2APWA

Crystal structure of the g17e/a52v/s54n/k66e/e80v/l81s/t87s/g96v variant of the murine t cell receptor v beta 8.2 domain
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
109
structure length
109
Chain Sequence
AAVTQSPRNKVAVTGEKVTLSCQQTNNHNNMYWYRQDTGHGLRLIHYSYGVGNTEKGDIPDGYEASRPSQEQFSLILVSATPSQSSVYFCASGVGGTLYFGAGTRLSVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of affinity maturation and intramolecular cooperativity in a protein-protein interaction.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Immune system
molecule keywords T cell receptor beta chain V
total genus 33
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 2005-08-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2apwA00
1ETZA 3FO0H 1IAIH 4TSBL 4IRSD 1OSPH 4S1SH 3TZVB 3OJVC 9CGTA 3TYGL 1OAXL 1NAKH 4ZO7A 2DQDL 2BOCB 3F7RA 3U7YL 4N0YL 4HXAL 1MF2H 2NW3A 4P3DA 3S4SA 4YR6A 3KYNB 3MLVH 4M1DH 3S4SG 1KTDA 2NYYD 4M6ML 3RWHA 2VLKB 1I7ZB 1II4E 4ZS6C 5GSRB 5K59F 1ZANH 2C4FT 4GRWH 3N0PB 4GSDH 4BQ6A 4TUKH 2E6QA 2VQ1A 5I8OL 4XPHH 5FA3A 3SDAB 2FJHB 1VACA 5DUBA 5CIPB 5F6IC 4N9GB 2ITCA 4FP8H 3PHSA 2HFFB 2W0KA 4DK6A 4OZHE 2OL3H 3K2MC 2AK4E 4M3JA 4LSTH 1DN0B 1M4KA 4X6CB 1QR1B 4TNWF 5TDNA 1MCEA 4CN6A 4GXVH 3MREB 1FSKC 3PP3H 4LHUB 2A77H 5KVMC 1PZUB 4RMVA 4D0CB 4OLVL 4RNRB 3P4MA 5IMMB 3SOBH 5EZOL 3PL6C 2G9HA 1FL3B 1R3JB 1WZKA 1XCQB 2ORBL 1E4XH 4IHOB 4PJXF 4X4YB 1AC0A 4B50A 4OLUL 1WLHA 3TH4T 1LQSR 1BF2A 2W60A 7FABH 3DUUA 4I3RH 1VADA 2DN7A 3H9SA 3A6BL 3P0YL 1OGAA 1J5OL 4DW2L 2P5EB 4PB9L 4HHAB 5J11C 4ZD3L 1U8PA 4YAQB 1JK8A 5IJVA 1KV3A 1SM3L 4L1HA 1MHCB 1MCFA 4JZNB 4PRIB 3VFGH 3OJ2C 3GJFB 2KZ1B 5C3TA 3L7FA 3SEPA 5C0RH 4NBZB 4D0CA 2ZOKB 4JN2A 3O4OB 3UYRL 3VA6A 3P4MB 5GRZA 1HQ4B 4PJXB 3WE6A 3I3EA 3MV7D 3FHAA 3PWNB 4QHMB 2MQ3A 4S1SL 2FIKA 5C0AA 4M3KB 4LCCA 1H3UA 4ORZC 3LEYH 1G7LB 3ARDB 3RVVD 3LZFL 5TE7H 2HH0H 5FKPA 1FNEB 1EBPA 5I15H 1WSST 4NN5B 4XX1G 3RNKB 4EJ1C 3SE3A 4HHAA 1QYGL 4KI5C 1RJYB 4XBEH 1JGUL 1P6AB 2AK4B 3E8UL 4GG8B 1E4WL 4QRTB 3WL9A 1QRNB 1U92B 4OGXH 4QO1A 1SJHB 5IHZB 4XMLH 1FFPB 4MQTB 4N0YH 5C0CE 4U1SA 4WI5A 4XRCA 1HK6A 4XCEB 1JPST 2Q76A 4A6YL 2DI7A 2GITB 2OS7A 4GLRI 4HF5H 3PWNA 1ONQA 1ZVSB 2C5DC 4QHMA 5L8KB 2GY5A 4LCCB 1NGQH 5MEOA 4NP4H 3ARTA 3HS0A 4L3CB 4I9WD 3BHBB 2AXJA 3GMOA 3O2VL 3GNML 5FA4B 5F1NA 1F6FB 1AD0A 5FYLH 3MJ6A 4G6KH 2GSIB 5JLZA 4Q74A 1S7QB 4KK6D 4U1NB 1GC1L 4KROC 1NCWH 3QCUH 2CH8A 3S36H 2EC9T 1HSAA 2VZTA 3MRFA 1VPOL 1XIWB 1YNLL 1U92A 1EPFA 3WJJA 2CRZA 4EOWL 4XCEA 4IRSA 1OSZB 2FHBA 1KIQA 2H32H 5GGSB 1I3RA 2QQLH 4AM0B 2NY4C 5TDOA 3NTCH 2R4RH 1QFWM 4GXUM 1DVFC 1YEGL 2YPKB 1XGQA 2J6EA 1DQJA 4JKWA 3T0AA 3JV5A 4PLKC 4M5YH 4LU5L 5EU6E 1CGWA 1F3DJ 1RZIA 5C2BH 5JLZB 3D69B 3H8NA 2D31B 5I8CA 4U1NA 5I66B 1LO0H 5E8PB 3V5HB 1MAJA 3QIBC 1NBZB 5T3ZE 2V2TA 1CLYH 4G8EA 4HJGA 2HKHL 4UIKL 4G8GE 1T0PB 1JRHL 4K3JL 1FGVH 1K3ZA 5TQ0L 3QQ9D 1DBJH 3LKSA 3T4AB 2XFXA 3QXWA 3W9EB 5FB8A 1IARB 1GOFA 3HAEA 5I16A 5IB2A 5SWZB 4JHWH 1CLCA 1ZV5A 4KGLA 3L7EA 3WSQL 2XI9A 1R3LA 3BW9A 4LP5A 3NFNA 1FVDB 5D6DA 4P23D 2ESVB 3EYSL 4OF0A 4GAJL 4GRWB 4NO0D 5IMOB 3KYKL 5CZVL 4NWUL 2AXGA 3OAZK 4ETQB 3RA7L 4JO3H 2ERJC 4J23A 2VR5A 1MREH 4LNRB 4PRAB 3SO5A 5D8JL 3VGFA 1X4ZA 3W9EA 4G42A 4D3CH 4QRQA 5JORB 3HUJF 4XHQA 3HE7A 1G9NL 4YC2B 3MLWL 2EECA 3MRNA 3VXSB 1IGMH 4JZOA 5D9SB 1MJJA 3TN0A 1EGJH 1IAMA 3NFNB 2YA1A 4HIJA 5T1LD 2YZ8A 3DV6B 4GRWF 3RY4A 4PJIF 1U93A 3VRLF 3D87B 1R5IA 3QQ4A 1A6VH 2X4TA 4HLJA 4B5EA 2YEZA 3O6FA 2I07A 3IF1A 4KVNL 5J9PA 1H15A 3NZHH 4Y4HB 1YMHB 2DQGL 5BMFL 1KEGL 4YDVB 1B0RA 4JFEA 3VFWA 1UVQB 3ESVF 4K8RL 2IQAB 1F3RB 4HS8H 5H2BA 5TE4H 4KTDL 1FN4A 3INUH 5F9JB 4ZUWB 5L2KE 2PR4L 5TF1H 4QRPE 1WIUA 1U8MA 4OCNC 4O58H 5JOFB 1UACL 5ISZD 4OLEA 5B3JF 1ZGLA 4S1QL 2YUZA 5EZIL 1KG0A 1OW0A 3CVIL 3KS0J 4OF7A 3T77A 2OR9H 2EKSA 1AKJD 2B39A 1N7MH 3CX5K 4LLDB 3DV6A 3T0WA 2MQCA 4G7VH 1LNUA 2XQBH 4FQQA 2Y5TA 2AI0H 3QQ4B 4JY6B 4P5MA 4WTZA 1FL6B 2EXYD 1HOCB 2O61A 2ZG1A 4Q9QH 2Y9RT 3QDGB 1XR9B 4BZ2H 1Y6MR 3FQWA 2JJVA 2R29H 2VB5A 3HA0A 5CP7B 5ETUB 1KENH 3KPMA 3KS0H 5D8JH 4OFYA 4OCRL 4ZYKB 1IC5H 4WO4B 5E08L 1CGUA 5IT2H 2Z9TA 3PL6B 4FTVD 4C58B 5DTFB 1HNGA 4J8RA 2RCSL 5MI0B 3QWRD 2XPGA 2Z8VC 5I8EA 3VXTB 4AY0A 1UCTA 4PJGA 2GI7A 3BKYH 3DSFL 3RWIB 2EDHA 4LGSB 5EPMA 2H6PB 4C56E 1N7ML 2X05A 5BW7C 2DYPB 3FB7B 1QRND 3VD7A 2EH7L 1DFBH 1FVCA 4G5ZH 5FOBA 4GG6E 1A6UH 3RVVC 4MCZA 12E8L 3CH8A 1YC8A 5I8KH 3C5ZA 3OKMB 5FUCE 3SDXE 3V8OA 4WUUD 1IGIH 1L9NA 4NHCH 5J6HA 4OD1L 3U4BL 4G8IB 3BZDA 2XWTA 4AEIH 2VDNH 1G6RA 4MXWL 4TSCL 2VDRL 4GG6B 5F89B 1FP5A 1AQKL 1MCJA 2X4UB 1RZGA 2FRGP 1CXEA 1UEMA 2VDML 5DK2B 1DLHB 5IVZA 4F3FA 4O9HH 1HKFA 1F90L 2Q8BL 4MA7L 4HC1L 4YK4C 3O4OC 4PJBA 5D1QC 1F13A 2OP4H 1FG2A 4NO2B 1XZ0A 2CMRH 2X7LA 4P9HC 1AQDB 2FX8L 5T3ZD 3C9NB 1KEMH 4Y1AD 4HG4K 3U4EB 2Y07H 5I30H 3RPKA 2MTPA 1HHGB 2XTJB 3OKMA 4ELME 3Q6GH 2IQ9L 1L0QA 3GSVA 5IQ7L 4E41E 3K1DA 2N1KA 1KXQE 4WEBH 1RUAL 4PJAF 3QDGE 4HWBA 3BN3B 4ELKB 1JVKA 2CKBH 2EE3A 3OBAA 3QCVL 4RA0C 3MJ9H 3IDNA 1DSFH 4LSDA 4YDLC 4YXLL 1UYWH 5D7JB 3O6ML 1X5ZA 2VLRA 3BOVA 3WNOA 4OKDA 3SKNA 3NCFB 5D7KE 3MV8B 4JFFE 2PCPA 1G7HA 5C0DB 2Q7YA 1FG2B 1DEEB 3TNNB 4TTGA 1OP3K 3BUTA 2XQBL 2AABL 1YEIL 2JJTC 3GI8L 3BQUB 2SEBA 1UJTA 2Z31D 3GM8A 1MVUA 4F9PA 1H5BC 3RL1A 1CT8A 2IH1B 3W81A 5L2KB 1H3VA 3QDJE 4ENEC 3UBXI 2IH3B 4URTB 1U41A 2R69L 1BVZA 1ZS8B 4NQSA 5TE4L 2DQJH 3QZWA 1QBBA 3L9RB 4WDIA 1BJ8A 4W4NA 1SMAA 1P4BL 3ZDZE 1S7RB 1I7RA 4G8GA 4ZSOE 4YXKL 3QPQC 3FQNB 1I7UA 5F7DA 4M9OA 4F9LA 4HIEB 3IXTB 1GAFL 3RRQA 2IALB 2OCFD 3QAZC 4X5WA 3RVWC 4P5TB 3FQTB 2DMBA 2CD0A 2UZIL 3H9SE 3DX8B 5DQ9A 1SYVB 5JR1H 3RL1B 4RMUA 2J4WH 2J6EL 3UC0H 2BMKB 4UUJA 1HXMB 4GS7B 1RY7B 2A83A 1FBIL 3MNWB 1LHZA 3MROA 4X4XB 4WW1A 4NZRL 1U58B 5ILTL 4LRNL 1KC5H 1YEFL 4XAKE 1GGBH 4NIKB 4GRWE 5I18L 3L5XH 4G80B 4HUNB 5EU3B 1F4XL 1I3VA 1LGVA 1RZKC 1D9KB 5GGVL 2AXFA 3MOAH 1AGCA 2X42A 1KUMA 2EO9A 5C0IA 3L95B 3BEVB 3D18A 3RGHA 2A9ML 4XWGL 4Y7MA 4PRIE 4YPGA 5SWZE 1MI5B 1TETH 3U6RB 5FYLL 4JN1L 4F58L 2BVPB 1I9EA 32C2A 3EYOA 3QXVA 3GMLB 4EUPA 4NM4H 3SKJH 4YBHA 3B2VL 2I26N 1NBVH 3QR2A 1PZ5B 5B39A 3MJ7B 3L5WA 3VFNB 4U1KA 5EA0H 1U8OA 1CGXA 3MODL 3JV4A 1A1NB 5FA3B 4R90L 1B0GA 2D7OA 3OKEA 4IIQA 4WHTA 3SDAA 4RWYL 4U4BA 3BMVA 1BBJB 1FV1A 4FQ2H 1A5FH 3WN5A 1YEFH 1AO7B 1S7VB 2RHEA 5KSAC 3V9FA 2AXFB 4M4PA 5ICXB 2YRPA 5MHSD 4NQTA 3CSYB 1RI8A 4GO6B 1YDPA 3RI5F 4WFHE 1M05B 1BX2A 5IM7B 4X6CF 4JPVL 4N8CL 2DAVA 1MQ8A 1AI1L 5I1CH 4ZFOB 1OCWH 2E7HA 3BIBX 5JR1L 3FFCE 3TCLA 5C6WH 1RULH 3GUTB 1M7DB 1N3NB 3VFNA 1X7QA 4UNVA 4PRHA 3CLFL 1E28A 2G60H 1IFHL 4ONFH 1TVHB 4O4YH 5JXEA 4OZIF 2PTTA 5I73B 3RWCA 1NCWL 3QCUL 3QUYA 3N9GL 4HDIB 4P0DA 3MLPA 3QEGL 2BVTA 3VXME 3FFDA 2XZAL 4K23H 2BK8A 3SJVD 3CSYA 1I3GL 2R69H 3JV0A 5DJCB 1MJUH 1TZIA 1YPZB 3E6HB 3MLWH 2XKSA 3DMMA 5DVMA 5B38A 3BWAA 5HGHB 3VDBA 2EIEA 4Y2DC 5EFIB 3GJFA 5ILTH 4QXUL 4M03A 1QHPA 3HZKA 4ZDHA 3TWCH 2FHCA 5FGSA 3X17A 3NA9H 4OLXL 3RU8L 5C0AB 1CE1L 5J1SC 4F7TB 1TTUA 4B7LA 1FNHA 2ORBH 2C3XA 4IRJB 4EZMA 2J8HA 4I1NB 1FYTB 1CS6A 4RMTA 4JO4H 1U8LA 3H6JA 5CZXD 3H3KA 3GSOA 5ISZA 2OXHA 2XZQL 4JJHA 4ERSL 3SQOH 1WZLA 3V4PL 5L6YH 1AY1L 2H26A 2R8SL 1YPZF 3GMRA 3C8KB 5D5MB 1TJHH 1NGWB 4M1CD 2CLVB 5IK3A 4PREB 3DXAE 3QIBA 1DQML 1NCCL 4PJCB 4PV9B 4X98B 3MRRB 3SN6N 1OT1A 3VXSD 3QDJD 5H37G 1XT5A 4JLRA 2BVUA 1YY8A 5EULV 3S34H 4LSQL 2VLKD 4F7CB 2R2BB 5I71C 2EO1A 4KDVA 2I9TB 5FYJE 1VGEL 4U6XB 2YHGA 1BZQK 3U82B 5FO9B 3GSQB 4Q97A 1QLRA 4MX7A 4FFZH 3PHOB 1ZEAH 4IM8A 2BJML 2DQUH 1CBVL 3VFUA 4HK3N 1CE6A 1NJ9A 3STLA 4Z7VE 5IB3B 1NKRA 1SY6H 1I75A 3VJ6A 3L3JA 1CD9B 4JEGB 5IF0B 5IQ9B 1JF6A 1OARH 2YA0A 1XGYL 4LVNB 4PJ7F 1BQHG 4JFED 1AR1C 3SKOA 2C3WA 3ZHKA 3MA9L 1H3WM 2QV2A 5D1XD 4I3RL 4RGND 4OLWH 2AJSL 1OT2A 3IDGA 5E6IB 3D3VA 1JFQH 1INDH 2F5AH 1ZHLB 3O0RH 1ORQA 2E9BA 2DLGA 4ONHA 4RFOH 3FT4A 3RVTC 3ELAT 4N5UA 2UY6A 4EI5A 2EH7H 4YHPA 3WFHA 4JFDD 5EBMA 2QEJA 4OM1H 2HMID 1UKQA 5HYJA 1FYHB 3VFUB 4HJJL 2BFVH 4KKLD 1AR1D 1FYTE 2WNGA 3RWJB 3NCEB 4DUXA 1Q9LA 2ZUWA 3OL2A 3VFVB 2ESVD 4OZHB 1EO8L 2YWZA 3OB0H 4QXTB 2Z92A 5C0AE 3MGOB 2VNCA 5J7CC 4O2EB 2LVCA 3WIIL 3STBA 5I1KL 1LO4L 4EQ3A 5JW5A 1IM9A 4G8EB 1JPFA 5ID1A 2D7QA 4HW6A 4Z7UA 1MCCA 1T66C 3BZEB 4NC2B 1H3PH 2QSTA 4OAWB 4PJAA 4BH8A 5JW4M 1DBMH 2FX9L 3A6CH 1YUHA 4H20L 3LKNB 3PQYB 2CJUH 3QUKA 2OP4L 2VDQH 3QRGH 3VXMB 3I50H 1UZ8A 4MNHA 4D8PA 4M5ZH 2YBRB 1C16A 5D1ZD 5JW4Q 1F6LL 2XY2A 4U1LB 1VFMA 4M6NH 5F1OB 5FK9A 3FO2A 5ESAB 1MI5D 3U9UB 3O3DA 4MA8H 4UB0H 1CGTA 3QHZL 1ZA6A 1IRAY 4A6YB 3CK0H 4KKCC 1GHFL 5ESVA 3GSWB 1N6UA 4LPYA 1RUAH 3KPPB 3OPZL 1FRGL 4TQEH 1G7PA 3AY4C 3CVHB 3QNYA 4Y2DD 1A6ZA 2Q7NA 3QIBD 4BQBA 2E6JA 4PG9A 3MCKA 5IT2L 3GO1H 2NLJB 2CMRL 3DHMA 1NFDA 1ADQH 1BD2A 2V5YA 3IFNL 2OL3B 1ED3B 4PGZA 1D6EB 1S5IL 5D71L 3S7GA 1F6AA 1A6TB 2YKLH 1YMMA 3DVNA 3O81A 4X8JB 5BS0E 4QEGA 4U1MB 4GAGL 2XTJE 4UOW1 3W0WE 4S1RH 4F57L 3KR3H 4NNYA 2NY4D 4LL9A 3QWQB 2ID5A 3LRGA 3HC4H 1NBYB 3MMEB 1D5ZB 2NY7H 1J87A 2AV1B 1F00I 5KBNC 1JPTL 3P9WB 3D3VE 1KULA 4JB9L 3PIQA 2NY6C 4QXGL 1RHHB 3MZTA 5AZ2H 3LS4L 4PJBF 1MHPH 1F11A 2KUTA 3ECBA 3DUUB 5T5NG 5E6YA 4F2MA 3KXFD 2B0SH 1AQKH 1Q9OA 1D6EA 5A2LH 2AEQH 4EI6B 5LGJB 1IAOA 3C8DA 4LLMA 5DRNB 4NNPL 4AMKH 1P9MC 4J3VA 4P4KA 4LLDA 4C59B 1RFDL 4RMSA 2LTQB 1WBXB 4M7LL 5H35A 4JY4B 4JDZB 5IVXA 4C83A 1TIUA 3BDXA 4LEOB 3LH2H 3RWGA 1MRCL 2B20A 3CFEB 3EHBD 5FO7B 2D0HA 6CGTA 4Z0XB 2DQGH 5BMFH 1KEGH 1I8IB 3EDJA 1A4KB 2DIJA 3ZTJG 1PGRB 3P9MB 4JB9H 3VI4F 3O3BA 5DJ6A 4CNIA 1KN4H 5ETUA 1J1PL 3TNMB 4U1JA 2FECI 5ELIA 4OZFG 1MLBB 4XVUD 1E27A 1MEXH 1B9ZA 3UJJL 4MNQD 2QR0B 3O2WL 1SBBA 1F8TL 4ODWA 3CLEL 5DTFA 3K1KC 4YFLI 4KTEL 5F8QC 2ZUQB 1KLGB 1WAAF 3L3KA 2PYEA 2PF6A 1M71B 5I76B 4H5SB 2W07A 2PYEE 4Y5VA 3VFMB 5IV2B 4WV1A 3DVGA 3TBSA 2Q76B 2FB4H 3HKFA 3U0TA 2VZSA 1BP3B 4QHLA 5D6DC 2V17H 3IYLW 4PTUA 3C87A 4NRXA 2H1PL 4OUUA 1N4XH 4Y2DB 1OB1B 2B2XL 3H9HB 5IESH 4HWEL 5GGQH 1I7TB 1HDMA 1S7UA 3BZFA 1NCBH 5HVHB 4HV8A 3L3DB 4JFFB 5BS0A 4I0PC 3QPQD 3QIUB 4LSRH 2P42B 5K9QG 2M8XA 2NY5L 2O5YH 4I77L 4PP1D 1AR2A 3L3KB 4M5ZL 2I9LB 4XVTH 4P57A 4GBXD 1FO0L 3U2SB 3VXRA 3QH3A 4KTDH 2AJYH 2C1PA 1CVRA 1G7JA 1A14L 1GVIA 4K3EH 4PJ7B 4HCRH 4JFQA 5K9OB 5D7JD 5GISL 4NNXB 1DJSA 1NGQL 3C9NA 2A9MH 4XWGH 1CK0H 4IJ3C 4Z7OF 4NRZA 2G60L 4MQ7A 4IBLT 1UT9A 3NH7L 4XPGH 1BVLB 3IDYB 3KG5A 1KELL 4Y16A 4Q58C 3E3QC 5JXAH 3O4LA 5TJWK 3CXHK 5LAXB 4J3WA 5DI8B 4PJDF 2XYCA 3WLWD 1CGSH 3P11L 2GTZB 2NY5C 2LFGA 2OR8A 5EZJA 3BDYL 2HG5B 1WFNA 4WTWA 1KB5H 2IPUG 4H8WL 4LSSH 4WUKH 2PTUA 4P5TD 1DBBL 5C0CD 3KYAA 1MJUL 3WBDA 3IFLH 4V2CB 5DC4B 3X14B 3VGEA 1OW0C 4N5EC 3TA3A 4ZODA 2FO4A 1DE4B 3CCHA 5LCVH 1JNLL 2ESVE 2W9DL 4ZUTB 2DKMA 1JNHA 5HHME 5EOTA 3CFJA 1CT8B 3ZYZA 1BF8A 3BP6B 3BPOC 1CZ8H 2VTFA 4RISH 4PJFE 1Q9KB 3KPOA 1MCPL 5E6IC 4EUPG 4LVNC 1CFBA 3I2CH 4X6CA 3UPAA 4V2BA 3QFJA 4DW2H 2ICWJ 2NZIA 4X6DE 4NKDA 3ZE0F 1N0LA 4Y16D 5JW3H 2F15A 3QUZD 3WN5C 4WY7H 3P0VL 5K9KB 1RK1A 3PGFH 5GRVK 5AWNH 3NPSC 1EAPB 2H8PA 2NX5A 3VXUA 1KN2L 3AM8A 3WDJA 3FAWA 3BH8B 3DETD 1CQKA 5C0BD 1LVEA 1NC4D 4BZ1H 2W60B 4OZFA 1U95A 5L7XH 1Q94A 5L88L 4TVPE 2BMKA 4WWKB 1KTDB 4GAJH 1MNUH 4D0BA 3VRLE 4YFLF 4ODUB 3UC0L 2ARJQ 3FOLA 4XCFL 1OAZH 4OCYL 4X4XA 1HNFA 1RZ7L 4WI4A 1T1ZB 1A6AA 1CU4L 5DMYA 3GBML 4OT1L 1I1AD 4JG0H 5E4EB 3S37L 2OJEB 3L3IB 3LKPB 1TJIL 5I2IA 2GT9A 3FQUB 3GMMA 3WIFA 4HS6A 1I1YB 4PY8I 4IMLB 4KK9D 5E2VL 1ZEAL 3VXUB 1OAXH 1BJ1H 4UIKH 1OVZA 4W4OC 3TYFA 2DYPD 2GK0A 1G7MB 1KPUB 4W6YB 3O8XB 2BSRA 1XGRB 4NRYB 5DXWA 5FM5M 4AIZA 5EIVA 2ZOLA 1FNEA 1U6AL 5C0ND 3FT3B 2ZJSL 2WQRA 2O5ZH 1X5JA 4HFWA 1OAQH 3RWFA 5M94B 1DANT 4R4FH 1MCIA 1ZVYA 5CINL 1K4CA 4HIHA 5C0JB 1U8OB 3ARGD 5J8OA 2OQJA 3MRBA 4JR9H 1T0MA 3WUZA 2DDQL 3Q1SH 1A1NA 2UZYB 1JRHH 3P77B 4J1UA 1RIUL 2B1AL 2DL2A 1AHWA 3C5SB 1BJ1J 3O11B 2F74B 4LSVL 4XRCB 2C4FU 3QDGA 1OM3H 3DX6B 3FQWB 2Y1VA 3QDMA 1EUTA 5E95B 3TVMA 1QG3A 2PW1A 2EDRA 3D25B 5FYKH 4JZNA 5J89A 1LD9B 3IDJA 3UMTA 2I5YH 4BZ1L 5DA4A 3OKDB 4EEEA 2ZG2A 3GI9H 3BYYA 4GSDL 1CF8H 1PSKH 2HKFH 2HT4C 2HWZH 3AUVA 4RSVA 1IC1A 5E03A 2OTWA 5L88H 3UTTB 2IBBA 2R4RL 4DVBB 4E0RA 1OP9A 3MC0A 3QIWC 4GAYB 5FHAH 1NAKL 2A38A 3RDTB 1K8DB 2AQ1A 2FSEA 4MJ6B 1A7OH 4AK1A 1BQUA 5F7KC 3G04A 5CINH 4JZJB 3CC5A 5IGXL 5LKNA 3OR6A 4M6MH 5GS0C 3OTTA 4X5XA 3R06B 5HYJE 3ARSA 1L9MA 3VXUD 2CR6A 2P5EE 3MNZB 1RMFH 4KKAC 3LRSB 5EU7E 3V6ZA 5DJAA 5FM4A 4R2GD 1EZVX 1LP9A 3FRUA 5C08B 3RVUC 4AEEA 4G7VL 1FC2D 5C0CA 2ED9A 3DECA 3VD5A 1IZKA 4GW4B 1A3QA 3OKYA 2OM5A 5EU5B 3L3HA 3DXAB 1G9EA 3CDYA 4PGBA 4XAWL 1T66D 1U8LB 3B83A 4UB0L 3T1WA 1R24B 1AKJA 4YHIA 2RGSA 2FJGB 3F7QA 2P8MA 3DRTA 1LEIB 4XAKD 1NH6A 1W8NA 1J1XH 1PW3A 3SGDI 1LEGA 1DQQA 4KJQC 4OCLC 4ZFZB 5E94A 4PREA 1XIWA 4GLRH 4ZPTB 2FNBA 3GSXB 4KPHL 4LSTL 2OTPA 5INDB 1U0QA 1T3FB 1UWEL 2DM3A 5IKCB 4Y4KD 3QT2A 3UTZB 1N6VA 1DUZB 4OCRH 4PJHB 2XG4A 1CD8A 1TITA 1HWGB 2F53B 1UB5A 1KCRL 4J7RA 5ACZA 5SWSE 3TPUB 5INCB 4RGOL 2YPKA 1OAQL 4RGNC 2ICCA 1IQDB 1XF5A 2FJGA 1KLFA 5ICZB 3P4NA 1FO0B 4H0HB 3U0PA 3U1SH 1DFBL 4LPVA 1BOYA 2F53E 5IQ9A 1SY6A 1KCSH 4OZGB 1CDBA 4UV4H 5F7NC 5LQBL 5HYFA 3TT3H 1TVDA 1FFOA 2FATL 2R0ZH 1KPRA 3O2WH 4GRLA 4OQTA 4HULB 4FFYH 2V2TB 4LBEA 3SGDH 4AIXA 2MHAA 1CFTA 4JJ5A 3LZFH 3MACL 2YC1A 4YDJA 5IBTH 3HI5L 4XXDB 3UTZA 1G7IA 3Q5TA 4I2XE 2VXUL 1ZHLA 3TBVA 5L0QB 5IW6B 1IEHA 4YO0A 5GZND 3AB0B 4XP4H 3I6KA 1UB5B 2NY3D 4HEPG 3BMWA 3EOBA 1AXTL 3LDBC 1FFNB 2FB4L 2FBJL 2X9YA 2XOTA 3FCTA 5BRZE 4YHYB 5JHLH 1LILA 4M7LH 3GGWB 4LLYA 3VFWB 5T3ZH 2R0WL 5DDHB 1I9JL 4M1CC 3C08H 5C0EA 1FN4B 3CSGA 1SYVA 4PJ8D 4JO1H 4PJXE 5C08E 4PRHE 2MWCA 5CMAB 1BLNB 3I85A 4MXQD 5IWLC 1IM9B 1A7PH 1DDHA 1TLKA 5FUCC 4NGHH 2HLAA 1F58L 5B4MC 1AFVH 1INQA 2AGJH 1DQLL 2DLIA 1PD6A 3ZSSA 2V5SA 2EDEA 1EMTL 4XNXH 4PLJC 4D94A 4LIQE 4ONGL 4G6ML 2DQHH 5T1MB 1S9WB 1A4JA 4OZFH 2W9EH 1RFDH 4MQSB 3VXOA 4J2XA 4J3UA 1ZT1A 2BVPA 32C2B 3KPMB 4ODXB 12E8H 5DD5H 4HIIA 3W11D 2IC2A 3FOMB 2CKNA 3QISA 2V17L 1QSFE 3VXRE 3ILPB 3F65A 5I1DB 1CWVA 1GGCL 3GKZA 3LCYA 4X7TA 5FKAA 2VXTH 3QG7H 4WTZG 5T1KA 2CIIA 5F3BA 3DWTA 4PJ5B 5DQDH 5HHXH 2CJUL 4XP4L 3ZHLA 5KOMC 2Q20A 3EYUH 4U1HA 4AEHH 2W1NA 5DC0A 3U36A 5C9JA 1VSCA 1FCGA 1X6LA 4UU9B 3H9SD 3QUMH 5GIRB 1YDPB 5I75C 1Y6NR 4X6BA 5C7XH 3QFJD 1SJEB 5HVGB 2D2OA 2JB6A 5DMKB 3EYFA 4YGAB 4R8WH 4YIQA 2DWEB 4OGAD 4WU5B 3TO2A 3TBYB 4NO0B 4F8QA 3MR9B 5F89A 3GSUA 1CXHA 3GUTA 3VFOB 4N5ED 2FYYB 3H3PL 1F5WA 1GGCH 1KCSL 4I77H 4JRXB 3O0RL 3MO1B 1WTGT 4Z7UF 3RWDB 5ANME 2HRLA 1KSRA 5GGRB 4LDLB 3FFCB 4JFDE 1A6VL 2R1XB 1V3KA 3LVEA 2FZ3A 5CJXC 2AABH 2ZCLL 5CP3H 3L5JA 3BD3A 5HBBA 5CAYB 5GRYA 3CNKA 2CRIA 5FHBL 3T3PF 3TBYA 2V9RA 4Q6IB 4BUGA 4ORGA 2ZPKL 4ZS6D 3W39A 1NGZB 5IB1B 3T0EE 5EBWB 3SDXA 1C8PA 3ZE0E 4JANB 4FFWD 4I4WA 5IHLB 2ED8A 1XH3B 4K3GA 4GBXC 4OBSA 4MDIB 3JV6B 3SE4C 4PGEB 3QUZA 5EC1A 3ZKXB 3WLBA 1UWXH 3SOBL 3LQZB 1J10A 3QIBB 1MI5E 3LKRA 1T1WA 4PGDB 1LO5A 5ERWA 2IH3A 2VZ1A 5DQDL 3SDCC 2ADGA 5HHMB 1QA9A 3KNBA 3LD8B 4JHAH 4DGYH 4JDTL 4X9IA 4DKEH 5I9QC 3LEYL 4F15B 4EN3B 3ARXA 3BGFC 4WU7A 4JFDA 1QLEL 4JRXD 5IF0A 4TNWK 1KB9K 5CGYC 3HNVH 4ODSH 2FR4A 3QH3B 3K8KA 6FABH 2W9EL 3T4YB 3OJDB 4PJ7A 3WHXA 1BFOA 3NPZB 1LO5B 3F58H 1M7IB 3F7VA 5D2LF 1R5VB 3GSRA 1MCDA 2BC4A 2VAAB 4F58H 3IFPB 3EO1B 4MD5A 5T1LA 1MVUB 4KI1A 4TSAL 3TWCL 3W2DL 2FH8A 3WFHB 4Z7WF 4C56D 5JZ7D 3TZVC 5FHAL 1NFIA 2E27H 1IAIM 3NIFF 5CJQL 2P7TA 4WUUB 2QADD 2EIZA 2GTZA 1P69B 1BZ7B 2EXWC 5EBLA 1E0OB 2GJ6D 1BWWA 4ZUSA 1MI5A 2DKSA 2AXGB 1UCBH 2HLFD 4HS3B 4OGYL 3UBXB 4EUPB 5ID1B 3WFZA 5F1IA 3G5VA 3OR7A 3TA3B 1YUHB 4O5LH 3IFPA 4Z77A 3O2VH 3M07A 1DE4A 2V7HA 5GRJL 3V2AR 3VXSA 3E2HB 1AD9A 1AXSA 1FORL 2E7BA 5A43C 2V5RA 4HUKB 1CICC 2N7AA 3RWHB 1NDGB 1HZHL 3O3DB 4MA1B 1I7ZA 3VRIA 4HBCH 3CXHJ 4KI5E 1PBYA 4OF6A 5AUMB 4E41B 1B2WH 4LHUG 5KJRL 2CDEA 4LGRB 1YMMD 3LAFA 2P43B 3PWPB 4KXZH 4KDTC 3FRPA 4XNUL 1RSFA 4H20H 4KDWA 3AROA 5HYIA 2Q86A 2HJLB 4P49A 4MMXC 3WNLA 4RFNC 4MS8D 5TPWL 1LK2A 1W72A 3WE6B 3UJTH 1S8DA 4UILL 3QO0A 4W70A 4S0TD 4WO4D 4AH2A 2CRMA 3ARFB 1RMFL 4QWWC 3B6SA 1G1CA 3PV6A 2EH8L 3WS6A 4Z7QF 4BQ8A 3SGJA 4L9LA 4LU5H 3Q0HA 4Z9KB 4FZEH 2AXHA 4ZOCA 1X9QA 4V1DE 5KTEL 1FJ1A 5LWYH 3TO4B 5ENWA 5F3HA 2IPKA 5T1DH 3H9YA 5CEZE 5I1EL 1Z0MA 5KG9A 5IROA 5KSVA 2VDPL 4M7ZB 5B38B 4FFVC 2KQNA 2CO6B 1GCFA 5C07D 2CKBL 4M7JH 5I2IB 1MIML 4PJBE 4DN4H 1XGTB 1W72B 1FE8H 3MLTA 1XGPA 4Q0XH 3S36X 5E1AB 4CJ0A 5GS2H 3NIGE 4Y4FA 1JZ7A 3B6SB 3PV6B 4PJ8A 1YEEH 3DURB 2ENYA 2VZUA 2HT3D 4MA8L 2AEPL 4I8DA 3L7FB 2DTMH 1LK3H 2GYSA 2BY1A 2XA8L 4EXKA 1AXIB 1NLBL 1HH9B 4OLVH 4LRNH 2H26B 4NO3B 1OAKL 3RZWA 5I1JH 2E8YA 1M7DA 1N3NA 2Z8RA 5C09E 2J8OA 4CMMB 4GUPA 1BECA 4N0FB 3QWOA 4GKNB 3W0WB 3BP5A 3K3QA 5DEGB 1N5AB 2Y72A 4U6HB 2YXFA 2BVOA 5FO7A 4OZ4A 2XV6B 3EJJX 4ELMF 3DV4B 1P4BH 1IKNC 4KZDH 5J13C 4U6XA 5FO9A 2EE2A 1JYWA 1CG9B 2PW1B 3MRMA 3ORJA 3ZZ1A 4MCYA 4L1DA 5HYQA 5EOQH 1PVHA 1GYAA 2Q8AL 2W0LA 4HQQL 5I1LA 4LCCC 4FTVE 3BN9D 2J4WL 2J6EH 4KRNA 3GZKA 4CADB 4J4PA 1H9VA 1QR4A 1DBAL 3BSZH 2V9QA 1HZHH 4YE4L 2X4OB 1CE1H 1FYTA 1GGUA 5FA4A 3UCRA 3BKMH 3X3GL 5ISZB 4DCQB 4OD3L 1J1PH 3G6JE 1DN2A 3VW3L 1KIRB 1NFDE 3B5HA 4WHDA 2RJMA 1BGXH 3G6JF 1WWAX 4FABL 4MD4B 3ROOB 1BIIB 1REIA 3L1OH 5TE6H 4H25B 4P23C 3MRFB 5EBMB 5IOPB 3FN9A 1I7TA 3ME0A 1R3LB 1K2DA 1AIFA 1KN2H 5A16A 2NY1D 3ARYA 5ID0B 3EJZC 5D2NC 1KCUL 3GKWH 3WIHL 2G5BA 4ONFL 1Q1JL 3S4SB 3MRLB 4CADA 5IB4A 2IG2L 5EDXA 1G7JB 3ARUA 4NUGH 4QOKD 4NNXA 1UEYA 1QFUH 1DQJB 4BFEA 1BM3L 1YYLL 3VXPA 1FIGL 3FFCD 4HWZA 2AV7B 4N1EA 2NY3C 1J0HA 3T2PA 3BAEH 1DQTA 4NKIL 1FNSL 5ESQB 3KJ4C 4ZUUB 5CUSL 5EO1A 4MXWH 4TSCH 3MJ9L 4W81A 5E94B 2ZKHH 3QUMA 3PWJB 1K2DB 2YD5A 5IMKA 1G7QA 4NQSB 3ZKXC 3O9WB 1D5IH 1CLZL 2CGRL 3O41B 3AMLA 3VWKC 1YZZA 3DOSA 4FXGB 1TNMA 4G9FE 4NQCB 3LH2L 4BM7A 1F8TH 3MUY1 2WUCH 1D5BA 5DMJB 3TPUA 4U33A 1HXYA 1D5MB 3UTSE 1IVLA 2O5XH 2ZPKH 3RKDC 1GC1H 3CFKA 1MFAL 4O02L 3Q2CA 2FD6H 2OSLB 4ZMAT 2RR3A 1ZLUH 5ADOL 4Y19D 3V6BR 4XMPH 3TC9A 3BP6A 4Y4KC 2EYTB 5IG7A 3QUMB 4U3XA 2PXYD 4LAJH 5DD6A 2GSGA 1I9RH 4JGUA 5IW3A 2P5WA 4NQCA 2VQ1B 3G6DH 2D03L 3VGHA 1A14H 4K3EL 1WFTA 3T3MF 3DO7B 4Z76A 3BGMB 4S1DC 5DUBB 2R0KL 3HE7B 2VLME 2WINA 1TPXC 1CICA 2JJTA 3MRNB 4X6CE 2D4FA 5ESAA 5DHYB 3QG6A 1YEJH 3LPGA 5FF6A 2R9HD 4ISVB 4HWEH 1YEHH 2ZUQC 3MRQB 2HT2C 3V0VA 2H2SC 4DTGH 5T3XE 3JUZA 3SHSA 4PRPA 3GMNA 1MCHA 5FKPB 4EDWL 1Q9OB 4DJMA 1BREA 1L0YA 4D0BB 4CW1B 1HILB 5E00B 1HYRC 4JFEB 4UOW0 3E6FB 3H0TA 5BQ7A 5I1GH 1INQB 5J12C 3VXUE 4P46A 3MCKB 4X83A 4L8DB 1OQXA 1R5WB 4L9LC 1FFRA 2AJZA 1BD2B 3WL9B 2LV4A 4WFED 1C5DB 5IHZA 1CICB 2P5EA 1HHKB 4O9HL 4PV8A 5EUKA 5FV1L 4RBPK 2VUYA 4X0KA 1I1YA 43CAB 3DBXA 4O51A 4RDQF 4ODHL 5HHMD 4YAQA 5ECJE 3FONB 5I1KH 1JFQL 2F5AL 2NY0B 5FGBC 1GL4B 2GJ6A 3AREA 3E2HC 5JMRA 2I60H 3LN4A 4JE4B 3KYMB 4ODXA 4OF3A 4J3XA 2WBJB 4D9QE 2ZOKA 1KJ2L 2R2HA 1ZLVH 1XGYH 1FYTD 4Y5VC 1MRFH 2O93L 3NIFE 3PV7A 2VDKL 1YYLH 5F44A 1MFEL 1G7LA 3WFEH 2BY0A 2LVEA 3QIWA 1QPXA 1FG9C 5ITFA 4JQXC 2R23A 1AO7E 4K3JH 3LMJL 1TTGA 4DGVL 4G6MH 1J88A 4X0KB 3EW3B 4RRPG 4U49A 1EFXB 4OD2B 1Q72L 2X1PA 2KZWA 2X5PA 2AK4A 5KAQF 4GKZA 5TDOB 1JZ5A 5GS0H 4GXUN 2BNQA 2HLFC 4PJFB 3V7AG 2VLLA 3BZFB 4OFKA 1NC4B 1RZ7H 2EYSA 3MR9A 5I71B 1IGJB 1FAKT 4ZOBA 2ZSWA 3P9MA 3V5HA 4POYA 2B5IC 4PJ9D 2FYYA 1MHPL 5CJQH 2VL4A 4ZAKD 3DGGA 2V2WB 5C2UB 3BO8B 5K9JH 1DBKL 4TQEL 1MQKH 1RIHL 1FVEB 2YSSA 35C8L 5E8DH 4JKPH 1C5BL 3NCYP 3IGAB 1I8LC 3NPSB 3FB5B 1L7IH 5SWZA 2FZ3B 4UIMB 5J06A 2Z91A 3QNZA 2IFGA 1IC4H 3JTSA 4NQVA 4NCDA 3WKMH 3IS0X 3WJJC 4ZG1A 1GGIL 1FZJB 1H3TA 4ZPVB 1FVDA 2OK0L 5KJRH 5JXED 2ESVA 1QP1A 3KPSE 1TNNA 2DQCH 4G6FB 5EU5A 2L7JA 4J4PD 1YEKL 4QXWA 5EBWA 4MJ5A 4ETQA 5IVNA 5LXGL 3O3AB 3EKCA 1ZHNA 3TZVA 3WEXB 2IADB 4L3EA 1AFVL 3S36L 4EDWH 4X5WB 4Z0BL 1ZE3C 2IAMC 3NCMA 4LCYB 1U8JB 1EJOL 3VXQA 5D6CB 2E3VA 2QQQA 4NT6B 4NN6B 2ZUYA 2C1PB 1HH6B 4HGMA 4PGDA 3DX7A 3TVMC 5INDA 4OLXH 1QBLH 2YR3A 4P2RE 3UPRB 4K9EH 2VDPH 5EO0B 5E8OB 5JIPA 1AGBB 4ZXBC 3MXWL 4CN1A 5MENA 2D0GA 4O4YL 1KNOB 1UFUA 4JM4H 4R4ND 5GJTL 1P7KA 4P2RB 3EDDA 4I0PA 3L7EB 4L5FH 3PHQA 4POZC 5C0BB 1XMWA 4KUZH 3BD5A 4OM0L 1IKFH 4JFOA 1RK1B 3RNQA 3CFCH 3VDCA 4JM2D 4BSJA 4NM8H 2ZZUT 3QDJA 3BH8A 2BVEA 4AZ8A 4G8GD 5TPWH 2KBGA 2GAZA 1NCNA 1OWRM 4LKXB 4LHUA 3GMPA 3EOTL 3OJDA 4LVHB 5F72S 4U6VH 4XCYB 3SDDC 3BZEA 5DO2C 3NGBC 4XVSL 3ZHDA 4AG4L 4TUJB 3B5GA 3SDAD 3BPLC 5IW6A 4OZGF 4NHUA 3I6KB 3R0MA 4ZUTA 3S37X 2FGZA 1T1ZA 3FT2A 3KWWB 3UTPE 3EOBB 2AJ3B 5GS1B 1TQBC 3WYRA 5DT1H 4P2OC 1PG7W 2W9DH 3JWNC 3RDTC 1OAKH 1NFIB 5D7JC 1QSFB 3U9UA 3TF7C 4RRPA 2NXYD 3MRGA 3FMGL 3MCLH 2W0PA 2CUMA 5EU7C 3D39B 1IGYA 1N6QL 3FQRA 3BT2H 1WIOA 5HI5C 4NM8L 4I0PD 4MNGE 5E2UL 4QHUA 1KJ2A 3VWKB 4ZXBA 4Z78B 1DUYB 1K6QH 1ZOXA 3JSSA 5JW4N 1T20A 5F7HA 5L2KD 1S7TB 3G5YA 5JDSA 5CJOH 2FIKB 1B90A 4LLVA 3U4AA 2CDGB 1NEZA 1PG7H 1CLOL 5DWUL 1CF8L 1PSKL 2HWZL 2XQYG 5C0JA 4JVPA 2OL3A 4YHNB 1HCFX 2VDOH 2YA2A 3H7BB 4YGVA 2MKLC 3MLYH 4YJZL 2VE6A 1T6VN 2OTUB 3N1GC 4HH9A 3IDUA 5JQ6L 2F8VA 3NZ8A 1RK0B 3PNWB 2P1YA 4M7LT 5T33L 3HMWH 1NBYA 3MMEA 3T0DA 2E6PA 3I75B 3WCYA 4AQ1B 4JQIL 5FM8A 5DD1L 2CSPA 1JHTA 2NY5H 2O5YL 4PJDA 5BRZB 2NCMA 3NN8B 3WS3A 3WNNA 1ZGLP 2BERA 2QTEA 4K9EC 2BNUB 4BJLA 3EOYG 2D4DA 1IBGH 3TIDA 3ALWA 3IFLL 2IEPA 3QHTC 2R9HC 1CXIA 1U42A 3WD5L 4Y4HC 1RJZA 4IIQC 3ZKMC 5CSBA 2ARJA 3PWLB 5KSAA 5DMIH 4DVRH 3P11H 2CO7B 4KRPC 4JG0L 3C2AH 1EJOH 1B4JL 4Y5XA 1YJDH 1SEQL 3S9DB 3SJVA 1CDCA 3RY6A 5HGDA 3GSQA 4JFPA 1Z5LA 3TNMA 4PRNA 5HGHA 5IFAH 2WBJC 3DURA 1IEAA 3OKDA 3RWDA 4P2QD 1QHOA 4HPYL 5KTEH 3BQUA 4Y5YA 1MRCH 3FO9A 1M71A 1QSEE 4Q9CA 5I8CB 2E7MA 3MZGB 3A6BH 5I66A 4KMLB 5JQ6H 1BQHA 4OV6F 5D1QA 1CR9H 1A7NL 3B9KD 2H32B 3DVGB 3TBSB 2BSTB 2CXKA 4NHCL 3IDGB 3RIAK 2PXYB 4R4BB 1KTLB 4M7JL 3LEXA 4TUOB 1DR9A 4MDJB 3DMMC 1WJ3A 4DN4L 3VWKD 1H3XA 1IQWL 3C60B 4PRNB 1X5LA 4J3SA 4S2SA 2JJWA 1X5HA 1RUKH 4MLIA 5F88A 4UTAH 4KK6C 1S9VA 3P4NB 4P57B 3GBLA 1YECH 3TJHC 5DQ9B 4KRPD 1FDLL 2DJSA 5J3HC 3SDYH 3U46A 1VEOA 3V0AC 4LCIL 4K7PX 2EH8H 1J86A 3ZKMD 2H32A 4Y1AA 4WHYG 3VJ6B 1A9EB 2P48B 3KLDA 4OAWA 5CKAA 5E8EB 4G9FB 4R3SA 3E1F1 1FZOB 4LSUH 1A22B 5KZCD 4P23A 1RD6A 2P47B 1V7ML 3S88H 2YWYA 1NCTA 5D5MF 1FO0H 3WHE0 4XNQB 4LARL 1P4LA 5C0IB 1YQVL 4XP5L 1T7YA 1MFCL 4LEXH 4JPKH 3N1QC 3DTXA 4K7FA 5AZEH 3GI8H 1Y0LA 5F7EH 4BK4A 3KPPA 3ES6B 5CCKL 3BH9A 1YN7B 2H3NB 4FN0A 4E42B 5IVXF 4JHAL 4DGYL 4YWGH 4YLQT 3D2UB 3H3PH 1N4XL 5IBLD 4WFGD 5EOCL 4FMFA 4P3DB 1CL7L 2OJZL 5HDBE 4FQJL 5T5FH 4WHTB 5AG8A 5GQBA 1YJDC 3F62A 4NOFA 4WWKC 1RIHH 2IPTL 5HDBF 7CGTA 3GBNH 5J1AB 2NW2A 5JUEH 2K1MA 3O9WA 1RHFA 1LDPH 4XXDA 3ARVA 4FXLA 1DP0A 4POUB 5EBLB 3O2DH 1M05A 1DBKH 1MH5A 4Z8FL 3O6MH 43C9A 2YD9A 3IS1X 4HFUL 1YN7A 1SJXA 4U3CA 3ULVL 2H2PD 4JDVA 3DHJA 4PP2A 3G6AB 1JYVA 5FKAB 2ICEB 4X7DC 4FTVB 3K4ZA 3GSWA 4N8VG 2DL9A 5H94B 2ZNWA 1HINL 2KDGA 5KVEL 3VE0B 2J88L 2EYTA 3HE6B 2BVQA 4WO4A 1QKZH 4YXLH 1NFKA 4HDIA 5B39G 5DD6B 1P5VA 3B8SA 3FOLB 3MJ7A 3BJLA 5DC9B 1HIML 3VG9B 5CJ8A 2A9NH 4YHLH 2CDEB 4JDZA 4LEXL 1SJEA 4N0UA 3MOBH 3IXAA 1XR8A 5D7IF 2VDMH 4FFVD 2EKJA 4BH7B 1LK2B 3WFBL 2HA1A 4FQCH 4Z7QE 2FJFA 2A77L 1IZJA 1ONQB 1ZVSA 4JDVB 1L7IL 4MHHG 2I25N 3G6AA 1MNUL 4NWUH 4GS7C 4FQIH 5DD0L 4P99A 4U1JB 4OQTL 5D7IA 3O8XA 3VD4A 3MV9B 4GAFB 1NDMA 3G9VA 4PB0H 4QF1B 4ZFGH 1RURL 2AK1L 5A2KH 5DS8A 4ZO6A 4P2QE 3OAYH 4LASL 5E7BA 3H0TB 3KLHD 1PKQA 3T0XA 4QGYA 2OZ4H 5HGAB 4LAQH 4X6EA 3SGEI 3B9VA 3VMOA 1HSAB 1TVHA 4PJBB 4FQXA 5JPMB 1FGVL 1U91B 5TQ0H 3X13A 3LY6A 4UU9A 2QQLL 3ARED 1TQCB 5HHOE 4MA3B 2ERJB 3BGFB 1I3RB 5B22A 4RWHA 5FCUL 5EFIA 4JKLA 5F7WC 4W68A 1U8HB 5F7EL 1CL7H 2FLBT 1G1YA 1T1YB 5DS8B 1JGEA 3GO1L 3G5XA 1QO3B 4DVBA 5BJTB 2WWKT 3QUZB 4NUJA 3SKJL 3QWOB 3QHZH 5L9DH 5GRUL 5I1AA 3K8LA 3BHBA 5JNYA 3TT1L 3NCJH 5DJ0A 2XXCB 4M48H 4ZSOB 1BAFH 3DYMA 4ZTOH 1QNZL 3AFLA 3I50L 3L3GB 4KK8D 1P2CA 4TTDD 4D0DB 2NY7L 1EEQA 3HLAB 2RCSH 3AU1B 1NPUA 4IS6A 5FOJA 2QBWA 4ODHH 4F80A 5DSCB 3CH1B 2VLKE 5LG1A 4CVXA 1XCTB 2NY6B 3TH3T 1A3RL 1WZ1H 2A74A 3RFZC 5GGTA 4KZEH 1ZS8A 1BOGA 4PJ9A 3SDCB 5DJXB 4MXVF 1NAMA 1KIQB 2YKLL 2I9TA 4NC1E 1RZKL 3SGKC 2DM4A 4NUJB 1WC7A 1IEBB 1U8KA 1IGCH 1S7RA 5GPRA 1QBML 3PHOA 5A40E 2PO6C 2HVJB 3THML 5I74B 5DVNA 4OZIA 5ALCH 1BFOB 4IOFC 5IB3A 1J18A 2Q3AA 2XACC 4YHIB 4EN3C 5I19L 1WWBX 3EZJB 3DXAD 2X4QA 2D31A 3I6LD 3UTQB 3DX9A 1GPOL 1LE9A 2NW3B 5E8PA 3VXMA 5HHPA 4IS6B 1K4DA 1LEKA 5AWNL 1UH4A 3G6JA 4TNVF 4XZUB 2EZ0C 3ULUL 2CKBA 3B9AA 3ULVF 3ARFC 4YC2C 3FO2B 5IB5B 4UBDD 3QO1A 1LMKA 3B3IB 4U6TA 2WK2A 2ITDB 1BD2D 2V9TA 1WBYA 2HH0L 2L0DA 1LK3L 1U93B 2DM2A 1IM3B 1FH5H 4L8SA 4Z95H 2WIIA 1VACB 2UYLB 4G80A 2Z4QA 2DIAA 5C0AD 4NP4L 5HSFA 1B0RB 4GQ9L 3MA9H 1KFAH 2ZUSA 5GGQL 2CLZA 2NX5B 4TVPH 1YQ2A 3CFDA 2W0FB 4Z5RA 4EBQL 3L5HA 2E7LC 5SX4I 4PD4K 4BK5A 5ALBH 1ZGLB 5D96C 5CZKA 3SGKA 4UT6H 4BH8B 1FL3A 1I1AA 3WKML 4DAGL 2ITDA 1QTYT 5F8RC 2YUVA 2YBRA 3V7MA 4L4TD 1RUMH 2X70A 1IBGL 3V4PH 1XF3B 1KPVB 5C1MB 2IANB 2VZVA 4M6AA 2H2SD 1D5MA 3W2DH 3VFRA 3BSZL 4JO4L 2C1OA 3HMXL 1VPOH 3KDMA 3HMXA 1KEML 3MFFB 2W0FA 4Z5RB 1F11B 1BX2B 4LLUA 1SVZA 4RX4D 4JPWL 1JHLH 1MHEA 4NKDB 5C6TL 4M1GH 2EDQA 5MERA 2F54B 1NMAH 1J1XL 3IJSB 4NQEE 4RQQB 2CDFA 5E99H 4OIAA 3QRGL 4IDJL 3FT3A 2JF1A 5DFVC 5AD0A 3D5OF 3HZMA 4OIBA 2GTWB 1T89A 4CL7A 4PJGB 5F9JA 4PD4J 4DKEL 2K3TA 1NUGA 5HGBA 3QCTL 1KPVA 5CD5C 1S9WA 3RWCB 4ALAH 3M8OL 4QTHB 2AERT 2B8OT 5A3ID 2F74A 1KB5A 4TNVK 2NTFA 4G9DB 4NNYB 4WUKL 5HHOD 2Y6SC 3FO1A 4HBCL 4MAYC 1IT9L 3AREC 4OCXL 4F37K 2XWTB 2FLRT 1HOCA 2R8SH 3FTGA 3ZTNL 4ODWB 3FL7A 2O61B 4ZDHB 5LCVL 1T1XB 3CPLB 3GRWH 3HPJA 3IETA 5EUOB 2P46B 3EFDL 1CGSL 4Q2ZA 3ARFA 3RY6C 2AJUH 4GUPB 4FXKA 1CLZH 4DZBA 3O8XC 3BP5B 2GK0B 3PQYE 1A8JH 1QSEA 4CMHC 4RIRA 2FWOA 2BSRB 3OAUH 4HT1L 1CK0L 4NRYA 1NSNH 1ZHBB 3A6OA 4Y5XC 4TUKL 5DMGD 4TULH 3WV0A 1KB5B 2GSIA 5KS9E 5L8LB 2XPGB 3HC0B 2EYRA 1YEKH 3VG9C 2YD1A 3B2VH 3P9LB 1D7FA 4JY4A 1KJVB 2VC2H 5F71A 1JZ6A 3SE9H 3GIZH 3ROLA 3PGCA 1MWAB 3HNSH 1CIUA 1U9KA 3BKJL 5KN5A 4NO0A 3LIZL 3QIUA 4Q6IC 3OPZH 4NQDB 3CPLA 5AYQA 2G2RB 2GUOA 1KYOJ 3LN9A 5BW7A 2VISA 3AS2A 5IVOA 3O3BB 5DJ6B 1LWRA 2NY1C 3KJ6L 3VXRB 3P30L 5J6HB 1U3HB 1WZMA 2A6JA 3VFTA 4P2RD 3F8UB 3MOQA 4JHBA 4EIGB 3BP4A 5CBEB 1R3HB 5EA0L 3ZMRA 1NGXB 3ALPA 2V2XA 2BFVL 4GKOA 1T03L 3NZHL 1K5NA 1RJZB 2YXMA 5KSBE 3PDOB 4GKNA 4JREB 3W0WA 2X2YA 2HJKB 4OM0H 3HR6A 3PGCB 2YD2A 4R97C 2OR7A 5FM5O 5EB9A 5TE7L 4HXBH 4E41D 4UAOC 4XC1H 4Y4FC 4EBQH 4WI3A 1KC5L 4LVOC 1Y18A 4LSPL 3D9AH 4ALAL 1OM3L 3R06A 2JCCE 1HSBB 4CBPA 3P0VH 1VEMA 3MRMB 1I7UB 5F7DB 1N6QH 5I1IH 4YH6A 4QYOA 5B3JE 2J5LB 4HKJA 3EZ8A 2FH6A 4QRRE 4Y4KB 5HYQB 3AXLB 5BS0B 2VWEC 2WIMA 4OZHA 1P4IL 5KVFL 4PJEE 2I9LA 2VLRB 3MV11 3MGOA 3IDMA 2V2XB 3IGAA 3UO1H 3MTRA 5GGSY 1X5IA 5F93C 4NQVB 2J2ZA 3Q5YA 1X4XA 5CHNA 2Y5EA 4DCQA 1F45A 3MGAA 3QEQD 2XZCL 1G84A 1I9IL 3LEXB 2XG5A 5F1SA 5LVEA 5JHDB 3EDKA 5D7SH 5D1XB 1NCBL 2CXGA 4FP8L 2FHFA 25C8H 1M7XA 3WFBH 1G0DA 1L6XA 4IDJH 4WNQA 1VCAA 3KPSA 1W0WA 4UT7H 1T5XA 1S78C 2IF7A 3AY4A 3K81A 5D2LB 2M1KA 3HRZB 3RGVA 4TPRL 2QQNL 5D6CA 4AMKL 4U31A 3CMOH 1BD2E 3LPWA 3HZVA 3VDAA 2YEZB 3GKWL 2JB5L 4WWKA 5J9PB 1I8MB 2PTVA 4KKAD 2VABB 3GSRB 2BC4B 1IQDA 1XF5B 3RVXD 1MCQA 5ICZA 3D85D 5DD3L 3Q3GA 1TVBA 2BHZA 4M8QA 3O6KL 5IFHL 3JV4B 4I0PB 4DGVH 3S6CA 2LQRA 3T1FB 2GT9B 1Q9KA 4WNQB 2ZSVA 3WIFB 3K7UA 1JPGA 3KPSB 4MA7H 3T77B 3B43A 1OWWA 1HI6A 4PJ5E 2VDRH 3EOAB 4Z7NE 1WFUA 3BRDA 1MHCA 4HXBL 2ICWB 1A02N 1FQ9C 4MS8C 1OTUC 2VXVL 3VMPA 4HX1B 5EBGA 2HT4D 4RAVB 2F54D 1P7QB 3CMOL 1ZHKB 2ZOLB 1U3ZA 1NGYB 4L4TE 3OKKA 1B6UA 2NY2B 4HIXL 5MEQB 1UWGL 4U1GC 1GZQB 3TGXA 2BRRH 4P46B 1WEJL 2CIIB 5F9AC 5F3BB 5KSUA 4HIHB 3THMH 5SWZD 1R5WA 1I85C 4CU8A 2AJ3A 3BI9X 3RHWK 5CMAA 25C8L 2AKRA 2NW2B 2OZ4L 4Z7OE 1AHWB 3C5SA 3O11A 3QEHB 3TFKD 5FO8A 5JXAL 3QFDB 4QHNA 2VN7A 2EDBA 4DKFL 1YQVH 1T21B 3H9ZA 3ZKQD 3L3IA 1BWMA 4YUEH 2QHLA 4S0SD 4P48A 3F12A 2DTSA 4HS6B 3ARGC 1JI2A 1IGML 4OKVB 4M62H 3FB6A 4U7MA 4HFUH 5FF6B 4LLVB 3SDAC 4QY8A 1CFVL 4OI9A 3TYFB 2FSEB 4MJ6A 1I1RA 5D5ME 3HPLB 4EVNB 5HPMB 2NZ9C 3IU3B 4NZUH 1G6RB 5TQ2H 2C3VB 2Y23A 1FFQA 5T1KD 5D5MA 3VGAC 2XZZA 5C0GB 3U9PH 3IDIA 3V4VH 4GKZB 3MUJA 1GGYA 1MCOH 1RU9H 1BAFL 2EC8A 5LQBH 2YPLB 3V6ZB 1U3JA 5E5MA 4FQPA 1I1AC 4OZHF 3MRDA 3QUYB 4KKBC 4WV1B 4RGMC 1UACH 3MUZ1 2WZPD 3GJFK 1U8NB 1IC4L 3FONA 1MJ8L 2YD6A 5H8DA 1FRGH 3F7YA 3PWUB 3D25A 1JI1A 2ZG3A 3AREB 4LKCA 4M62L 1N64H 1MVFA 4ZS7L 3D85A 1A6WL 5E9DE 1GC1C 1L4IA 4HBQA 7FABL 2WBJA 2CK2A 4YIQB 3DLQR 2XXMB 4JHZA 1EBAA 1IC7H 1S9XB 4OFDA 2CIKA 4DKDC 2YZ1A 4OJFL 5EN2B 4PTTB 5EC1B 5FYJD 5EZOH 3AS1A 4WTXA 3HC3L 5KSBA 2L7UA 1K8DA 5C0GA 4AJ0A 4ZFZA 1T7WA 3EGSB 1EEUA 4R96B 3C6LB 2RAMA 3EUUA 4FQJH 4Y16C 5CGTA 5T5FL 1QVOA 4GMSL 4RAUB 1DUZA 4M43H 1HEZB 1IAII 1PQZA 2XFXB 1UZ6E 1IJ9A 4I18A 3QUML 1UWGH 3RU8H 3LRSA 1ZLUK 5LAXA 2OLDA 15C8L 4EN3A 1A64A 5DI8A 2ZUUA 4GBXB 3QP3A 1CU4H 1FNLA 2VLJA 1GHFH 1INEH 5HYJD 4Y5YB 1A6UL 1U36A 2ZJSH 3KPNA 4MX7B 2R0LL 3QZWG 1J7VR 3STLB 5DJ0B 4KQ4H 1KTLA 4UQ2A 3DNKA 1YNKH 1DQDH 1YEEL 4PGEA 4WFFD 2NY3B 1A7QL 2D7TH 1WWCA 1CN4A 4QRQB 1HIMH 4MNHB 1RQ5A 1P84J 4DOHB 3OKOA 2X9WA 5C8JB 3VU2A 1PX4A 1CGYA 1RVFH 5DRWB 4WFEE 4K7PL 4XP9H 5HVFB 3BE1L 4MLSA 4F7MA 1KN4L 4R4NC 2FX8H 1RPQA 3WXWH 4R9HA 5C0EB 5GGTH 3Q6FB 4HSQA 2XICA 5GRVL 3UTTE 1VFOA 2ZCHL 5GRXG 2WUBL 1F3JA 1VDGA 2JJSA 4X9BA 3GDBA 2KL6A 4J3OC 1OF2A 4WW2C 1ZHNB 3WEXA 1D9KA 1A6ZB 2Y4SA 3VFVA 4HJ0D 4LCYA 4DVRL 2B1AH 4HWBH 1MLCA 3ARWA 3UP1A 3K46A 5IIEB 3ESUF 3FT2B 3KWWA 1KPRB 3SCMC 4PLOB 5C8JA 3VI3E 1W8OA 1PG7X 2MHAB 2MPAL 1G7QB 3NVQA 1RZFH 3IVKA 3NGBB 4J4PC 3GIZL 3ZDYE 4MD5B 5T1LB 4F7MB 3BPLB 2YUWA 1WBYB 3HNTH 2OYPA 4KZEL 2J8UF 3MBED 1RZ8A 4PJEA 3W11C 2E9JA 3I02A 5E4IA 4XPFL 1FFNA 4F33A 3LKPA 2HJLA 3FQXA 4JQVA 3ULSA 3K4AA 4NQXB 3QRFM 4JR9L 1JTTA 3EJYD 3GJFH 4ETYA 3X12B 5JDSB 1VFAA 3QDJB 5E08H 4U6YB 1YNKL 1P84K 4KRLB 3B9KA 4HPYH 1E4KC 3S8WA 4DUVA 4LSSL 4EI6A 3CVHA 4TN9A 3BEWA 3TN0C 3GHBH 3DYOA 3SPVB 2HT2D 2IPKB 3QDME 5TH2A 2AS5M 5B4MD 4M7KH 4QCIA 4PRHD 3BKML 5CWSB 3X3GH 4I48B 1Q0YL 1UADC 4G7YL 4MXQC 1ZT7A 4XC1L 4G3YL 43C9B 1CTOA 2LE9A 1FVCB 4RFNB 4X8JA 4JO1L 4WUUE 1T0NA 5BS0D 3GSUB 3NABL 3UTSD 4X4ME 2APXA 4OCMC 5AUMA 1X44A 2ZKHL 4OLWL 2PXYC 5HHQB 3OGOE 3GB7B 4PRPB 3PWPA 2VDLL 1JL8A 3MRKA 5C09B 4EIZC 4JVUA 2QR0A 1DUYA 5FECB 2WUBH 3QQ3B 4NSKA 3KLSA 5GZNC 1X5YA 1KIPB 2YK1L 2XTLA 4YXHH 5FAAA 1X6NA 3CFBA 2DQEL 4GAYA 4MJIA 2WWMC 5CWSA 2F8OA 5I0DA 4K7PH 4XP9L 1A7QH 2D7TL 4APQC 3TO4C 3MJ8A 4NO2A 2RB8A 5F7MC 1P1ZA 1J1OH 5ENWB 3D0LA 3V6OA 5HPOA 4KU1A 2FATH 2EE9A 4KV5F 2VE6B 1ZGLM 1OTUD 4G9DA 4XBPB 4PTUB 1WBXA 3F6LA 4JGJA 5M7QA 4JCLA 4C83B 1WAAE 3SDXB 5HHQA 3H9HA 2P5WD 5FYLD 2VXTL 3QG7L 2MOVA 4LSRL 3ARBA 4KRMB 5IFHH 3REWB 1CZ8L 1C12A 2R2HB 2NY0D 3FRUB 5C08A 3NN8A 3TJEH 1JPSL 1A3LH 4Y89A 4WGWB 5GRWA 5TGBB 3HUJE 4K8RC 4OLYL 1JZ8A 4JFQB 4K3DL 4JRXA 1CE6B 3G9AB 3K2UL 2VL5A 4TPRH 1ZHBA 3LB6D 5DF0A 3QFJE 5HI4D 3JVGC 4TSAH 1S7XA 2DQHL 5C92A 3ARZA 3CAFA 3NOIA 4MDJA 3C2SA 4XVSH 5BVPL 2EDTA 3BKCH 4JQVC 1EAJA 4BZ2L 2XKNB 3PWPE 5CJXA 1ERNA 1N59B 1TDQA 2FDBP 1BFTA 2HAZA 5B8CC 3O6FC 3VGAB 4FG6C 4HWBL 3T0ED 1EIBA 4WU7B 3U0TB 2CR3A 4Y88A 1ORQB 3KYOB 3M1BA 3QEGH 3TV3H 5GS2D 1JYNA 4LP4A 4R2GC 3PABA 5IB1A 5SX5K 4O2FB 3VXNA 5E5UB 4Y2DA 1PLGH 5I6XC 2OL3L 4BSVB 5JTWA 2NTSP 2PO6A 4I4WB 4NC0B 2F5BL 5JQHC 2IALA 5FDWA 4M1GL 2QQKL 3IAQA 1JF1A 1J12A 2HN7B 4M7ZC 4P5TA 3REVA 5I1LB 2XA8H 4P59H 4MJ4A 3WLBB 5MEND 4TULL 4XBGA 4BZYA 1K5NB 4KUCD 4GRLB 4XGZB 3RKDD 4PBXA 2X4SB 1IL1B 1L7TH 2EDNA 3PWJA 3QXDA 3QIWD 3MNWA 3RVTD 5F7FA 4PUBH 4FXGA 3GBMH 4OT1H 3D48R 4F9PC 4ODTL 3SDXF 3VRJA 4LQFH 2FBOJ 4K7FB 1GSMA 1HSBA 1JPSH 4D8PB 3GI9L 4HS3A 4RMRA 4H88L 5ADPL 5F1IB 4PY8J 4X99A 5DUPL 1CFVH 3LKOB 3RUGF 3CX5J 4Z7WA 3GGWA 4LLYB 1OY3B 2P8PB 5C07B 3ZT5A 4XT1C 2UUDH 1BJMA 5HHPB 3JTTA 2A1WL 4O2CB 2GJZA 4S1RL 3FHQA 1F4YL 1BLNA 2X4SA 1FDLH 1G6RL 5T5NF 4YDLB 3QI9B 3QDAA 2R56L 1S7WB 1AGBA 3OV6A 4L9DA 4MGXA 2AV7A 4NPYA 1UJ3B 3HHRB 4OGXL 5K59E 1EXUB 2BXYA 3KPSD 3NCJL 4ZUUA 3C5ZC 3QJHB 4KQ3L 4YHKH 2ATKA 1MH5B 4MAYA 5J0BA 3LS5L 1AO7A 1S7VA 3HC3H 5DJ8B 5AZ2L 1MWAL 1VEPA 4U7KA 3MV01 4NC1C 4P3CH 4LCWE 5DZNA 3LHPH 1S8DB 2HFGH 4IMLA 1ES0A 3WUWB 4AH2B 2IPUK 5HYSA 5C07A 1INDL 3OAUL 4HT1H 4LFHD 4X6FA 2EDKA 4JKKA 3T04D 2Z93A 4LGPB 3RX8A 2GK2A 2X6MA 2H1PH 1IGCL 1RHHA 3RWFB 1EHXA 3WO3B 2QL1A 4PRHB 1T0MB 4OZFB 5JIIA 2BXZA 4QHKI 1DSFL 1FNSH 1AXSB 2MFNA 1MJ7L 4K71B 1HHKA 4PV8B 1QSFA 3ARGA 3DROB 3DETC 2GSGB 2FJFB 3KDMB 2AJYL 1FL5A 4PGCA 4PRBA 1MIEL 1AGEB 4Y2OA 5GSVA 3QUZC 3OGCB 4EOWH 5IW1B 3B2UD 4MAYD 2P5WE 5HHOA 1T20B 5FYKE 4WU5A 2AQ2A 3QG6B 2DKUA 3J7HA 3EO0B 5ANMB 1I8KB 5FGCE 4IRJA 3JXAA 3MRQA 3P0GB 3ZYJA 3O6LL 4XPBH 3V7AE 3QIWB 4HK0B 3MQIA 4U1IB 5EOCH 1RAMA 3GMNB 3VE0A 1INEL 4HUXB 4X4ZA 5KSAD 4CRPA 5JPMA 4KK5C 2AKRB 3N06B 4ODBD 3MLRL 2HT3C 3DV4A 5BOZG 1L7TL 5AZEL 1HHHB 1EFXA 3F7PC 1RK0A 2YPLD 3PL6D 2XZCH 1F58H 4KY1H 1AGEA 5SWSB 1S5HA 4UV4L 3GIVB 1RIVH 3TA3C 3V5DA 5CJ5A 5KW9H 5BRZA 3S88L 3ZLQC 1U8HA 4PJHE 4XI5D 3KLAA 2YS4A 1T1XA 1EH9A 2FIRT 3IETB 5EUOA 3EO0A 2EE6A 3ALXA 3ULVD 3JWOC 4YX2H 4KVNH 4PJ8B 4R26H 4OUUB 5L0QC 5C86A 4HK0A 4U1IA 4RIRB 1F2QA 5C0FA 2BNUA 3MXVL 4HG4J 2LABA 3NFPA 3BPCB 2JB5H 2D03H 3OQ3B 5CCKH 1N26A 2B4CH 3BIKA 5C07E 1NKOA 4HKBB 4E0RB 4XNZB 1TPXB 1BIIA 4M93C 4AEFA 4DFIA 4UV7L 3BRGC 3CVIH 4QRTA 3TCXA 3LKRB 3OX8A 3GIVA 4IMKC 3MJ9A 4K7PY 4K94H 2BVOB 2VWEE 5A16B 5JO5A 2PR4H 5EU6A 4YEFA 1HYSC 3KLAB 2BDNH 4NQDA 1NAMB 4YDKL 3LKSB 5L7XL 5D96B 3FT4B 4ONOA 5I16B 1Z5LB 3F7YB 3ZYOA 5F6HJ 3G6DL 3GRWA 3QNXB 5HYJB 3O4LB 5HXMA 1AD0B 1LP9B 4L3EB 4MWFB 4Z8FH 1NMBH 4PG2A 1A7OL 2R4SL 3HNSL 2PW2B 1IGJA 4F7EA 3CVHH 3RVWD 1FNFA 3RUGE 2HJKA 5D7LB 4XBEL 1I3GH 3I2CL 1TJHL 4DEPB 4IOFD 3D1MC 4YNYA 1CDUA 1QSVA 2VQTA 3DGGB 3P30H 1PYWB 1QVOB 3MRHB 2EEBA 3PG2A 4D3CL 4H1LG 4YK4B 4IRSB 5DGQA 3HFML 5GGSA 5GXBB 3ROOA 2V5TA 5LWYL 4AM0A 3SKUD 4EN3D 3CXDL 1NLDL 1KLUB 3HCVB 4UQ3A 3B5TA 4N8VA 4JZOB 2E7LA 1QEWB 1T04A 3E8UH 3VGDA 1T2QL 1I9JH 1OD7A 3AXLA 1MFBL 1OCWL 1QOKA 2DDQH 1IGIL 4L8BB 2I5YL 2VDLH 2PW2A 1CDIA 4MVBD 2FGWH 1O0VA 1B3JA 5IB4B 5I1EH 3QFJB 1ROWA 3O6FB 2B1HL 1OARL 1JGVH 2IGFH 2JTDA 4OZGE 3NABH 3H7LA 1RJLA 3O3AA 3UBXA 4YNYB 1NCAL 3INUL 2EDDA 2ADJB 3HUJB 2AJUL 5CSZB 1J8HA 1ADQA 1RIUH 5FCSH 1WWWX 1YPZE 5JHDA 4G9FA 4R3SB 4KVCH 1NCDL 1ZA3A 4JFYB 1LE9B 2Z35B 1NFDB 5C0RL 4OGAC 1ZKAA 3TJEL 4A6YH 5E2VH 3G6JB 4XHJD 1SHMA 4XZUA 5EIIA 4XH2B 5ISZE 4LBEB 3T09A 4XPAL 1FZKB 5BO1H 2RBLA 5A2JH 1LP9F 2DBLH 4LCIH 5D1QD 1V7NL 2C1OB 1ZSDB 2DTML 1GOGA 1LNUB 4FQQB 4GRLC 4HAFA 1KNOA 4K2UH 4N0UE 5TFSL 1IGYB 1HHIA 1D9KD 4N0CD 3OAZH 4P2RA 2H9GA 2QSCH 4PJIE 5MERB 3BAEL 3S98A 3FQUA 3GMMB 1JYXA 5D70H 2ADJA 3HUJA 3S35L 3AM8C 1U8IA 1J8HB 3G5YB 1A1OA 1IQWH 1S7TA 1FPTH 2HKHH 1M1SA 1OGAE 2IFFH 4JRYA 5LGHL 5LBSL 1KBGL 4K3DH 4IOIA 3IAPA 4D9LH 2P24A 5CILH 2CDGA 4LSVH 2BNRD 3KPRD 4K94C 3GRWL 4YHNA 5HHNA 3PL6A 5J1AA 1IAOB 2NY1B 4DQOL 4ELMB 1IGTA 4Y0GA 3VXRD 5ALBL 4Q9RL 3OAYK 3BE1H 5BZWB 1NSNL 2H6PA 4JAMA 4U0RB 4KGJA 5DJZA 4HLZG 4WJ5B 3I75A 4WENB 4GRMB 1I9IH 4MNQA 1HHJB 1VERA 3C6LD 2BY3A 4NQXA 1JGLH 1EX0A 4OD3H 4PJIB 3TVMB 2FECL 4U6YA 4Y4FB 4WFGE 2W9LA 3C60D 3F5WA 5ITFB 4XXCA 3PWVA 1HN1A 3KHOA 4JREC 4TOYH 1T4KB 4ZXBB 1CFNB 1NANH 1R3KA 2EXYC 4HC1H 3NIGF 3UZEA 2UWEE 3MV9D 4NQCD 4OV5B 2EYRB 2Y25A 1QLEH 1S9KC 4NN7B 4NZTL 1H3PL 2GW5A 1CD1B 3RTQC 2EIBA 2D7NA 4JZJA 1EFQA 4EQ2A 5C9JB 3RP1A 2VLLB 1IE5A 3QXAB 3IAGC 1DVFB 2NNAB 4UDUB 4Y1AE 5AAMA 3SJVB 1GGBL 1JV5A 1KELH 1UM4L 5DRZA 2DI8A 4D9QD 4S10A 1UCBL 4PJHF 1QLFB 2HTLD 5EIQA 3GSVB 4LLQA 2ZCHH 1XH3A 2DWEA 1IILE 5C09A 3FTGB 4KJWD 3QQ3A 1DL7H 2QSCL 1GPOH 1A5FL 2GY7B 2J8UE 1AGDA 3JBG7 4NKQB 2IBZX 3IDXH 1RVFL 3DI2B 2WBWB 2DBLL 1NGPH 2W65A 2NQCA 1GIGL 4YDIL 2J8UA 2UWEB 4NZTH 4QGTA 4H26A 5ABDE 4OQTH 1QA9B 2DLHA 5D71H 4A2LA 4AG4H 4GMTL 3LV3A 5DUML 3EDFA 1V7NH 1JP5A 1NBVL 2HRPL 1MCPH 2HTKC 3HE7D 1UGNA 4MJ5B 2BNQB 4NWTL 4LPTA 1AIFB 5KVDH 3V4VL 2JIXD 4Y4KA 3VH8A 3MV8E 5KN5B 1LP9E 4GXVL 1SEBA 3L9RA 1QO3A 1AE6L 1AO7D 5I18H 1AGDB 5BV7L 5JPNA 5KVGH 1YNTA 2OR9L 1PKOA 4YXHL 4NT6A 1HH6A 1L6ZA 4XP5H 5FUZH 4NKMB 2YD4A 4WI9A 2MCPH 5MEPA 3SE8H 4RAUA 1A9EA 4IRJC 2VXSH 4R90H 4RWYH 4H0IA 5F7YC 5BZDB 1PQZB 3FO9B 3UYRH 1NCUA 2K7PA 3HI1A 3RZCD 3U0WH 3QA3A 4XP6H 4U1GB 3TBWB 4JG1L 4UDTA 4P5KA 3AS3A 2AI0L 2I27N 4AT6A 1SM3H 4FZEL 5IMKB 4HUWB 5LBSH 3VH8B 2P7TB 4WUUA 1V3LA 2PETA 1OQOA 3O41A 3OKNA 4RZCA 3TBVB 5GS0D 5CLTA 1LO3L 5KZCB 2A73A 2AK1H 3OF6A 4JFHE 4CU6A 1A1MB 3B9KC 5HHXL 1UM5L 4LK4A 3DO3A 1JF1B 1S9YB 1PY9A 4YQXH 3DPBA 2QSVA 1U8JA 3LEVH 4Z77B 1XF2B 4J6RL 3RJQB 4YPGB 4M61B 3HI1B 2FR4B 4KRPB 2VDOL 3N9GH 5CSGA 1P7HL 5GGUA 4HKZA 5D7IE 3T1FA 5DRWA 3RQ3A 5IEKB 4NQDD 1F02I 5ALCL 4NKOA 4XVJH 2VXQL 1JMZA 2C3GA 3PJSB 2BX5A 4G8GB 1UYWL 5BXFB 3PHQB 3PUCA 1G0XA 1P7QD 3KGRA 3WN5B 3FN3A 1S3KH 1KB5L 2XWBB 2XY1A 2BZDA 2VLJE 1MCRA 4QRPA 2A9NL 5MEQA 4JPVH 4N8CH 2CLRB 4Y4HD 3F58L 1QBLL 2BOCA 1CFSA 1UZ6F 4KTEH 5IM7A 3PDDA 4PJ7E 3K74B 5K93A 3V0VB 3T0VA 2NXZB 3HI6H 3HE6A 4G6JL 1VFBA 2PYFA 5EOCJ 5HDOA 3TO4A 3UDWC 2BOBB 5BVJA 2DMCA 3R8QA 3S3JA 1I1AB 2XN9A 2DM7A 1MFDH 5BQ7B 5IEHA 4XCNA 1YY9C 1XF1A 4OD1H 3A67L 1EXUA 2OQJB 4KI5D 3IJYB 2Z0BA 1FNGB 3HG1A 4MJ2A 2ITCB 5HGGS 4JPIA 1FNAA 4XVTL 1JPGB 1MFEH 2R0LH 4QRPB 3VRIB 1KCKA 3DBXB 3MJGX 1ES0B 3WUWA 3FN0L 1WFOA 4EDXA 3D39A 3ZT7A 1RUPH 3X11B 4PRID 1EDQA 35C8H 4JFZL 3BWAB 2QQNH 1DQDL 3UTSA 5DYOB 3IJHB 1P7QA 2X4PB 2YOCA 2VH5L 4HPOL 2N7BA 3AGVA 4HKXB 3LKQB 1H5BA 2G9HB 1OAUL 1F4YH 1PZ5A 5CEYA 4XMKH 3UZQA 3L5WB 5JHDD 5IEHB 1J0KA 1CGVA 1UM5H 4KDTA 5D2NB 4YWGL 4K9EL 1KCVH 3E0GA 4EKXA 1QSZA 1DLFL 2FCBA 1R6VA 3GSOB 1DBML 2FX9H 3A6CL 5E5MB 1BGXL 3TO4D 2DWDB 4OF5A 4OIIH 4N1HB 4ZFFB 3QFDA 4OM1L 2XN9D 1BQLH 5KSVB 3RA7H 4YBQC 1TJGH 5LGKA 4LVHC 4I5BB 2GFBA 5E6ID 4LPXA 1TMCB 3A0OA 5IW1A 1WCBB 4KVCL 4UTAL 1JHTB 2AJVL 5T3ZL 4G6AD 1MUJA 3BPNB 3HPJB 3O3UN 3WS3B 3RTQD 5C71A 2CIKB 2FO1A 2F8XC 1JGVL 2IGFL 5F70A 3QQNA 4X6DA 1F4WL 2YRZA 3RDTD 2ZCKL 4ENED 1WEJH 5CBAA 3V52L 3MGTB 3K8MA 3Q5OA 1EFXD 4YHMH 4K8RH 4LPUA 3BO8A 4NBXB 3B9EA 5HHVH 4L4VD 1UB6B 2NX5D 4ZUVB 3H42L 3QUXD 5C70A 3MRCA 1IKFL 3L3GA 5CIPH 4NN7C 3P9LA 3B8YA 1LEGB 5I1HH 5HGAA 1TTFA 4I18B 4GG8A 2AEIT 3UAJC 1U3YA 4MXVE 4ZPTA 3C6LC 4G43B 1T3FA 1FFPA 4MQXD 1GOHA 3MNVB 4DZ8A 4U1SB 1FZJA 4OSUH 1FCCA 5F88B 2HJFB 3EOTH 5DJXA 4OBRA 1S9VB 4I2XA 2VISB 4RGOH 4LRIC 4PJ5D 4PJCE 5HGDB 4HGWA 4F7TA 4EI5B 1HKLH 1IEBA 1U3HA 3CZJA 1JWUA 2MNUA 3KPQA 5DJ2B 2NYYC 3OB8A 2HVJA 3JWOL 4X9FA 5I1GL 3NFPB 3GFUA 1U2HA 2APBA 4WW2F 4Z7VF 1S9XA 4GKSA 1Z9LA 3RKPA 4PTTA 3C8KA 2F58L 1SEQH 3QEQB 1JGUH 2V5MA 1UXWA 5JNYB 1G0YR 4X98A 4M7KL 4DN3H 2YC1B 4ZSOA 3VG0H 2WLZA 2VRAA 3VD9A 3WXVH 3B3IA 1XAUA 4YO0B 1D9KC 1ZT4A 2IBGA 2XA3A 2FL5A 4JM2B 5IOPA 5F9OL 5CEXB 5C0BA 3RHWF 2F53D 4RGNB 3EFFA 5FK9B 4E42A 1MFDL 3D2UD 4OFIA 2YRLA 1H8NA 4QXUH 4B41A 3W9DA 5IIEA 4OI8A 1MCWW 4NZJA 4ZUSB 4DK3A 3JWDL 2X1QA 1V3MA 3EYQC 3VFSB 3WO4B 1B0WA 1NEUA 3MLXL 4ZD3H 5DA0B 2YD8A 3PDGA 4FS0A 1PYWA 3MRHA 3VXPB 5E6IA 2JELL 4L4TA 1JRHI 3C5JA 5F1KC 3UTQA 2ADIB 2QLVB 3ZE1F 5IFJA 3S34L 1NGPL 3TBTB 4MVBC 5AG9A 2BP3A 5L6YL 2BCKB 4JKPL 2NZ9D 5FYKD 4XWOD 2OZ4A 2WINB 3D39D 3ZYIA 4IJ3B 3KR3L 3MRPA 1P4LB 3MRGB 4RX4A 5D2NE 4L8BA 2ICEA 3T8XA 2Z92B 4MMZC 5B38G 2X4RB 2XZQH 2QJDA 5FGRA 1MY7A 3EO9H 2AV1A 4KAQH 3FOMA 3B9KB 4CW1A 3QUXB 4LQFL 1CVSC 3ILQC 2MMXA 2KPNA 2XNAA 1EHNA 1EVUA 3ILPA 3QO0B 4ZAKB 5TH2B 2OSLA 4JFXA 3TYGH 4PP1C 2VXUH 1UZ8B 1ZLVK 4L9LB 3JUYA 3TH2T 3FAXA 1KB9J 3TV3L 1KCRH 2Y07L 4LRIA 4QTHA 3WFCH 1HKLL 2LU7A 5DHVB 2YUXA 4QRPD 1T0NB 4P4KB 3UO1L 4M1DL 4AYFA 5HY9A 5TDNB 4M6NL 4C54A 1SVCP 5BO1L 2C9AA 3ZDXF 3DO7A 1QSFD 3RTQA 3U30B 5DK0B 4IOSD 4W6XB 4UINH 3ZDXE 3LSOA 3V4UL 1XIWD 1HYSD 4YHOH 3HE6D 1YMHA 1YEDA 2H45A 5EO9A 3QXTA 2XNAB 5E5RB 5HD8D 3HZYA 4LOUC 5HJ3B 3HAEG 1MAML 1NC2D 1CD0A 4ZUWA 1D6VL 2RQ8A 3R1GH 2BHUA 1MHEB 4FQXB 3WXVL 3H9SB 5ICYB 2F54E 4NQEB 4PJFF 5JOFA 2WLYA 4MNQE 3MX0A 4XC3L 1KG0B 4HLZH 3NH7H 5E00A 1WTLA 5F96H 3NTCL 3BDBA 4UT6L 4L4VE 2NXZC 5GSVB 4HZLB 1N2RA 3ROLB 4PJFA 4UT9H 3EHBC 4P4RB 2CK0L 2L4OA 3F12B 1HHJA 1AC6A 4GMTH 1YEDB 4LHJB 3V4UH 1XR9A 4NJAL 4PJEF 5I8OH 1W72L 4QOKA 4QY8B 1S78D 4BFIA 1F4HA 1J0YA 5BOPA 3O45B 1KJ3H 1ZANL 1TXKA 3LQAL 2A6JB 5GGVH 3HPLA 4CMHB 4HGKC 4EVNA 3MV9A 4PYHA 2LAAA 3L3DA 3C6SA 3IRPX 3VFGL 4PY7B 3OF6D 2YSSB 3QQ9C 4RA3A 4TOYL 3BWUC 1QACA 4RISL 6FABL 1A0QL 1KIUA 2VR4A 3MOAL 3NAAL 4HC1A 4HZLA 2NY6D 1A9BB 4CVXB 1BQHB 4LIQH 2WUCL 5FXCH 4LHQB 3L6FB 3X13B 3HMXH 1CCZA 2GEEA 4QLRA 4NRZB 4W6WB 4MQ7B 2BVYA 4KJPD 3HC0A 1WK0A 4MD4A 2NXYB 3QB7C 5AAWA 2WV3A 1KJVA 1QLFA 2QSQA 3RBSA 4LLQB 1HE7A 3ARBB 2UY7A 1E27B 4HKJB 5KS9A 2KKQA 4L8CB 2K7QA 3DYPA 3O3EA 3T0EA 2QHRL 2GUOB 1U3HC 4YUEL 4KHTL 1G9NC 2P49B 4WHYH 1J0IA 2DQFA 1WICA 2Q3ZA 4NN6C 4YX2L 5IB5A 3UPRA 3VFMA 1LO2L 2EEDA 1AQDA 4KROD 4H26B 5D7KD 4DTGL 5JMOC 1AP2A 3QDMD 4F7PB 1PDKA 1VGKA 2WIIB 1YEJL 5I8KL 1ZK9A 1NAMH 3EJZD 4F15C 4OZIE 3CZFB 1Z3GL 2Y36H 2VXQH 3AAZB 2RFXA 3OKLA 5AEAA 3OXSA 3SE4A 2VDNL 4WHCA 3KHQA 1WBZB 4IRJD 4LQ1A 3MLRH 4JRYE 1R3IH 4NNPH 5LJYH 1BQSA 3IRZA 5K9KA 1E4WH 2H8PB 4JRWA 1IC5L 1C1EL 4TUJA 3SDDB 8FABB