB 3RI5F 1M1SA 3X3GL 3L9RA 4ONFH 5ICXB 2WWKT 3MV8A 4QRQA 4AH2A 4RSVA 4KAQL 4P57A 3ARSA 3ARDA 5HHOB 4ONHB 4WUUA 4WTWA 4LHJB 1NGQH 2VUYA 4XB8A 2W59A 3WYRA 5IF0A 4DEPB 1KENL 3EYUH 5L8JB 1FVDA 1OCWH 2HT4C 2KZWA 2DBLH 3QIUC 5INDB 1YMHB 3VXTB 2E6PA 5DMIL 5DRZB 3IU3B 3IDMB 5I1LB 1RHHA 3MA9L 3EO0B 4UQ2B 3HG1D 1J1XH 3HFMH 3VXRD 4MDIB 5HD8D 1LQSR 4UV4H 1VKXA 3IFLL 4GKZB 3BIAX 4G3YH 2RR3A 3VFMB 1BOGA 1FVEA 4YBQC 5GGTH 1AKJA 4YHNB 4HWBA 1YECL 4P5MA 1T5XA 3SE3C 5JQ6H 4M62L 3IETA 2FCBA 3DVNB 3IYLW 4UNUA 1QBBA 2A73B 1Z9SA 2GJJA 3BKCH 2YS4A 3GO1L 1T6WA 3BP5B 1G7LA 4A6YL 1JNLH 1BPVA 3JWNC 4U1JA 3GSVB 3IXTB 4PJCE 5KN5A 5IOPB 7FABL 5IGXH 2VLME 3RVWD 2G75B 2JCCE 3M17A 5LXGH 2P4AB 2VLKB 3SO3B 5L2KD 1UXSB 3ROOA 5F8RC 1QSFD 5DJ6B 4BFIA 3D3VA 1IGFH 4OT1L 4YUEH 5EUOE 3W0WD 3LKNA 3VFUA 3O6FC 5JW3H 1KJ2L 3BQUC 4MVBC 5HVHC 5I8OH 2NY0C 2F5BH 2CRZA 4I0KA 1QKZL 5DVLA 4NM4L 4NQDA 2M26A 2VN7A 5C0CA 5ETUA 1CD1B 2P5EB 1YN6A 3SOBH 1YPZB 2IG2L 3RY4A 2W9LA 4QRPA 1OPGL 4YXLH 1VCAA 4Y8DC 5J9PA 3LD8B 4U2ZA 5J89A 3GMOA 3B5TA 3FT4B 3RY6C 4OGYH 1P4LB 4LQ1A 3CFKA 3M8OH 4PJHE 3OSKA 3AREC 3LS5L 3RX5A 5C8JB 1Q72L 1K85A 2CIIB 1FIGH 3ZE1E 5JIIA 5KVFH 1LP9F 2AJYH 4YPGB 4Z95L 4KPHH 2CR6A 5DJXA 1X5KA 2X05A 1OAKH 2HG5A 3VH8B 3I50L 3P30L 3BIKB 3EOAA 2O5YL 4FN0A 2NY6B 4LPWA 2Q6WB 2AS5M 2NYYC 4ZO7A 4MAYA 3VWJC 2IEPA 4FZ8H 1Z9OA 3MLVL 1X5GA 5BRZB 1DVFB 3QULA 5DR5H 5C0JA 3QNZA 5GRUH 3MRGA 3NFSH 4HJGB 5ADPH 1X5HA 3TBYB 3THMH 3HNTH 3U4BL 1T4KA 5LCVH 4OF3A 3V4VL 3G04B 4G42B 3AS1A 4IRZL 1NGXA 1ED3A 4UU9A 2DYPA 1IAOB 1TQCC 2X4SA 1QD0A 4R26L 4HQQH 3BAEL 2W65B 3DXAA 1BOYA 3H9HB 5C70A 4APQA 4X98B 5F9OL 1SVCP 3BHBA 4K8RD 1ZANL 4Y4KD 5C09D 1FGNL 1D5IL 1NLBL 3DROB 2X4TA 1YNKH 1AHWB 3TBWB 5GISL 2C3XA 3ZL4H 4JJ5B 5K9JH 1IQDA 5F7EH 5HYQA 1A6WL 3KPQB 5FGCB 3KYNB 3ZSSA 2NY1C 4L4JA 3CSYA 1LEGA 4G9FE 4RAVB 4FQQA 2JIXD 4LLDB 1BIIB 3O2WL 1T2QL 1M6OB 1NGWB 3TIDA 3PABA 4N8CH 4RMVA 4MXVE 4HWBL 4L8SA 1MFCL 3NABH 1S7RB 4YHPA 5JPNB 4HDIB 4MGXA 5FFLA 4NKMA 3T3PE 5KVGL 2R0LH 2W9DL 1BZQK 4QXGL 3C6LC 3L7EB 5B39G 4GKOA 1FC1A 4JGUA 5F88A 1ZT1B 4P5TA 3MRNB 5F6HI 2OJEA 1OTSD 3R8QA 2F19L 2PN5A 1H3UA 4J3SA 4ODWB 4QCIA 1NBYB 4TVPE 1U3HC 3VGBA 1RD6A 5JXEC 3NCFB 5EU6E 3NFNB 4NC0B 4XWGL 1CYGA 4WI7A 2FD6L 2A1WH 4L4TA 1UB6B 3QAZC 3EYSH 3UJJL 1M05B 4LP5A 2QKIB 3ZKMC 3RKPA 2YUWA 1ZVHA 3G6JE 1JGDA 1TPXC 2AJZA 4M7ZB 3OXRA 1ZGLP 2F58L 4RX4D 3WJJC 4I0PB 3GMPA 5K9KA 4K7PX 5GS0D 3GSNH 1FBIH 4GOSA 1GL4B 5D4QA 1RK0B 4NBYB 1IFHL 2DJUA 1J87A 1C16A 3UX9B 1AXTL 2Y06H 3D39E 3S98A 4MA8H 3RVXD 4IRSC 2P43B 5ADOL 2X4OA 5F9WB 2B1AH 3NZHL 1GAFL 1QBLL 1FYTE 3QWRA 1T80A 2GSGA 1EO8H 4XZUA 4QHUA 3G5XA 4Z7WE 3U7WL 3U9UA 3MUGA 3P9LB 2D7NA 5FM8A 4LRNH 5C0AE 4XAKD 4NNPH 3JUZA 3VFNB 5F21B 2B0SL 1N3NB 1VGEL 1YYLH 2VN4A 3RBGA 2ADJA 5D8JH 1RSFA 1F6LL 3INUL 5SWQB 2D7TH 4RFEA 4ETYA 3QUYC 3ZTNL 3PF2A 1KCVH 3T4YB 3IF1A 1UACH 1UQSB 4X8JA 4Z0XB 5FYKU 5JOPE 3WO4C 5HPMB 2BZDA 4XHJC 4OJFL 2A77L 4U49A 4OIBA 5CEZH 1TZGL 2KKQA 4KY1H 4GBXA 2HVJB 3MLYH 2Q86A 1C5BH 1S9WB 1XIWC 1K3ZA 3SDDD 1JFQH 3X14A 5EC2A 2IQAA 2YD3A 3RZCB 4F2MB 4ZXBD 3O9WC 4LSQH 1MH5B 4LCCA 4PJ5E 3T77B 4GQPH 2VDPL 4JLRA 1A3RL 1SJVA 3RWFB 4ZUTB 3ILQC 1IM3B 4MD0B 2B5IC 3RWJB 3DUHA 3TA3B 4O2FB 3CH1A 3TEUA 4B41A 3QWQB 4JCLA 4EDWL 3WNLA 1YEGL 5AYQA 2BVPA 5MERB 3U83A 3QXDB 3MOAL 5BV7L 2HTLD 3IGAB 5D2LF 4CU8A 3BZ4A 1J0KA 5J6HA 3VFRA 4I4WA 4JFZL 5HYJB 1P4BL 4X4ME 5JMRA 4N8PA 5IIEA 2NW2A 3NFPB 4KTDL 5DUPH 5DQ9A 4Q0XL 5KSVB 1JZ6A 4JZOA 4E41B 3A6CL 4TOYL 1QFHA 1CG9A 1MFAL 5AZEH 4S1DC 1OY3B 5KANI 3ETBF 1TLKA 2EE9A 1VB9A 4IRJC 3RWHB 4CN4A 4NWTH 5J1AB 3IFNL 1D6EB 3DRTA 1IQWL 5E2VH 4TNWK 5BW7C 5C3LD 1LEIB 4OLVL 4N1HB 1MLBA 1MCEA 1N5AB 4XMLH 3G5ZA 2DMKA 5GSRB 4D9RE 1FZOB 1UYWH 4XTRD 4KI5F 4X6DF 3LN5A 1CU4H 2PO6B 5FKPA 5F1SA 1JGEB 3RWCA 3QR2A 3WN5C 4KK8D 1MI5A 2P42B 4LIQE 4DKAA 3PHQB 5IMOB 3G08B 5FOBA 2J12B 1YEEL 4ZUUB 3WFCH 1IGYA 4NO0B 2G9HA 3I3EA 2YN5A 1Z0MA 1VADB 5AUMA 2V7HA 5DSCA 3IJSA 1U9KA 5E5UB 3BZEA 3PL6B 5CFHA 1C7SA 3SDXA 3VFSB 2FEEI 1I8MA 4PY7B 1C1EL 1PVHA 1KCKA 4TRPH 5FYJU 5K9OA 4NN5C 4RAUB 5IROA 5GJSH 4YE4L 5KS9A 4L4VA 1ORSB 5I30L 4DZ8B 1B4RA 2HJFB 2WSKA 1DE4A 4XPHH 2YXMA 3SKUD 4Y19B 4XWOC 2NZIA 4PJGF 3MMEA 1MHHA 3P0VL 4PJ9A 3VXME 3TBSA 1INDH 5I1JL 4JDVB 3K0WA 5TQ2H 1JWUB 2UYLA 5HYIA 5F1NB 4YQXH 1J05A 4J8RA 2X4PA 3GSXB 3V4PL 2BK8A 1HIML 1RZKL 3LMJH 3GHEH 3MNWB 1QNZH 4R2GD 4IIQB 3CVHB 1PQZA 5DJYA 5IJKA 5BQ7B 4G6FB 5EOCL 5DEFB 4MXWH 4E42B 2CDEA 4IS6B 3CCHA 4MNGE 5TE4L 1G9NC 4MS8C 2G5BB 4EQ3A 4OZIB 2KPNA 3LKRB 5EU7C 2ZZUT 4PRHE 1T21A 4CMHB 4URTB 5HHQA 4G6MH 1P84K 2MJWA 5SWZA 4G8EA 4LASL 1GHFL 1I3GH 1HQ4B 2QSQA 3QDMA 1JK8B 2FJFA 1CGSL 2YUZA 3FCTA 1A7OH 2DOCA 3MRPA 3RWGB 3U4EA 1WBXB 3WO3B 4I2XB 3EYOA 4R4ND 4G6AD 1IC4H 2DQFA 4GLRI 4NKQB 1HDMB 4LVHC 3KPOA 1HCVA 3IXAA 3GUTA 3IKCA 4Z0BH 2FEDD 1T03H 5C08D 2VDKL 4Q9QL 3BH9A 4NQCB 1NFDE 3HHRB 4NQUA 5H94B 3CX5J 1I3VA 2BY3A 1IL1A 4KI1A 5E8EA 4JO1H 1U3JA 3FFCD 4QXTA 2NXYC 4Z6AT 3GBLA 4FRWA 4C56B 2FEEL 3STBA 4P5KA 2BOCB 3OZ9H 3DX9A 4H8WL 1AGEB 1KJVB 5T5NF 5B39B 3W5MA 1KC5H 4JO4H 1YJDC 5AD0B 2GW5A 2X7LA 1ACYL 1AO7A 4PRNB 5JDJA 1GGIH 4P23A 5MP6H 4Z7VA 4OCWH 5ISZD 1BWMA 3U4AA 5INCA 3FRPG 1W0VA 2Z31C 2EZ0C 2OJZL 3CZJA 4GXUN 1BAFL 5HYSA 1XGYL 1PGRB 3ARFB 3OJMB 4UNVA 3ECBB 5HVFB 3DI3B 2AJUH 1KJ3H 5FGBA 4X6CB 1CK0H 4K3EH 4U0RC 4AM0A 2HLFD 3GDBA 2H3NB 3NCYS 4LCWD 1AP2A 1IGJB 5EOTA 1KCSL 4ZFGH 1JN6B 1NGPH 4PGEA 2B4CC 2P44B 4JGMA 4BFBD 1TJHL 4F7CB 2B1HL 4NCDA 4BH7A 2YK1H 2XICA 3K3QA 3OJ2C 1J7VR 1A7QL 4ETQA 5FGRA 3REWB 4F9PC 2EKSA 1UA6H 2DM7A 2YUVA 2ITDA 2P5WA 3FQTB 1FZMB 5EU3A 2W0PA 1KTRL 2BJMH 4L3CA 1ZHLB 4Z7VF 2IPTL 3CXHK 3VJ6B 3BFOA 3EOYG 2J4WH 2Z91B 3CU1A 2O5ZL 4KRPC 3AVEA 5EG6C 1KEMH 4QHMA 1P7QA 2R9HD 5HDOA 1NLDL 4RGNE 1S3KH 3HNVL 2ZSVB 1M7IA 2DD8L 3ZT6A 1NCCL 2HFGH 1T83A 4P9ML 5JHDA 4YPJA 3QUXA 1V8HA 3VFVA 5IHUL 4JVPA 5FF6B 3MBEB 1L7TH 1EXUB 4R4BB 3T0VA 4KDTA 4XMKL 2J8UF 2HVKA 1ZHNA 4HW6A 3QUZD 5IW6A 4MNQE 2UY7A 3LPFA 5KSUB 1XCQB 5MI0B 2HFEB 3PQYE 4HIXH 4GS7C 4O2CB 3L5JA 4ZAKA 1G0DA 5C0GA 1QO3B 2X44D 1A9EA 4KQ4H 2YXFA 1P9MA 2IQ9H 3CXDH 1Q0XL 3MRRA 5AWNL 3O45A 1U93B 1UKQA 3TLRA 2BXYA 4AYFA 3FT3B 1CFBA 1JNHB 1FC2D 3MLZL 5IVZA 1F4YL 3V52L 2C3VB 5LBSL 2F9BT 4PJ8C 1NFIB 1BFOB 2ZG1A 3SDCD 1MRFH 2B8OT 3V79C 1KIRB 1NCWH 1A1MB 5HHME 5MENE 3S3JA 2BSED 3EYVB 1WEJL 3CUPB 4Y8AA 5EO9B 4F37K 4OAWA 1K5NB 5F70A 3BKJH 3TH2T 1D6VH 1OP3H 4Z8FL 1FP5A 3V6ZA 5C0FB 3CLEL 2AKRA 2HFFA 4EUPA 4M8VA 1EVUA 5T1MB 2ZNXA 3O3EA 5I18L 1WITA 4EN3C 5GGUB 2HKHL 1SJXA 3FQRA 3M45A 5EZJB 2OK0L 2SEBB 3DPBA 5TH2B 4QHNA 4OFIA 4ZYKA 5IHLB 2BNQB 4LAQL 1OHQA 5B8CB 4YHML 3SKJL 2LAGB 2Q7YB 3K46A 5KSAC 1ITCA 2DTML 3ZLQC 4WW1B 4ZNEA 3X3FL 4NYLA 2EC9T 3MV8D 1UXWA 5EUKA 4KK9D 1MIMH 1AQKH 1N6UA 1NJ9B 2RQ8A 3IDXH 4WTXA 5I1KL 1GRWA 4U1SA 5E6IA 4PLJC 4JFFE 1PFCA 1QUNA 4WUUD 1JWMA 3UTQB 4PRPB 1WZLA 3QFJB 1CR9H 4LU5L 1NFKA 4G7VL 5E9DA 1OM3H 1MCOL 3WSQL 2Y07H 2C26A 5DO2C 1I75A 2YC1B 2A9NL 1EUUA 3TJEH 3QDJB 3BUYB 4P3DA 4NP4H 1MJ8H 5DMKA 4LCUA 3MOBH 3B9DA 3DWTA 3HE6A 3MCKA 4HIHA 4KK6D 5FAAA 1F3DJ 2NW3A 4M48H 5C7XL 3ULVH 5IWLC 2OQJB 5I8KH 4PYHA 2XTJC 3B5HA 4J3TA 4WHCA 4UIMB 3IU4L 1U8MA 4OI9A 1FFQA 5IJVA 1F90H 3BUTA 5IG7A 1NKOA 1NPUA 4Y5YB 1AKJD 2QSCL 1KJ2B 1FQ9C 1CFVL 4GW5B 3PGDB