2AQ0A

Solution structure of the human homodimeric dna repair protein xpf
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
84
structure length
84
Chain Sequence
MDSETLPESEKYNPGPQDFLLKMPGVNAKNCRSLMHHVKNIAELAALSQDELTSILGNAANAKQLYDFIHTSFAEVVSKGKGKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The HhH domain of the human DNA repair protein XPF forms stable homodimers
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna repair, hydrolase
molecule keywords DNA repair endonuclease XPF
total genus 20
structure length 84
sequence length 84
chains with identical sequence B
ec nomenclature ec 3.1.-.-:
pdb deposition date 2005-08-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2aq0A00
3RH6A 2VA2A 4B9SA 1U4BA 7ICQA 4O0IA 1NK5A 3RH4A 4JWMA 2BCSA 2AGQA 2MUTA 3QEAZ 4M04A 1LV5A 2W9AA 3OHAA 2DFLA 3PO4A 3C2MA 3V7JA 2XY6A 2F1JA 2PI4A 4DL7A 4NLNA 1PZNA 2FMPA 4PPXA 3JPTA 4XUSA 3PW5A 4EEYA 4GXJA 2C28A 2MUTB 1SL2A 3RJHA 3OJUA 4F3OA 5IIJA 4UQGA 4M9JA 4DEZA 4M9GA 3GDXA 2ZTCA 3N97B 1SKWA 3GFKB 2I1QA 5L1KA 3C21A 1KSPA 2ASDA 7ICKA 3KHGA 3C5FA 3ZDBA 3KHRA 4RPZA 5HMLA 3AU2A 3FDSA 4IQTA 2XY7A 1UA1A 5DDYA 3Q8PB 3MR6A 4F93B 2AQ4A 1A76A 3C23A 1TVAA 2R8HA 2ZJAA 4F4KA 1XO1A 1TK5A 2P6RA 4I2HA 5J2HA 1BVSA 3H8SA 5L1JA 1IM4A 2BCUA 3PW7A 1NK4A 2MAXA 4TUSA 1ZJNA 4FS1A 4O3SA 4C8OA 9ICMA 1SKSA 1JXEA 3RB0A 5DLFA 9ICUA 4Z6FA 1JXLA 1A77A 4KN4A 4KLFA 1ZETA 3MGHA 2BPFA 1KFSA 1D9FA 1WCLA 2BQUA 2PFOA 8ICHA 5CJ7A 5KG3A 3HWTA 4M6WA 5DB7A 1ZYQA 4QWCA 2FLNA 3RRHA 3RJFA 7ICPA 8ICYA 3JPPA 5DKWA 3ZDAA 4RUAA 4DSKA 5J2JA 4Q45A 5KG2A 4HYKA 3PX0A 9ICTA 2W8KA 4KLDA 2JZBB 4M6WB 4Z6EA 1D8YA 9ICLA 3EW9A 3EWAA 1ZQDA 8ICSA 4O9MA 4DSFA 4O3NA 5KFJA 3GV8B 4YR2A 1U49A 5J0WA 9ICAA 2C2EA 5KG6A 3EYZA 4KLQA 1S9FA 9ICIA 4M2YA 3QEBZ 1BPYA 7ICGA 1HJPA 3GQCA 4Z6CA 1ZQMA 3MR3A 4DFJA 5BPCA 2V4QA 3C2KA 8ICUA 4P4OA 3OSPA 7ICSA 5L9XA 4J9OA 9ICRA 2W9MA 4DWIA 5J2IA 3H40A 4B9VA 1L3VA 1B22A 2UVUA 3MGIA 2AQ0A 1N48A 7ICTA 5KFIA 4F8RA 3C1YA 1UT8A 5DLGA 1HUOA 9ICEA 3UXPA 5IINA 2FMQA 5DQHA 2HHQA 3V7LA 3THVA 5J0SA 2XGQA 2A1JB 2KTQA 5KT5A 5J0XA 4RNMA 4ED7A 2KZMA 2AGOA 4LVSA 2DPIA 7ICJA 5J2EA 4RPXA 4O3OA 9ICHA 3MR2A 3G6VA 9ICVA 3V72A 9ICJA 5KFUA 4IQWA 1KTQA 8ICWA 4I2CA 3B0XA 8ICKA 3MR5A 3AUOA 4J9PA 4F91B 3MFIA 4RQ7A 4QZAA 4MFCA 1KEJA 3H8WA 4YVZA 5KFEA 3PVXA 1WCNA 3LDAA 4TQRA 1NK8A 3BJYA 2W8LA 4UAYA 4QZ8A 4J9SA 4ZH4A 2IHNA 3EZ5A 4LZGA 5J0RA 4KN7A 4PGXA 3RBEA 4NY8A 2M9NA 1RPLA 3RB4A 3PNCA 3RAQA 3UXOA 8ICTA 4F4WA 1ZQJA 1MC8A 4GXKA 2HHWA 1JMSA 1ZQGA 4I28A 3MDCA 4QZIA 4TUQA 9ICBA 2ZJ8A 4UB2A 9ICGA 4QW8A 5KFDA 4JK1A 5KFNA 1KRPA 9ICQA 3H4DA 4XA5A 5J2DA 5KFFA 4R8UA 3EPIA 4C8LA 4KLOA 2B21A 3RBDA 1BPZA 4P4MA 1CEZA 4QZGA 4P2HA 3PX4A 5BOLA 4F2RA 4RQ2A 3PR5B 2C22A 4ELUA 3ORYA 5KFMA 1RZTA 2HHUA 4XQ8A 3GV7B 5L1LA 4YR3A 4RT2A 3LK9A 4UAZA 4NLGA 4DFKA 3LWLA 4ECXA 4R64A 2RDJA 8ICGA 8ICLA 2GWSA 4QZDA 4NXZA 4DSLA 2J6SA 3PY8A 3JPRA 3TANA 3PX6A 4QWDA 3T5JA 1T8EA 3GV5B 4RQ8A 4DS5A 4DSIA 3GILA 4ECVA 4ED2A 4ED0A 1ZQBA 1NK7A 2HHSA 3M8RA 4DL3A 1ZQOA 3TQ1A 2R8GA 1ZQTA 4B9UA 2PFPA 1ZQLA 2ASLA 4DFPA 4ECSA 3Q8KA 4QZBA 8ICFA 5DG8A 4Q8EA 1V9PA 4E0DA 9ICSA 2P66A 8ICMA 4DQRA 1KFTA 4JV2A 3SV4A 4FO6A 4O5KA 4G3IA 8ICEA 1S10A 4F50A 3E2EA 5KFOA 8ICVA 1MQ2A 5C5JA 5D49A 3RH5A 2ASJA 2W9CB 1TK0A 3UQ0A 4PHDA 2BCRA 3Q8SB 2IBKA 4EBEA 3UXNA 4QWEA 4DOAA 5JUMA 3PMLA 1S0OA 4FS2A 3GIJA 5KFQA 4KLIA 1L5UA 2BHNA 3AU6A 1ZQPA 1U48A 2FLPA 4QZFA 4EYHB 4EBDA 1DOQA 4I27A 2XCPA 2W9BB 1ZQIA 2V4RA 3BQ2A 1Z00A 5DG7A 2UVWA 3ISBA 2AJQA 5J2BA 4R65A 4YFKA 2Q0ZX 4RQ4A 5CR0A 5KT2A 1BPXA 5KG0A 5J2GA 2KFZA 3H8JA 4YXJA 1TK8A 8ICBA 5KFRA 1T4GA 2I9GA 5KFXA 4NM1A 3BQ0A 4DL4A 1SL0A 2HHVA 4MFFA 7ICFA 1BPBA 4Q43A 1U45A 5CA7A 3QZ7A 1XSPA 3MFHA 5J0UA 4PHAA 4FBUA 7ICOA 8ICRA 1U47A 1NJYA 3Q8MA 1ZQRA 9ICCA 1QSYA 2VA8A 4LZDA 4PH5A 4F4XA 2PXIA 3N4MB 5CHGA 5J0OA 1X9WA 4YP3A 4EBCA 2FPKA 5KT7A 1UA0A 2ZUBA 1ZQZA 1QSLA 4Z6DA 1RYRA 1EXNA 3UPQA 4MFAA 4YMMA 3PR4A 1KLNA 2JEJA 8ICNA 5IILA 1H38A 1ZQNA 1ZQEA 3BQ1A 4J9MA 4O5CA 1NOMA 3IM1A 3H4BA 4ELVA 3RJJA 4YMOA 3EPGA 3Q8LA 2FMSA 5KFCA 4IQUA 4CCHA 4K4IA 5KFSA 5DG9A 1MQ3A 1NJZA 9ICKA 3Q8RB 3RB6A 4R63A 3TAPA 1XC9A 3RJGA 2F1IA 3PV8A 5HP4A 1L3TA 1ZQHA 3RRGA 3RJIA 8ICAA 4YD1A 3T5KA 4GXIA 4I2GA 5KFYA 7ICIA 4BXOA 1T3NA 2A1JA 2NRXA 2VANA 5IIMA 4RQ1A 4IRKA 3T3FA 3RB3A 2NRWA 1NJWA 2J6TA 7ICNA 4KMUA 4PGYA 4KLMA 1KFDA 3OHBA 3HT3A 1ZJMA 4F92B 4ECRA 4KITB 5BOMA 2PFQA 4QZCA 2DPJA 1QLNA 1KDHA 3ZD9A 1TFRA 4Q44A 3HP6A 5KG1A 4BWJA 1XSNA 4ECQA 4KLLA 4KLHA 3OJSA 2IMWP 9ICNA 3RAXA 4RNNA 2KZZA 1S77D 3OSNA 3G6XA 4F5RA 2BQ3A 1NK9A 4IRDA 4PHEA 9ICOA 9ICFA 5EWEA 2AU0A 1ZQCA 4J9RA 1CUKA 3H7IA 1SZPA 4TUPA 5IIIA 3RJKA 2KFNA 3ZDDA 4JV0A 4ED8A 8ICXA 5D4BA 3ISCA 3M9OB 2PI5A 4B9TA 2UVRA 4I2JA 4FBTA 5KG4A 4KTQA 3RR8A 5HNKA 4KLUA 5J0QA 7ICMA 4ED6A 4UBBA 4MF2A 3MBYA 4I2DA 5DQGA 2XY5A 4YXMA 5L1IA 2IA6A 1Y88A 5IIOA 4K4HA 4O3RA 8ICJA 2VA3A 1S97A 5KFPA 3C2LA 2FLLA 5DBAA 9ICXA 1ZQXA 3QZ8A 3IHQB 2LYHA 2BCVA 5KFVA 5EWGA 1S0MA 3T5LA 4M0AA 3NGDA 5KT6A 3V6HA 4UBCA 5J2KA 3ZDCA 9ICWA 3V6KA 7ICEA 4MEXA 5DGBA 1RXWA 4M47A 1XU4A 4K4GA 2BDPA 4UAWA 4QW9A 4Q8FA 3B0YA 3SYZA 2C2RA 4TURA 3TFRA 2ISPA 1NK6A 5KFLA 1IXRA 4YMNA 5CWRA 4QZEA 3GIKA 2F1HA 5J29A 3G6YA 2HHXA 8ICPA 4I2BA 5J2FA 3M8SA 3TARA 8ICOA 2FPLA 2V9WA 4DLEA 4R8UB 3UQ2A 3TAQA 4DSJA 4GC7A 4DL5A 5F9LA 1U9LA 5J0YA 1XWLA 1D8LA 4DL2A 1TV9A 5EOZA 4DFMA 1S0VA 8ICCA 2ZTDA 1TAQA 3TFSA 3ZDEA 5DBBA 4YG2A 4I2IA 2KN7A 3JPOA 4YN4A 2ZJ5A 4NM2A 4DQSA 1NKCA 7ICUA 4P4PA 2ZUDA 1NK0A 3HPOA 1LB2B 1DGSA 4M9LA 1B43A 2C2DA 4YCXA 4NLZA 1HUZA 4J9QA 4IR1A 4UB4A 3HW8A 4DOCA 3PW2A 3OGUA 5DBCA 2IHMA 4UB5A 2Y1JA 4EZ9A 3GIIA 4JV1A 1QTMA 1T7PA 2JEIA 1SL1A 5DB8A 4J9KA 4X5VA 7ICHA 2P6UA 2HVHA 4ECUA 4DLGA 5J2CA 3MABA 2NRVA 4KLJA 4ECWA 2BKEA 2ALZA 3RTVA 4RQ0A 4O3QA 5KG5A 4RZRA 3JPNA 3JPQA 1UT5A 3HX0A 3T5HA 4KLSA 1TAUA 3MDAA 2R8IA 5DDMA 2XGPA 4C8NA 2HHTA 2XO7A 5KFGA 4YD2A 4PGQA 4ED3A 1ZQWA 4IRCA 1L3UA 2BQRA 4O5EA 1C7YA 5HMMA 3FYHA 1JIHA 4R66A 2UVVA 2PFNA 5KFAA 4BDPA 3C1ZA 1Z00B 1BPEA 2ZTEA 4RQ6A 2FPMA 3ISDA 2W9BA 5KFHA 1ZQAA 1COOA 2Y1IA 9ICPA 4M9HA 5KT3A 5KFWA 1NJXA 3PO5A 4O3PA 4M9NA 5IIKA 1ZQQA 4RU9A 1N56A 3JPSA 4ECYA 5KFBA 4DF4A 5DB6A 5DB9A 2H5XA 1NKBA 1Z3EB 1ZQYA 4DQQA 2XCAA 4C8KA 5KTQA 5J0PA 4PHPA 4JUZA 2W9CA 4DS4A 1X9SA 4B9NA 5HHHA 4RUCA 1XSLA 4QWAA 4I2FA 4NLKA 3PMNA 5HHIA 5TZVA 4ECZA 4GC6A 4QWBA 5KG7A 2JZBA 8ICZA 3K4GA 1S76D 2HVIA 3TI0A 4UB3A 3PW4A 2ZUCA 1X2IA 2WTFA 3Q8QB 5CP2A 4BGDA 3PW0A 3RJEA 1ZQFA 7ICRA 5DQIA 4DOBA 2ATLA 4EZ6A 4ECTA 3NTUA 4IQVA 3M9MB 2BR0A 2XC9A 4DSEA 1TKDA 2NRZA 3C5GA 2R8JA 4XRHA 1K1QA 1MSWD 1AROP 5KFKA 4RNOA 4DF8A 2ISOA 4BWMA 1D9DA 1S0NA 3KHHA 1JX4A 4DQIA 4EYIB 4DO9A 7ICVA 4QZHA 1BPDA 4RQ5A 4GLXA 2RDIA 3V6JA 2JEGA 4I2EA 2BPGA 3ZD8A 1L3SA 3KTQA 1JN3A 3QE9Y 5J0TA 4J9NA 2AGPA 2BCQA 1SKRA 4MEYA 4YR0A 4F5QA 2NRTA 4F4YA 4ED1A 1K1SA 1X9MA 5KT4A 1RXVA 1RYSA 3ETLA 5EWFA 4YQWA 3V7KA 2JEFA 4F2SA 3BDPA 3K75D 1ZQUA 5KFZA 2BPCA 4UB1A 2KZ3A 4J9LA 1ZQKA 7ICLA 5D46A 4JWNA 5CB1A 1NKEA 3KHLA 4RPYA 4RQ3A 3M9NB 1XS9D 1ZQVA 3GIMA 4TQSA 4QZ9A 4B9MA 1BGXT 3LWMA 2OWOA 4F5OA 4I29A 3SZ2A 4MF8A 4DL6A 4BXOB 4KLEA 4DQPA 4KLTA 5J2AA 8ICQA 2BGWA 4KLGA 4I2AA 3SI8A 2R8KA 4B9LA 4IR9A 4F5PA 5F9NA 3BQTA 4C8MA 5KFTA 4F4ZA 5DGAA 1QSSA 4F5NA 1ZQSA 2HW3A 4RT3A 3SV3A 8ICIA 4ELTA 2J6UA 3RR7A
chains in the Genus database with same CATH superfamily
3RH4A 4JWMA 2AGQA 3QEAZ 2E8OA 2IOHA 2KD1A 3HKZF 3OHAA 4DL7A 3PW5A 5AICA 4Y2YA 1SL2A 3D6JA 3RJHA 4F3OA 5IIJA 4EX6A 4M9JA 3AL0B 2RQ5A 3GDXA 2ZTCA 7ICKA 2KJ8A 3QNMA 4RPZA 2HOIA 3MR6A 2LMRA 1OXJA 5AM3A 3SR6A 2Y9UA 5J2HA 5L1JA 2MA1A 5AHXA 4NWIA 2BCUA 3PW7A 1VDVA 4C8OA 9ICUA 2KNJA 4EX7A 3L4PA 2PMZC 4NJ8A 1ZETA 3S6JA 3MGHA 2BPFA 1KFSA 2BQUA 8ICHA 2ZXHA 2OM6A 5DB7A 2G06A 2FLNA 2WF8A 5AIBA 1K5OA 5J2JA 5ALWA 1ZD2P 2JZBB 9ICLA 8ICSA 3EUB2 4DSFA 1V85A 4KLQA 4M2YA 3QEBZ 1BPYA 4CF4A 1T94A 2JXJA 1HJPA 3GQCA 2YMMA 1ZQMA 4MHVA 3C2KA 8ICUA 4P4OA 2H3VA 2HOFA 1Z19A 9ICRA 4DWIA 5J2IA 3QUBA 7ICTA 3MGIA 1KQQA 2GH1A 2W3SA 4F8RA 4GIBA 9ICEA 2FMQA 2GLEA 3SAFA 3THVA 1F5SA 2XGQA 2KTQA 5KT5A 4FFDA 2DPIA 7ICJA 3L3FX 5KFUA 3QU4A 8ICWA 2HBJA 2DBYA 2NV3A 3AUOA 1HEKA 1LVHA 4YVZA 5KFEA 3BJYA 4J9SA 5AM2A 3EZ5A 1RPLA 2QB1A 2ZIWB 4A8EA 5ALRA 3NRWA 2OCEA 2HHWA 3TADA 4I28A 2ZJ8A 4NV0A 4UB2A 4QW8A 1SWWA 5KFDA 4JK1A 1SV4A 3J81j 1BPZA 4P4MA 3PX4A 1UQVA 4F2RA 4RQ2A 2C22A 5L1LA 4NLGA 4QZDA 4DSLA 5AKLA 3PY8A 3JPRA 3PX6A 4QWDA 3IP4B 5ALMA 3T5JA 3M7DA 3N28A 4RQ8A 1TAMA 2B6GA 5GTIU 2YMLA 1NK7A 4DL3A 1JROA 1ZQTA 3WKCA 2W3RA 4G3IA 1S10A 4DCCA 5KFOA 1MQ2A 1QQ7A 4PL1A 4PHDA 2IBKA 3UXNA 2KKVA 5ALGA 5KFQA 3HKZC 3AU6A 3F5AA 4EYHB 4EBDA 3BQ2A 3ISBA 5J2BA 5CR0A 1BPXA 4YXJA 1PUZA 2I9GA 4DL4A 2JMGA 1ZQRA 4LZDA 4PH5A 4F4XA 3WKBA 1X9WA 4P0QB 2FPKA 3WK6A 1O08A 4Y2TA 1EXNA 4YMMA 1H38A 1ZQNA 3IM1A 4ELVA 4YMOA 3Q8LA 5KFCA 4C7ZA 4OJ6A 2G09A 1NJZA 5ALUA 3RJIA 4GXIA 4BXOA 1T3NA 2NRXA 4IRKA 4RQ1A 1RQLA 2NRWA 3SQIA 4KMUA 3NVVA 3UMGA 1KFDA 3HT3A 1ZJMA 4ECRA 3QU7A 5BOMA 5EE1A 4Q44A 5KG1A 1XSNA 2KMDA 3OJSA 5AK5A 2K60A 1S77D 3G6XA 4ACOA 4IRDA 5EWEA 3KKAA 1ZQCA 3H7IA 2YMQA 3ZDDA 3ED5A 3KZIU 3ISCA 2PI5A 4B9TA 5G5GA 2BDUA 4KLUA 3RR8A 3IDWA 5J0QA 4MF2A 1SIJA 4I2DA 2WF7A 4YXMA 4K4HA 2HBMA 4O3RA 3T5LA 5J2KA 3ZDCA 5HR6A 9ICWA 4MEXA 5DGBA 4M47A 4UAWA 2QB0A 4Q8FA 5KNIA 2C2RA 5G5HA 1NK6A 1IXRA 5J29A 4FZMA 5J2FA 8ICOA 2V9WA 4DLEA 3TAQA 2AH5A 4DL2A 8ICCA 1S0VA 2ZTDA 3ZDEA 2KN7A 4OJPA 2ZJ5A 4NM2A 1NKCA 4C0ZA 1NK0A 3HPOA 3SD7A 3LYSA 5JRTA 4NLZA 3HILA 4US8A 2PMZF 2E8MA 4JV1A 2A3VA 1UCVA 4J9KA 4DLGA 2NRVA 4KLJA 2E1EA 4O3QA 3JPNA 1UT5A 1O03A 2R8IA 4CDGA 2K4PA 2LYBA 4ED3A 2YTUA 1C7YA 1KL9A 3FYHA 4RQ6A 2QB0B 2FPMA 5KFHA 4M9HA 3PO5A 4O3PA 3B9JA 2DKXA 1ZQQA 1N56A 1ZXIA 3I76A 4ECYA 1ZD4A 3BS5B 2H5XA 1NKBA 4QJFB 5J0PA 4JUZA 2F44A 4B9NA 4NLKA 2F8LA 4BUGA 4GC6A 4CF3A 8ICZA 4FE3A 2KKPA 4IS7A 5CP2A 2IOFK 5A0LA 4IQVA 3M9MB 1PK3A 2R8JA 2LHTA 4XRHA 1K1QA 3E0FA 4RNOA 1S0NA 4OJ5A 1CI4A 7ICVA 3BS5A 1BPDA 1JN3A 2K4IA 5J0TA 3QE9Y 4GFJA 2NO5A 1SKRA 4ED1A 3ETLA 3V7KA 3WK7A 2EAOA 4J9LA 3GIMA 4F5OA 2FE9A 4DL6A 4KLEA 4KLTA 5J2AA 3GU3A 2BGWA 4KLGA 3SI8A 2WF5A 2R8KA 4F4ZA 3SV3A 3AMZA 5E79U 2JH7A 4U6PA 3RH6A 2VA2A 1U4BA 2OEHA 2DKZA 2ZIWA 2BCSA 4M04A 3QUTA 1LV5A 3WK5A 2XY6A 2F1JA 4NLNA 1P7DA 1PZNA 4PPXA 4GXJA 2C28A 2H3FA 1JUDA 4DEZA 3N97B 1N2XA 2ASDA 3KHGA 5B66U 3C5FA 3AU2A 5DDYA 2AQ4A 2K4EA 1A76A 1TVAA 2RLTA 2R8HA 2DUYA 5C0YA 1TK5A 3QU2A 3H8SA 1IM4A 1NK4A 2MAXA 4O3SA 9ICMA 1ECWA 1PVRA 3F2DA 2N1RA 1N5XA 4KLFA 3FC4A 2DQNB 2J6UA 2FDRA 1D9FA 1WCLA 2PFOA 3IG8A 5CJ7A 2B0CA 3RJFA 5J8YA 8ICYA 2W43A 4DSKA 5KG2A 3PX0A 2HOQA 2W8KA 4M6WB 3PSFA 1D8YA 3EW9A 1ZQDA 1L7PA 4O3NA 9ICAA 4Y2QA 5KG6A 2QARB 1S9FA 5EE0A 4DFJA 3OSPA 2CRXA 4J9OA 2W9MA 4B9VA 1N63A 3I1YA 5KFIA 1Z1BA 1HUOA 1T3QA 2KZMA 1ZOLA 2WB1C 3MR2A 3G6VA 9ICVA 9ICJA 1RG6A 3N7SC 4PZNA 4C4TA 4I2CA 3MR5A 1RQNA 2F76X 1X42A 1KEJA 4TQRA 2E8NA 2G0AA 2W03A 2F77X 2M9NA 3RB4A 3PNCA 3UXOA 4F4WA 1JMSA 1ZQGA 4QZIA 9ICGA 2HDOA 3DV9A 5KFNA 1KRPA 9ICQA 4XA5A 3RBDA 1CEZA 2LPEA 3PR5B 4ELUA 5ALQA 3GV7B 4RT2A 3LK9A 2W7OA 4DFKA 4ECXA 8ICGA 8ICLA 4NXZA 4DS5A 4AYBC 4DSIA 1ZQOA 2DL0A 2R8GA 2ASLA 2KV2A 2D8CA 4BJQA 4QZBA 5DG8A 8ICFA 1V9PA 2P66A 4JV2A 3N7RC 4O5KA 3H0LB 2JR5A 4F50A 2ZIXA 4EENA 5D49A 3RH5A 2ASJA 5K4LA 5CRXA 4O3MA 4EBEA 4QWEA 3PMLA 4FS2A 5ALVA 5AKIA 2WF6A 1ZQIA 1F0MA 5ALFA 2Q0ZX 4YFKA 4U7CA 4RQ4A 5KG0A 2KFZA 4UASA 3H8JA 1T4GA 5KFXA 3BQ0A 1SL0A 1U45A 5CA7A 3QZ7A 3QU9A 7ICOA 4PHAA 3K1ZA 4RQMA 3E58A 9ICCA 1QSYA 2Z7JA 3N4MB 5CHGA 5J0OA 4YP3A 5ALNA 2ZUBA 1JRPA 1QSLA 4Z6DA 3PR4A 2JEJA 5IILA 1NZPA 3H4BA 1S8OA 3RJJA 4IQUA 4CCHA 2W11A 1YZ6A 3TAPA 3RJGA 3RRGA 3QUQA 4YD1A 3I28A 2QLTA 5KFYA 2KIVA 2A1JA 1L7OA 2YQEA 3RB3A 1L7MA 5ALZA 2D6FC 2I6XA 3OHBA 3RFAA 2ESEA 2DPJA 1QLNA 1N61A 2KVCA 3ZD9A 1TFRA 4BWJA 4KLLA 2GO7A 4ICAA 9ICNA 1Q3UA 3RAXA 4Y2XA 4C4SA 1NK9A 2ZIXB 4PHEA 9ICOA 2AU0A 1Z1VA 1SZPA 4JV0A 2ZIVB 2F2AB 4ED8A 2G07A 8ICXA 4FBTA 5KG4A 5HNKA 4UBBA 2W04A 3MBYA 3C28A 3OPXA 5ALSA 2IA6A 2EZYA 2KVSA 1SV0C 5KFPA 2GOLA 2BCVA 2LKYA 5KFVA 5EWGA 4M0AA 3V6KA 3RF9A 7ICEA 3DDHA 2CN1A 1RXWA 4K4GA 3SYZA 5L1MA 4YMNA 5CWRA 2F1HA 2HHXA 4I2BA 5GTHU 2G08A 1IV8A 3UQ2A 4CRXA 4DSJA 1XWLA 4P0PA 5AI4A 1TV9A 4DFMA 1TAQA 3TFSA 4I2IA 4UW9A 7ICUA 2RRDA 1KBUA 4M9LA 1B43A 3SAHA 4YCXA 4PL2A 1ZQ1C 3HW8A 5F3XB 4DOCA 3O0FA 4P0QA 2IHMA 2Y1JA 4UB5A 5ALIA 4EZ9A 3GIIA 1T7PA 4PJ0U 5DB8A 1SL1A 7ICHA 5J2CA 3WKDA 1N62A 2ALZA 3UMCA 2KG5A 1Z4NA 1VJ5A 3VC8A 2HHTA 4YD2A 1L3UA 4AYBF 4O5EA 3ISDA 2ZTEA 2W9BA 1X6JA 1COOA 2Y1IA 3H0MB 1NJXA 2JHDA 1Q3VA 1RM6C 4RU9A 2DF4B 5DB6A 5DB9A 5T14A 4C8KA 5KTQA 4PHPA 1X9SA 4DS4A 4RUCA 4QWAA 3PMNA 4ECZA 3H8MA 4QWBA 2RHFA 5KG7A 2JZBA 3K4GA 2HVIA 3TI0A 2ZUCA 2WTFA 4Y2UA 2KHQA 3PW0A 5DQIA 4DOBA 4EZ6A 3PSPA 2XC9A 3C5GA 1ED1A 1UPHA 4DF8A 2ISOA 4BWMA 3WKEA 3KHHA 4DQIA 4DO9A 4OCZA 2LYAA 1L3SA 4F5QA 2NRTA 2O6KA 1K1SA 2HVHA 5KFZA 2BPCA 4UB1A 2KZ3A 7ICLA 5D46A 1WYGA 3KHLA 2ZG6A 4RPYA 3M9NB 1XS9D 1NI3A 2KIWA 3SZ2A 1J97A 1UHUA 1X6IA 5KFTA 2A1AA 1DXSA 4F5NA 8ICIA 4ELTA 3RR7A 4B9SA 7ICQA 3M6ZA 4O0IA 1BNPA 2MUTA 5H2FU 5ALPA 3AM9A 3ICXA 2WF9A 3PO4A 3V7JA 2PI4A 4KX3A 1YT3A 4XUSA 4EEYA 3OJUA 3IV6A 2KE7A 3CP8A 3GFKB 5L1KA 3C21A 1KSPA 4PZOA 3ZDBA 3M1YA 1URJA 2F8KA 3VCBA 3FDSA 4IQTA 3Q8PB 4F93B 1F44A 3C23A 2YY6A 2ZJAA 4I2HA 1BVSA 5FP0A 3D2NA 1JI7A 2HBLA 4FS1A 1ZJNA 1SKSA 3RB0A 4JMUA 5KG3A 3HWTA 1ZYQA 4QWCA 5DKWA 3ZDAA 4RUAA 3NVYA 4Q45A 4HYKA 3QYPA 9ICTA 1SB3C 4KLDA 2JH1A 3EWAA 4O9MA 2HSZA 1DK2A 2C2EA 1S5LU 4NLBA 3EYZA 7ICGA 4Z6CA 3MR3A 7ICSA 3H40A 2P35A 2AQ0A 3C1YA 1UT8A 5DLGA 1RDFA 3D2QA 5IINA 2FI1A 2HHQA 5J0SA 2A1JB 5ALLA 5J0XA 4RNMA 2AGOA 1QQ5A 1KTQA 1KN5A 2WFAA 8ICKA 3F2BA 4J9PA 4F91B 5KL8B 3MFIA 1Q46A 1D8BA 4MFCA 3H8WA 3PVXA 3LDAA 1NK8A 2W8LA 3C29A 4UAYA 5AKGA 4ZH4A 2IHNA 4LZGA 4PGXA 3RBEA 1VLBA 4NY8A 8ICTA 1MC8A 4GXKA 3BS7A 9ICBA 3MDCA 2OH2A 2G5HB 4HAIA 3HJEA 2KHVA 3KOOA 4KLOA 3EPIA 3SMVA 4R8UA 5KFFA 2B21A 2E3TA 4QZGA 2VJ4A 3LVVA 3ORYA 5KFMA 1RZTA 2HHUA 4XQ8A 4YR3A 4UAZA 2Y0SF 2RDJA 3UMBA 2J6SA 1X40A 2LI6A 3GV5B 4ED0A 1ZQBA 4UATA 2HHSA 3TQ1A 2XI9A 2K8BB 4B9UA 1ZQLA 4USAA 4Y2JA 4WJ3B 3F2CA 3WK9A 8ICMA 2CPRA 4DQRA 2YN4A 4FZNA 1V38A 4FO6A 5ALKA 3OTQA 2IOFA 5ALJA 1ZD3A 8ICVA 3CYMA 5C5JA 1TK0A 2XIDA 1MN8A 2BCRA 2AXTU 4RQNA 4DOAA 1NNLA 5JUMA 1S0OA 4KLIA 5HR7A 2K8AA 2BHNA 2OHFA 1ZQPA 1LKYA 4QZFA 2XCPA 1YZ7A 5KAIU 5DG7A 2UVWA 2F3NA 4R65A 1B4FA 2H3ZA 1FO4A 3CRXA 1B0XA 1N5WA 2MRLA 1TK8A 8ICBA 2EH9A 4US9A 2HHVA 4MFFA 1BPBA 5CEHA 2AHOB 4Q43A 4FBUA 5J0UA 8ICRA 3Q8MA 2VA8A 4BX9C 4EBCA 5KT7A 1ZQZA 3UPQA 4MFAA 1KLNA 3L5KA 4JB3A 3BQ1A 4J9MA 3TADC 1NOMA 5J8YC 5KL1B 2FMSA 1SXDA 3WU2U 2EZZA 4K4IA 3NVWA 9ICKA 3Q8RB 1XC9A 4P0PB 2F1IA 3PV8A 1L3TA 1ZQHA 8ICAA 7ICIA 3NASA 1MA7A 4Y2PA 3T3FA 1NJWA 7ICNA 4LJXA 1A0PA 2PFQA 3HP6A 1SZHA 4ECQA 2KSOB 3BQ7A 2IMWP 3PZPA 4RNNA 2H3IA 3M6KA 2KJ5A 2BQ3A 3KZXA 5JTIA 4J9RA 5IIIA 3RJKA 2HMXA 5D4BA 3M9OB 2UVRA 4I2JA 4KTQA 2MU2A 7ICMA 1SGGA 4J03A 2OYYA 1WWVA 1FEZA 5L1IA 1DK3A 5IIOA 2VA3A 2FLLA 5DBAA 9ICXA 1ZQXA 3QZ8A 5AI0A 4CE6A 1N60A 3V6HA 4C80A 1XU4A 1OW5A 4QW9A 2WAQC 4QIWF 4TURA 2DWQA 5KFLA 2E5SA 3G6YA 8ICPA 2HBKA 3M8SA 3TARA 2KEYA 4GC7A 4DL5A 5J0YA 2K4HA 4OJOA 5EOZA 3K1RB 3JPOA 4YN4A 4DQSA 2XVTA 1CRXA 1LB2B 5AM5A 1NZBA 3IN5A 1HUZA 4J9QA 1M6YA 4X5VA 2P6UA 3MABA 4ECWA 2BKEA 3RTVA 2VJ5A 5KG5A 4UB8U 1COKA 3SEIA 2KP7A 3NUQA 2XGPA 3F5EA 4C8NA 5KFGA 1ZQWA 2BQRA 3D2SA 4EEKA 2UVVA 2PFNA 4UARA 2LM1A 4BDPA 3C1ZA 1BPEA 2EAPA 4Y2SA 1LKYB 5KFWA 1PVPA 4M9NA 5IIKA 3JPSA 4DF4A 1ZQYA 4DQQA 3T79A 2W9CA 2DGZA 1J2NA 5HHHA 5HHIA 5ALOA 2JV3A 1X2IA 2XICA 1A6SA 5AKYA 2R18A 3RJEA 1ZQFA 7ICRA 2ATLA 3NTUA 1TKDA 2VKQA 1WUDA 2NRZA 5AI9A 1MSWD 5KFKA 3DEEA 5AKKA 2Q4TA 2WAQF 4QIWC 4ZOHC 4RQ5A 4GLXA 4I2EA 3V6JA 2BPGA 2KSOA 3KTQA 2EDUA 4F4YA 3NRZA 4YR0A 1RYSA 5AI8A 2EQYA 5KT4A 4F2SA 4YQWA 3K75D 4JWNA 4RQ3A 4B9MA 3LWMA 4I29A 1ZD5A 4DQPA 3IRUA 4OD0A 3KFUF 4I2AA 4B9LA 4KX5A 4IR9A 2M0NA 3BQTA 2HW3A 5DGAA 5AM4A 1QSSA 2ZIUA 3IG5A 4QNLA 4NLCA 4RT3A 2WB1F 2A19A 1NK5A 1ZRNA 5ALYA 2W7PA 2KK0A 2W9AA 2DFLA 3WK4A 3C2MA 1XNSA 2FMPA 5EE9A 3JPTA 2MUTB 5B5EU 4UQGA 4M9GA 1DRGA 1SKWA 2I1QA 1BNOA 3KHRA 3TACB 5HMLA 3U26A 1C20A 2XY7A 5ALDA 1UA1A 2OXOA 1Q8KA 4F4KA 1XO1A 2P6RA 4TUSA 1JXEA 5DLFA 3ALRA 4Z6FA 1JXLA 3R9KA 1A77A 1KKXA 1QCKA 4KN4A 2KICA 2EAMA 4M6WA 3RRHA 3QU5A 7ICPA 4NL9A 3JPPA 5AKZA 1GO3F 1KW4A 4Z6EA 1SV0A 5KFJA 3GV8B 4YR2A 1U49A 5J0WA 9ICIA 1OUQA 3QUCA 5BPCA 2V4QA 1L8OA 2CXYA 5L9XA 1L3VA 2YB1A 1B22A 2UVUA 1N48A 4OO1J 3UXPA 5DQHA 2H3QA 5AM1A 3V7LA 5AKEA 3PSTA 5ALTA 4ED7A 4LVSA 5J2EA 4RPXA 4O3OA 9ICHA 3V72A 3BZCA 4IQWA 2QKQA 3B0XA 5AKHA 4RQ7A 4QZAA 1L7NA 1WCNA 2Y9TA 5ALXA 3FAHA 3HRDD 1RYUA 4QZ8A 5J0RA 3AN1A 4KN7A 2LM4A 2G5IB 3RAQA 4EELA 1ZQJA 2Y0SC 4TUQA 1PVQA 2WHEA 2ZIUB 2EZXA 3H4DA 5J2DA 4C8LA 1TAUA 3TKAA 4P2HA 5AK3A 5BOLA 3UM9A 2E8PA 4CGZA 3LWLA 4R64A 2GWSA 3CW2C 3KD3A 1FIQA 3TANA 1T8EA 3AQEA 1L8LA 3GILA 2FJ6A 4ECVA 4ED2A 5EE3A 4C7YA 2QARA 3M8RA 3F53A 2YB4A 2PFPA 4B6JA 4DFPA 4ECSA 3Q8KA 3BZKA 5AK6A 4Q8EA 4E0DA 9ICSA 1KFTA 3A0HU 3SV4A 4Y2RA 8ICEA 3WKAA 3E2EA 2W9CB 5TISU 3UQ0A 3Q8SB 2I5HA 5KAFU 2RP5A 1X66A 3GIJA 1L5UA 4IC9A 1WWUA 1U48A 2FLPA 4I27A 1DOQA 2VIXA 2W9BB 2V4RA 1Z00A 2AJQA 5ALEA 2L5YA 2EANA 5KT2A 2JRZA 5J2GA 2JGAA 5JU5A 5KFRA 4NM1A 3KKAC 3ONNA 7ICFA 2ODGA 2ZXIA 1XSPA 3MFHA 1JALA 1U47A 1NJYA 2PXIA 2YMPA 1IIPA 1QH9A 1UA0A 4F71A 1RYRA 8ICNA 3AQFA 5AI6A 4O5CA 1ZQEA 3KBBA 1ZRMA 2NYVA 3EPGA 3QX7A 4KMOB 5KFSA 5DG9A 1MQ3A 1SXEA 3RB6A 4R63A 4UAVA 5HP4A 3T5KA 1HIWA 3AEVA 4I2GA 2VANA 5IIMA 1FFUA 3PSIA 4UB6U 2J6TA 4DFDA 3H0RB 3A0BU 4PGYA 4KLMA 1TE2A 4F92B 3SENA 4KITB 4IL6U 4QZCA 1KDHA 4KLHA 2KZZA 4UAUA 4OJLA 3OSNA 2K89A 4F5RA 2KJ9A 9ICFA 1CUKA 4TUPA 2KFNA 1V97A 4G9BA 2ZIVA 1PK1A 4ED6A 5DQGA 2XY5A 1Y88A 4AP9A 8ICJA 1S97A 3C2LA 3IHQB 2LYHA 5AM0A 1WG8A 4FZLA 1S0MA 3NGDA 5KT6A 4NL9C 4UBCA 2BDPA 3B0YA 3TFRA 2ISPA 5AI5A 3LVWA 4QZEA 3GIKA 2K8CB 2E1FA 2FPLA 2HCFA 3QXGA 4R8UB 5AIAA 5F9LA 1U9LA 1D8LA 2HI0A 5DBBA 4YG2A 3NS1A 1AQ6A 4P4PA 2ZUDA 1DGSA 2C2DA 2W55A 4IR1A 4UB4A 2MSNA 3PW2A 4Y2VA 5DBCA 2ES6A 3OGUA 2BZFA 3NVZA 3MGVA 2YX8A 5AK4A 1QTMA 2JEIA 4ECUA 2W54A 3CNHA 4RQ0A 4RZRA 3JPQA 3HX0A 3T5HA 4KLSA 3MDAA 2PKEA 5DDMA 1Z4OA 2XO7A 4PGQA 4IRCA 2KOBA 3N7PD 5HMMA 1JIHA 3ETRA 4R66A 5KFAA 1Z00B 1ZQAA 9ICPA 5KT3A 1L6NA 5KFBA 1Z3EB 2XCAA 2D3DA 3SAGA 1SWVA 4I2FA 1QQ6A 1XSLA 3WK8A 5TZVA 1DGJA 1S76D 4UB3A 1PK1B 3PW4A 1X9XA 3Q8QB 4BGDA 3ZI4A 4ECTA 2BR0A 4DSEA 1AROP 4F72A 1D9DA 1IG6A 5AKJA 1JX4A 4EYIB 4CF5A 4QZHA 2NO4A 2RDIA 3MC1A 2JEGA 3ZD8A 2AGPA 1FFVA 4J9NA 1XO0A 2BCQA 4MEYA 1X9MA 8ICQA 1RXVA 5EWFA 2JEFA 3BDPA 1ZQUA 1ZQKA 5CB1A 3GZFA 1NKEA 1J2MA 3FM9A 1ZQVA 2LBOA 4TQSA 4QZ9A 1BGXT 2OWOA 4C4RA 4MF8A 5AKXA 4BXOB 4F5PA 5F9NA 4C8MA 4CNQA 1ZQSA 5ALHA
chains in the Genus database with same CATH topology
3RH6A 2VA2A 4B9SA 1U4BA 7ICQA 4O0IA 1NK5A 3RH4A 4JWMA 2BCSA 2AGQA 2MUTA 3QEAZ 4M04A 1LV5A 2W9AA 3OHAA 2DFLA 3PO4A 3C2MA 3V7JA 2XY6A 2F1JA 2PI4A 4DL7A 4NLNA 1PZNA 2FMPA 4PPXA 3JPTA 4XUSA 3PW5A 4EEYA 4GXJA 2C28A 2MUTB 1SL2A 3RJHA 3OJUA 4F3OA 5IIJA 4UQGA 4M9JA 4DEZA 4M9GA 3GDXA 2ZTCA 3N97B 1SKWA 3GFKB 2I1QA 5L1KA 3C21A 1KSPA 2ASDA 7ICKA 3KHGA 3C5FA 3ZDBA 3KHRA 4RPZA 5HMLA 3AU2A 3FDSA 4IQTA 2XY7A 1UA1A 5DDYA 3Q8PB 3MR6A 4F93B 2AQ4A 1A76A 3C23A 1TVAA 2R8HA 2ZJAA 4F4KA 1XO1A 1TK5A 2P6RA 4I2HA 5J2HA 1BVSA 3H8SA 5L1JA 1IM4A 2BCUA 3PW7A 1NK4A 2MAXA 4TUSA 1ZJNA 4FS1A 4O3SA 4C8OA 9ICMA 1SKSA 1JXEA 3RB0A 5DLFA 9ICUA 4Z6FA 1JXLA 1A77A 4KN4A 4KLFA 1ZETA 3MGHA 2BPFA 1KFSA 1D9FA 1WCLA 2BQUA 2PFOA 8ICHA 5CJ7A 5KG3A 3HWTA 4M6WA 5DB7A 1ZYQA 4QWCA 2FLNA 3RRHA 3RJFA 7ICPA 8ICYA 3JPPA 5DKWA 3ZDAA 4RUAA 4DSKA 5J2JA 4Q45A 5KG2A 4HYKA 3PX0A 9ICTA 2W8KA 4KLDA 2JZBB 4M6WB 4Z6EA 1D8YA 9ICLA 3EW9A 3EWAA 1ZQDA 8ICSA 4O9MA 4DSFA 4O3NA 5KFJA 3GV8B 4YR2A 1U49A 5J0WA 9ICAA 2C2EA 5KG6A 3EYZA 4KLQA 1S9FA 9ICIA 4M2YA 3QEBZ 1BPYA 7ICGA 1HJPA 3GQCA 4Z6CA 1ZQMA 3MR3A 4DFJA 5BPCA 2V4QA 3C2KA 8ICUA 4P4OA 3OSPA 7ICSA 5L9XA 4J9OA 9ICRA 2W9MA 4DWIA 5J2IA 3H40A 4B9VA 1L3VA 1B22A 2UVUA 3MGIA 2AQ0A 1N48A 7ICTA 5KFIA 4F8RA 3C1YA 1UT8A 5DLGA 1HUOA 9ICEA 3UXPA 5IINA 2FMQA 5DQHA 2HHQA 3V7LA 3THVA 5J0SA 2XGQA 2A1JB 2KTQA 5KT5A 5J0XA 4RNMA 4ED7A 2KZMA 2AGOA 4LVSA 2DPIA 7ICJA 5J2EA 4RPXA 4O3OA 9ICHA 3MR2A 3G6VA 9ICVA 3V72A 9ICJA 5KFUA 4IQWA 1KTQA 8ICWA 4I2CA 3B0XA 8ICKA 3MR5A 3AUOA 4J9PA 4F91B 3MFIA 4RQ7A 4QZAA 4MFCA 1KEJA 3H8WA 4YVZA 5KFEA 3PVXA 1WCNA 3LDAA 4TQRA 1NK8A 3BJYA 2W8LA 4UAYA 4QZ8A 4J9SA 4ZH4A 2IHNA 3EZ5A 4LZGA 5J0RA 4KN7A 4PGXA 3RBEA 4NY8A 2M9NA 1RPLA 3RB4A 3PNCA 3RAQA 3UXOA 8ICTA 4F4WA 1ZQJA 1MC8A 4GXKA 2HHWA 1JMSA 1ZQGA 4I28A 3MDCA 4QZIA 4TUQA 9ICBA 2ZJ8A 4UB2A 9ICGA 4QW8A 5KFDA 4JK1A 5KFNA 1KRPA 9ICQA 3H4DA 4XA5A 5J2DA 5KFFA 4R8UA 3EPIA 4C8LA 4KLOA 2B21A 3RBDA 1BPZA 4P4MA 1CEZA 4QZGA 4P2HA 3PX4A 5BOLA 4F2RA 4RQ2A 3PR5B 2C22A 4ELUA 3ORYA 5KFMA 1RZTA 2HHUA 4XQ8A 3GV7B 5L1LA 4YR3A 4RT2A 3LK9A 4UAZA 4NLGA 4DFKA 3LWLA 4ECXA 4R64A 2RDJA 8ICGA 8ICLA 2GWSA 4QZDA 4NXZA 4DSLA 2J6SA 3PY8A 3JPRA 3TANA 3PX6A 4QWDA 3T5JA 1T8EA 3GV5B 4RQ8A 4DS5A 4DSIA 3GILA 4ECVA 4ED2A 4ED0A 1ZQBA 1NK7A 2HHSA 3M8RA 4DL3A 1ZQOA 3TQ1A 2R8GA 1ZQTA 4B9UA 2PFPA 1ZQLA 2ASLA 4DFPA 4ECSA 3Q8KA 4QZBA 8ICFA 5DG8A 4Q8EA 1V9PA 4E0DA 9ICSA 2P66A 8ICMA 4DQRA 1KFTA 4JV2A 3SV4A 4FO6A 4O5KA 4G3IA 8ICEA 1S10A 4F50A 3E2EA 5KFOA 8ICVA 1MQ2A 5C5JA 5D49A 3RH5A 2ASJA 2W9CB 1TK0A 3UQ0A 4PHDA 2BCRA 3Q8SB 2IBKA 4EBEA 3UXNA 4QWEA 4DOAA 5JUMA 3PMLA 1S0OA 4FS2A 3GIJA 5KFQA 4KLIA 1L5UA 2BHNA 3AU6A 1ZQPA 1U48A 2FLPA 4QZFA 4EYHB 4EBDA 1DOQA 4I27A 2XCPA 2W9BB 1ZQIA 2V4RA 3BQ2A 1Z00A 5DG7A 2UVWA 3ISBA 2AJQA 5J2BA 4R65A 4YFKA 2Q0ZX 4RQ4A 5CR0A 5KT2A 1BPXA 5KG0A 5J2GA 2KFZA 3H8JA 4YXJA 1TK8A 8ICBA 5KFRA 1T4GA 2I9GA 5KFXA 4NM1A 3BQ0A 4DL4A 1SL0A 2HHVA 4MFFA 7ICFA 1BPBA 4Q43A 1U45A 5CA7A 3QZ7A 1XSPA 3MFHA 5J0UA 4PHAA 4FBUA 7ICOA 8ICRA 1U47A 1NJYA 3Q8MA 1ZQRA 9ICCA 1QSYA 2VA8A 4LZDA 4PH5A 4F4XA 2PXIA 3N4MB 5CHGA 5J0OA 1X9WA 4YP3A 4EBCA 2FPKA 5KT7A 1UA0A 2ZUBA 1ZQZA 1QSLA 4Z6DA 1RYRA 1EXNA 3UPQA 4MFAA 4YMMA 3PR4A 1KLNA 2JEJA 8ICNA 5IILA 1H38A 1ZQNA 1ZQEA 3BQ1A 4J9MA 4O5CA 1NOMA 3IM1A 3H4BA 4ELVA 3RJJA 4YMOA 3EPGA 3Q8LA 2FMSA 5KFCA 4IQUA 4CCHA 4K4IA 5KFSA 5DG9A 1MQ3A 1NJZA 9ICKA 3Q8RB 3RB6A 4R63A 3TAPA 1XC9A 3RJGA 2F1IA 3PV8A 5HP4A 1L3TA 1ZQHA 3RRGA 3RJIA 8ICAA 4YD1A 3T5KA 4GXIA 4I2GA 5KFYA 7ICIA 4BXOA 1T3NA 2A1JA 2NRXA 2VANA 5IIMA 4RQ1A 4IRKA 3T3FA 3RB3A 2NRWA 1NJWA 2J6TA 7ICNA 4KMUA 4PGYA 4KLMA 1KFDA 3OHBA 3HT3A 1ZJMA 4F92B 4ECRA 4KITB 5BOMA 2PFQA 4QZCA 2DPJA 1QLNA 1KDHA 3ZD9A 1TFRA 4Q44A 3HP6A 5KG1A 4BWJA 1XSNA 4ECQA 4KLLA 4KLHA 3OJSA 2IMWP 9ICNA 3RAXA 4RNNA 2KZZA 1S77D 3OSNA 3G6XA 4F5RA 2BQ3A 1NK9A 4IRDA 4PHEA 9ICOA 9ICFA 5EWEA 2AU0A 1ZQCA 4J9RA 1CUKA 3H7IA 1SZPA 4TUPA 5IIIA 3RJKA 2KFNA 3ZDDA 4JV0A 4ED8A 8ICXA 5D4BA 3ISCA 3M9OB 2PI5A 4B9TA 2UVRA 4I2JA 4FBTA 5KG4A 4KTQA 3RR8A 5HNKA 4KLUA 5J0QA 7ICMA 4ED6A 4UBBA 4MF2A 3MBYA 4I2DA 5DQGA 2XY5A 4YXMA 5L1IA 2IA6A 1Y88A 5IIOA 4K4HA 4O3RA 8ICJA 2VA3A 1S97A 5KFPA 3C2LA 2FLLA 5DBAA 9ICXA 1ZQXA 3QZ8A 3IHQB 2LYHA 2BCVA 5KFVA 5EWGA 1S0MA 3T5LA 4M0AA 3NGDA 5KT6A 3V6HA 4UBCA 5J2KA 3ZDCA 9ICWA 3V6KA 7ICEA 4MEXA 5DGBA 1RXWA 4M47A 1XU4A 4K4GA 2BDPA 4UAWA 4QW9A 4Q8FA 3B0YA 3SYZA 2C2RA 4TURA 3TFRA 2ISPA 1NK6A 5KFLA 1IXRA 4YMNA 5CWRA 4QZEA 3GIKA 2F1HA 5J29A 3G6YA 2HHXA 8ICPA 4I2BA 5J2FA 3M8SA 3TARA 8ICOA 2FPLA 2V9WA 4DLEA 4R8UB 3UQ2A 3TAQA 4DSJA 4GC7A 4DL5A 5F9LA 1U9LA 5J0YA 1XWLA 1D8LA 4DL2A 1TV9A 5EOZA 4DFMA 1S0VA 8ICCA 2ZTDA 1TAQA 3TFSA 3ZDEA 5DBBA 4YG2A 4I2IA 2KN7A 3JPOA 4YN4A 2ZJ5A 4NM2A 4DQSA 1NKCA 7ICUA 4P4PA 2ZUDA 1NK0A 3HPOA 1LB2B 1DGSA 4M9LA 1B43A 2C2DA 4YCXA 4NLZA 1HUZA 4J9QA 4IR1A 4UB4A 3HW8A 4DOCA 3PW2A 3OGUA 5DBCA 2IHMA 4UB5A 2Y1JA 4EZ9A 3GIIA 4JV1A 1QTMA 1T7PA 2JEIA 1SL1A 5DB8A 4J9KA 4X5VA 7ICHA 2P6UA 2HVHA 4ECUA 4DLGA 5J2CA 3MABA 2NRVA 4KLJA 4ECWA 2BKEA 2ALZA 3RTVA 4RQ0A 4O3QA 5KG5A 4RZRA 3JPNA 3JPQA 1UT5A 3HX0A 3T5HA 4KLSA 1TAUA 3MDAA 2R8IA 5DDMA 2XGPA 4C8NA 2HHTA 2XO7A 5KFGA 4YD2A 4PGQA 4ED3A 1ZQWA 4IRCA 1L3UA 2BQRA 4O5EA 1C7YA 5HMMA 3FYHA 1JIHA 4R66A 2UVVA 2PFNA 5KFAA 4BDPA 3C1ZA 1Z00B 1BPEA 2ZTEA 4RQ6A 2FPMA 3ISDA 2W9BA 5KFHA 1ZQAA 1COOA 2Y1IA 9ICPA 4M9HA 5KT3A 5KFWA 1NJXA 3PO5A 4O3PA 4M9NA 5IIKA 1ZQQA 4RU9A 1N56A 3JPSA 4ECYA 5KFBA 4DF4A 5DB6A 5DB9A 2H5XA 1NKBA 1Z3EB 1ZQYA 4DQQA 2XCAA 4C8KA 5KTQA 5J0PA 4PHPA 4JUZA 2W9CA 4DS4A 1X9SA 4B9NA 5HHHA 4RUCA 1XSLA 4QWAA 4I2FA 4NLKA 3PMNA 5HHIA 5TZVA 4ECZA 4GC6A 4QWBA 5KG7A 2JZBA 8ICZA 3K4GA 1S76D 2HVIA 3TI0A 4UB3A 3PW4A 2ZUCA 1X2IA 2WTFA 3Q8QB 5CP2A 4BGDA 3PW0A 3RJEA 1ZQFA 7ICRA 5DQIA 4DOBA 2ATLA 4EZ6A 4ECTA 3NTUA 4IQVA 3M9MB 2BR0A 2XC9A 4DSEA 1TKDA 2NRZA 3C5GA 2R8JA 4XRHA 1K1QA 1MSWD 1AROP 5KFKA 4RNOA 4DF8A 2ISOA 4BWMA 1D9DA 1S0NA 3KHHA 1JX4A 4DQIA 4EYIB 4DO9A 7ICVA 4QZHA 1BPDA 4RQ5A 4GLXA 2RDIA 3V6JA 2JEGA 4I2EA 2BPGA 3ZD8A 1L3SA 3KTQA 1JN3A 3QE9Y 5J0TA 4J9NA 2AGPA 2BCQA 1SKRA 4MEYA 4YR0A 4F5QA 2NRTA 4F4YA 4ED1A 1K1SA 1X9MA 5KT4A 1RXVA 1RYSA 3ETLA 5EWFA 4YQWA 3V7KA 2JEFA 4F2SA 3BDPA 3K75D 1ZQUA 5KFZA 2BPCA 4UB1A 2KZ3A 4J9LA 1ZQKA 7ICLA 5D46A 4JWNA 5CB1A 1NKEA 3KHLA 4RPYA 4RQ3A 3M9NB 1XS9D 1ZQVA 3GIMA 4TQSA 4QZ9A 4B9MA 1BGXT 3LWMA 2OWOA 4F5OA 4I29A 3SZ2A 4MF8A 4DL6A 4BXOB 4KLEA 4DQPA 4KLTA 5J2AA 8ICQA 2BGWA 4KLGA 4I2AA 3SI8A 2R8KA 4B9LA 4IR9A 4F5PA 5F9NA 3BQTA 4C8MA 5KFTA 4F4ZA 5DGAA 1QSSA 4F5NA 1ZQSA 2HW3A 4RT3A 3SV3A 8ICIA 4ELTA 2J6UA 3RR7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RH6 A;  2VA2 A;  4B9S A;  1U4B A;  7ICQ A;  4O0I A;  1NK5 A;  3RH4 A;  4JWM A;  2BCS A;  2AGQ A;  2MUT A;  3QEA Z;  4M04 A;  1LV5 A;  2W9A A;  3OHA A;  2DFL A;  3PO4 A;  3C2M A;  3V7J A;  2XY6 A;  2F1J A;  2PI4 A;  4DL7 A;  4NLN A;  1PZN A;  2FMP A;  4PPX A;  3JPT A;  4XUS A;  3PW5 A;  4EEY A;  4GXJ A;  2C28 A;  2MUT B;  1SL2 A;  3RJH A;  3OJU A;  4F3O A;  5IIJ A;  4UQG A;  4M9J A;  4DEZ A;  4M9G A;  3GDX A;  2ZTC A;  3N97 B;  1SKW A;  3GFK B;  2I1Q A;  5L1K A;  3C21 A;  1KSP A;  2ASD A;  7ICK A;  3KHG A;  3C5F A;  3ZDB A;  3KHR A;  4RPZ A;  5HML A;  3AU2 A;  3FDS A;  4IQT A;  2XY7 A;  1UA1 A;  5DDY A;  3Q8P B;  3MR6 A;  4F93 B;  2AQ4 A;  1A76 A;  3C23 A;  1TVA A;  2R8H A;  2ZJA A;  4F4K A;  1XO1 A;  1TK5 A;  2P6R A;  4I2H A;  5J2H A;  1BVS A;  3H8S A;  5L1J A;  1IM4 A;  2BCU A;  3PW7 A;  1NK4 A;  2MAX A;  4TUS A;  1ZJN A;  4FS1 A;  4O3S A;  4C8O A;  9ICM A;  1SKS A;  1JXE A;  3RB0 A;  5DLF A;  9ICU A;  4Z6F A;  1JXL A;  1A77 A;  4KN4 A;  4KLF A;  1ZET A;  3MGH A;  2BPF A;  1KFS A;  1D9F A;  1WCL A;  2BQU A;  2PFO A;  8ICH A;  5CJ7 A;  5KG3 A;  3HWT A;  4M6W A;  5DB7 A;  1ZYQ A;  4QWC A;  2FLN A;  3RRH A;  3RJF A;  7ICP A;  8ICY A;  3JPP A;  5DKW A;  3ZDA A;  4RUA A;  4DSK A;  5J2J A;  4Q45 A;  5KG2 A;  4HYK A;  3PX0 A;  9ICT A;  2W8K A;  4KLD A;  2JZB B;  4M6W B;  4Z6E A;  1D8Y A;  9ICL A;  3EW9 A;  3EWA A;  1ZQD A;  8ICS A;  4O9M A;  4DSF A;  4O3N A;  5KFJ A;  3GV8 B;  4YR2 A;  1U49 A;  5J0W A;  9ICA A;  2C2E A;  5KG6 A;  3EYZ A;  4KLQ A;  1S9F A;  9ICI A;  4M2Y A;  3QEB Z;  1BPY A;  7ICG A;  1HJP A;  3GQC A;  4Z6C A;  1ZQM A;  3MR3 A;  4DFJ A;  5BPC A;  2V4Q A;  3C2K A;  8ICU A;  4P4O A;  3OSP A;  7ICS A;  5L9X A;  4J9O A;  9ICR A;  2W9M A;  4DWI A;  5J2I A;  3H40 A;  4B9V A;  1L3V A;  1B22 A;  2UVU A;  3MGI A;  2AQ0 A;  1N48 A;  7ICT A;  5KFI A;  4F8R A;  3C1Y A;  1UT8 A;  5DLG A;  1HUO A;  9ICE A;  3UXP A;  5IIN A;  2FMQ A;  5DQH A;  2HHQ A;  3V7L A;  3THV A;  5J0S A;  2XGQ A;  2A1J B;  2KTQ A;  5KT5 A;  5J0X A;  4RNM A;  4ED7 A;  2KZM A;  2AGO A;  4LVS A;  2DPI A;  7ICJ A;  5J2E A;  4RPX A;  4O3O A;  9ICH A;  3MR2 A;  3G6V A;  9ICV A;  3V72 A;  9ICJ A;  5KFU A;  4IQW A;  1KTQ A;  8ICW A;  4I2C A;  3B0X A;  8ICK A;  3MR5 A;  3AUO A;  4J9P A;  4F91 B;  3MFI A;  4RQ7 A;  4QZA A;  4MFC A;  1KEJ A;  3H8W A;  4YVZ A;  5KFE A;  3PVX A;  1WCN A;  3LDA A;  4TQR A;  1NK8 A;  3BJY A;  2W8L A;  4UAY A;  4QZ8 A;  4J9S A;  4ZH4 A;  2IHN A;  3EZ5 A;  4LZG A;  5J0R A;  4KN7 A;  4PGX A;  3RBE A;  4NY8 A;  2M9N A;  1RPL A;  3RB4 A;  3PNC A;  3RAQ A;  3UXO A;  8ICT A;  4F4W A;  1ZQJ A;  1MC8 A;  4GXK A;  2HHW A;  1JMS A;  1ZQG A;  4I28 A;  3MDC A;  4QZI A;  4TUQ A;  9ICB A;  2ZJ8 A;  4UB2 A;  9ICG A;  4QW8 A;  5KFD A;  4JK1 A;  5KFN A;  1KRP A;  9ICQ A;  3H4D A;  4XA5 A;  5J2D A;  5KFF A;  4R8U A;  3EPI A;  4C8L A;  4KLO A;  2B21 A;  3RBD A;  1BPZ A;  4P4M A;  1CEZ A;  4QZG A;  4P2H A;  3PX4 A;  5BOL A;  4F2R A;  4RQ2 A;  3PR5 B;  2C22 A;  4ELU A;  3ORY A;  5KFM A;  1RZT A;  2HHU A;  4XQ8 A;  3GV7 B;  5L1L A;  4YR3 A;  4RT2 A;  3LK9 A;  4UAZ A;  4NLG A;  4DFK A;  3LWL A;  4ECX A;  4R64 A;  2RDJ A;  8ICG A;  8ICL A;  2GWS A;  4QZD A;  4NXZ A;  4DSL A;  2J6S A;  3PY8 A;  3JPR A;  3TAN A;  3PX6 A;  4QWD A;  3T5J A;  1T8E A;  3GV5 B;  4RQ8 A;  4DS5 A;  4DSI A;  3GIL A;  4ECV A;  4ED2 A;  4ED0 A;  1ZQB A;  1NK7 A;  2HHS A;  3M8R A;  4DL3 A;  1ZQO A;  3TQ1 A;  2R8G A;  1ZQT A;  4B9U A;  2PFP A;  1ZQL A;  2ASL A;  4DFP A;  4ECS A;  3Q8K A;  4QZB A;  8ICF A;  5DG8 A;  4Q8E A;  1V9P A;  4E0D A;  9ICS A;  2P66 A;  8ICM A;  4DQR A;  1KFT A;  4JV2 A;  3SV4 A;  4FO6 A;  4O5K A;  4G3I A;  8ICE A;  1S10 A;  4F50 A;  3E2E A;  5KFO A;  8ICV A;  1MQ2 A;  5C5J A;  5D49 A;  3RH5 A;  2ASJ A;  2W9C B;  1TK0 A;  3UQ0 A;  4PHD A;  2BCR A;  3Q8S B;  2IBK A;  4EBE A;  3UXN A;  4QWE A;  4DOA A;  5JUM A;  3PML A;  1S0O A;  4FS2 A;  3GIJ A;  5KFQ A;  4KLI A;  1L5U A;  2BHN A;  3AU6 A;  1ZQP A;  1U48 A;  2FLP A;  4QZF A;  4EYH B;  4EBD A;  1DOQ A;  4I27 A;  2XCP A;  2W9B B;  1ZQI A;  2V4R A;  3BQ2 A;  1Z00 A;  5DG7 A;  2UVW A;  3ISB A;  2AJQ A;  5J2B A;  4R65 A;  4YFK A;  2Q0Z X;  4RQ4 A;  5CR0 A;  5KT2 A;  1BPX A;  5KG0 A;  5J2G A;  2KFZ A;  3H8J A;  4YXJ A;  1TK8 A;  8ICB A;  5KFR A;  1T4G A;  2I9G A;  5KFX A;  4NM1 A;  3BQ0 A;  4DL4 A;  1SL0 A;  2HHV A;  4MFF A;  7ICF A;  1BPB A;  4Q43 A;  1U45 A;  5CA7 A;  3QZ7 A;  1XSP A;  3MFH A;  5J0U A;  4PHA A;  4FBU A;  7ICO A;  8ICR A;  1U47 A;  1NJY A;  3Q8M A;  1ZQR A;  9ICC A;  1QSY A;  2VA8 A;  4LZD A;  4PH5 A;  4F4X A;  2PXI A;  3N4M B;  5CHG A;  5J0O A;  1X9W A;  4YP3 A;  4EBC A;  2FPK A;  5KT7 A;  1UA0 A;  2ZUB A;  1ZQZ A;  1QSL A;  4Z6D A;  1RYR A;  1EXN A;  3UPQ A;  4MFA A;  4YMM A;  3PR4 A;  1KLN A;  2JEJ A;  8ICN A;  5IIL A;  1H38 A;  1ZQN A;  1ZQE A;  3BQ1 A;  4J9M A;  4O5C A;  1NOM A;  3IM1 A;  3H4B A;  4ELV A;  3RJJ A;  4YMO A;  3EPG A;  3Q8L A;  2FMS A;  5KFC A;  4IQU A;  4CCH A;  4K4I A;  5KFS A;  5DG9 A;  1MQ3 A;  1NJZ A;  9ICK A;  3Q8R B;  3RB6 A;  4R63 A;  3TAP A;  1XC9 A;  3RJG A;  2F1I A;  3PV8 A;  5HP4 A;  1L3T A;  1ZQH A;  3RRG A;  3RJI A;  8ICA A;  4YD1 A;  3T5K A;  4GXI A;  4I2G A;  5KFY A;  7ICI A;  4BXO A;  1T3N A;  2A1J A;  2NRX A;  2VAN A;  5IIM A;  4RQ1 A;  4IRK A;  3T3F A;  3RB3 A;  2NRW A;  1NJW A;  2J6T A;  7ICN A;  4KMU A;  4PGY A;  4KLM A;  1KFD A;  3OHB A;  3HT3 A;  1ZJM A;  4F92 B;  4ECR A;  4KIT B;  5BOM A;  2PFQ A;  4QZC A;  2DPJ A;  1QLN A;  1KDH A;  3ZD9 A;  1TFR A;  4Q44 A;  3HP6 A;  5KG1 A;  4BWJ A;  1XSN A;  4ECQ A;  4KLL A;  4KLH A;  3OJS A;  2IMW P;  9ICN A;  3RAX A;  4RNN A;  2KZZ A;  1S77 D;  3OSN A;  3G6X A;  4F5R A;  2BQ3 A;  1NK9 A;  4IRD A;  4PHE A;  9ICO A;  9ICF A;  5EWE A;  2AU0 A;  1ZQC A;  4J9R A;  1CUK A;  3H7I A;  1SZP A;  4TUP A;  5III A;  3RJK A;  2KFN A;  3ZDD A;  4JV0 A;  4ED8 A;  8ICX A;  5D4B A;  3ISC A;  3M9O B;  2PI5 A;  4B9T A;  2UVR A;  4I2J A;  4FBT A;  5KG4 A;  4KTQ A;  3RR8 A;  5HNK A;  4KLU A;  5J0Q A;  7ICM A;  4ED6 A;  4UBB A;  4MF2 A;  3MBY A;  4I2D A;  5DQG A;  2XY5 A;  4YXM A;  5L1I A;  2IA6 A;  1Y88 A;  5IIO A;  4K4H A;  4O3R A;  8ICJ A;  2VA3 A;  1S97 A;  5KFP A;  3C2L A;  2FLL A;  5DBA A;  9ICX A;  1ZQX A;  3QZ8 A;  3IHQ B;  2LYH A;  2BCV A;  5KFV A;  5EWG A;  1S0M A;  3T5L A;  4M0A A;  3NGD A;  5KT6 A;  3V6H A;  4UBC A;  5J2K A;  3ZDC A;  9ICW A;  3V6K A;  7ICE A;  4MEX A;  5DGB A;  1RXW A;  4M47 A;  1XU4 A;  4K4G A;  2BDP A;  4UAW A;  4QW9 A;  4Q8F A;  3B0Y A;  3SYZ A;  2C2R A;  4TUR A;  3TFR A;  2ISP A;  1NK6 A;  5KFL A;  1IXR A;  4YMN A;  5CWR A;  4QZE A;  3GIK A;  2F1H A;  5J29 A;  3G6Y A;  2HHX A;  8ICP A;  4I2B A;  5J2F A;  3M8S A;  3TAR A;  8ICO A;  2FPL A;  2V9W A;  4DLE A;  4R8U B;  3UQ2 A;  3TAQ A;  4DSJ A;  4GC7 A;  4DL5 A;  5F9L A;  1U9L A;  5J0Y A;  1XWL A;  1D8L A;  4DL2 A;  1TV9 A;  5EOZ A;  4DFM A;  1S0V A;  8ICC A;  2ZTD A;  1TAQ A;  3TFS A;  3ZDE A;  5DBB A;  4YG2 A;  4I2I A;  2KN7 A;  3JPO A;  4YN4 A;  2ZJ5 A;  4NM2 A;  4DQS A;  1NKC A;  7ICU A;  4P4P A;  2ZUD A;  1NK0 A;  3HPO A;  1LB2 B;  1DGS A;  4M9L A;  1B43 A;  2C2D A;  4YCX A;  4NLZ A;  1HUZ A;  4J9Q A;  4IR1 A;  4UB4 A;  3HW8 A;  4DOC A;  3PW2 A;  3OGU A;  5DBC A;  2IHM A;  4UB5 A;  2Y1J A;  4EZ9 A;  3GII A;  4JV1 A;  1QTM A;  1T7P A;  2JEI A;  1SL1 A;  5DB8 A;  4J9K A;  4X5V A;  7ICH A;  2P6U A;  2HVH A;  4ECU A;  4DLG A;  5J2C A;  3MAB A;  2NRV A;  4KLJ A;  4ECW A;  2BKE A;  2ALZ A;  3RTV A;  4RQ0 A;  4O3Q A;  5KG5 A;  4RZR A;  3JPN A;  3JPQ A;  1UT5 A;  3HX0 A;  3T5H A;  4KLS A;  1TAU A;  3MDA A;  2R8I A;  5DDM A;  2XGP A;  4C8N A;  2HHT A;  2XO7 A;  5KFG A;  4YD2 A;  4PGQ A;  4ED3 A;  1ZQW A;  4IRC A;  1L3U A;  2BQR A;  4O5E A;  1C7Y A;  5HMM A;  3FYH A;  1JIH A;  4R66 A;  2UVV A;  2PFN A;  5KFA A;  4BDP A;  3C1Z A;  1Z00 B;  1BPE A;  2ZTE A;  4RQ6 A;  2FPM A;  3ISD A;  2W9B A;  5KFH A;  1ZQA A;  1COO A;  2Y1I A;  9ICP A;  4M9H A;  5KT3 A;  5KFW A;  1NJX A;  3PO5 A;  4O3P A;  4M9N A;  5IIK A;  1ZQQ A;  4RU9 A;  1N56 A;  3JPS A;  4ECY A;  5KFB A;  4DF4 A;  5DB6 A;  5DB9 A;  2H5X A;  1NKB A;  1Z3E B;  1ZQY A;  4DQQ A;  2XCA A;  4C8K A;  5KTQ A;  5J0P A;  4PHP A;  4JUZ A;  2W9C A;  4DS4 A;  1X9S A;  4B9N A;  5HHH A;  4RUC A;  1XSL A;  4QWA A;  4I2F A;  4NLK A;  3PMN A;  5HHI A;  5TZV A;  4ECZ A;  4GC6 A;  4QWB A;  5KG7 A;  2JZB A;  8ICZ A;  3K4G A;  1S76 D;  2HVI A;  3TI0 A;  4UB3 A;  3PW4 A;  2ZUC A;  1X2I A;  2WTF A;  3Q8Q B;  5CP2 A;  4BGD A;  3PW0 A;  3RJE A;  1ZQF A;  7ICR A;  5DQI A;  4DOB A;  2ATL A;  4EZ6 A;  4ECT A;  3NTU A;  4IQV A;  3M9M B;  2BR0 A;  2XC9 A;  4DSE A;  1TKD A;  2NRZ A;  3C5G A;  2R8J A;  4XRH A;  1K1Q A;  1MSW D;  1ARO P;  5KFK A;  4RNO A;  4DF8 A;  2ISO A;  4BWM A;  1D9D A;  1S0N A;  3KHH A;  1JX4 A;  4DQI A;  4EYI B;  4DO9 A;  7ICV A;  4QZH A;  1BPD A;  4RQ5 A;  4GLX A;  2RDI A;  3V6J A;  2JEG A;  4I2E A;  2BPG A;  3ZD8 A;  1L3S A;  3KTQ A;  1JN3 A;  3QE9 Y;  5J0T A;  4J9N A;  2AGP A;  2BCQ A;  1SKR A;  4MEY A;  4YR0 A;  4F5Q A;  2NRT A;  4F4Y A;  4ED1 A;  1K1S A;  1X9M A;  5KT4 A;  1RXV A;  1RYS A;  3ETL A;  5EWF A;  4YQW A;  3V7K A;  2JEF A;  4F2S A;  3BDP A;  3K75 D;  1ZQU A;  5KFZ A;  2BPC A;  4UB1 A;  2KZ3 A;  4J9L A;  1ZQK A;  7ICL A;  5D46 A;  4JWN A;  5CB1 A;  1NKE A;  3KHL A;  4RPY A;  4RQ3 A;  3M9N B;  1XS9 D;  1ZQV A;  3GIM A;  4TQS A;  4QZ9 A;  4B9M A;  1BGX T;  3LWM A;  2OWO A;  4F5O A;  4I29 A;  3SZ2 A;  4MF8 A;  4DL6 A;  4BXO B;  4KLE A;  4DQP A;  4KLT A;  5J2A A;  8ICQ A;  2BGW A;  4KLG A;  4I2A A;  3SI8 A;  2R8K A;  4B9L A;  4IR9 A;  4F5P A;  5F9N A;  3BQT A;  4C8M A;  5KFT A;  4F4Z A;  5DGA A;  1QSS A;  4F5N A;  1ZQS A;  2HW3 A;  4RT3 A;  3SV3 A;  8ICI A;  4ELT A;  2J6U A;  3RR7 A; 
#chains in the Genus database with same CATH topology
 3RH4 A;  4JWM A;  2AGQ A;  3QEA Z;  2E8O A;  2IOH A;  2KD1 A;  3HKZ F;  3OHA A;  4DL7 A;  3PW5 A;  5AIC A;  4Y2Y A;  1SL2 A;  3D6J A;  3RJH A;  4F3O A;  5IIJ A;  4EX6 A;  4M9J A;  3AL0 B;  2RQ5 A;  3GDX A;  2ZTC A;  7ICK A;  2KJ8 A;  3QNM A;  4RPZ A;  2HOI A;  3MR6 A;  2LMR A;  1OXJ A;  5AM3 A;  3SR6 A;  2Y9U A;  5J2H A;  5L1J A;  2MA1 A;  5AHX A;  4NWI A;  2BCU A;  3PW7 A;  1VDV A;  4C8O A;  9ICU A;  2KNJ A;  4EX7 A;  3L4P A;  2PMZ C;  4NJ8 A;  1ZET A;  3S6J A;  3MGH A;  2BPF A;  1KFS A;  2BQU A;  8ICH A;  2ZXH A;  2OM6 A;  5DB7 A;  2G06 A;  2FLN A;  2WF8 A;  5AIB A;  1K5O A;  5J2J A;  5ALW A;  1ZD2 P;  2JZB B;  9ICL A;  8ICS A;  3EUB 2;  4DSF A;  1V85 A;  4KLQ A;  4M2Y A;  3QEB Z;  1BPY A;  4CF4 A;  1T94 A;  2JXJ A;  1HJP A;  3GQC A;  2YMM A;  1ZQM A;  4MHV A;  3C2K A;  8ICU A;  4P4O A;  2H3V A;  2HOF A;  1Z19 A;  9ICR A;  4DWI A;  5J2I A;  3QUB A;  7ICT A;  3MGI A;  1KQQ A;  2GH1 A;  2W3S A;  4F8R A;  4GIB A;  9ICE A;  2FMQ A;  2GLE A;  3SAF A;  3THV A;  1F5S A;  2XGQ A;  2KTQ A;  5KT5 A;  4FFD A;  2DPI A;  7ICJ A;  3L3F X;  5KFU A;  3QU4 A;  8ICW A;  2HBJ A;  2DBY A;  2NV3 A;  3AUO A;  1HEK A;  1LVH A;  4YVZ A;  5KFE A;  3BJY A;  4J9S A;  5AM2 A;  3EZ5 A;  1RPL A;  2QB1 A;  2ZIW B;  4A8E A;  5ALR A;  3NRW A;  2OCE A;  2HHW A;  3TAD A;  4I28 A;  2ZJ8 A;  4NV0 A;  4UB2 A;  4QW8 A;  1SWW A;  5KFD A;  4JK1 A;  1SV4 A;  3J81 j;  1BPZ A;  4P4M A;  3PX4 A;  1UQV A;  4F2R A;  4RQ2 A;  2C22 A;  5L1L A;  4NLG A;  4QZD A;  4DSL A;  5AKL A;  3PY8 A;  3JPR A;  3PX6 A;  4QWD A;  3IP4 B;  5ALM A;  3T5J A;  3M7D A;  3N28 A;  4RQ8 A;  1TAM A;  2B6G A;  5GTI U;  2YML A;  1NK7 A;  4DL3 A;  1JRO A;  1ZQT A;  3WKC A;  2W3R A;  4G3I A;  1S10 A;  4DCC A;  5KFO A;  1MQ2 A;  1QQ7 A;  4PL1 A;  4PHD A;  2IBK A;  3UXN A;  2KKV A;  5ALG A;  5KFQ A;  3HKZ C;  3AU6 A;  3F5A A;  4EYH B;  4EBD A;  3BQ2 A;  3ISB A;  5J2B A;  5CR0 A;  1BPX A;  4YXJ A;  1PUZ A;  2I9G A;  4DL4 A;  2JMG A;  1ZQR A;  4LZD A;  4PH5 A;  4F4X A;  3WKB A;  1X9W A;  4P0Q B;  2FPK A;  3WK6 A;  1O08 A;  4Y2T A;  1EXN A;  4YMM A;  1H38 A;  1ZQN A;  3IM1 A;  4ELV A;  4YMO A;  3Q8L A;  5KFC A;  4C7Z A;  4OJ6 A;  2G09 A;  1NJZ A;  5ALU A;  3RJI A;  4GXI A;  4BXO A;  1T3N A;  2NRX A;  4IRK A;  4RQ1 A;  1RQL A;  2NRW A;  3SQI A;  4KMU A;  3NVV A;  3UMG A;  1KFD A;  3HT3 A;  1ZJM A;  4ECR A;  3QU7 A;  5BOM A;  5EE1 A;  4Q44 A;  5KG1 A;  1XSN A;  2KMD A;  3OJS A;  5AK5 A;  2K60 A;  1S77 D;  3G6X A;  4ACO A;  4IRD A;  5EWE A;  3KKA A;  1ZQC A;  3H7I A;  2YMQ A;  3ZDD A;  3ED5 A;  3KZI U;  3ISC A;  2PI5 A;  4B9T A;  5G5G A;  2BDU A;  4KLU A;  3RR8 A;  3IDW A;  5J0Q A;  4MF2 A;  1SIJ A;  4I2D A;  2WF7 A;  4YXM A;  4K4H A;  2HBM A;  4O3R A;  3T5L A;  5J2K A;  3ZDC A;  5HR6 A;  9ICW A;  4MEX A;  5DGB A;  4M47 A;  4UAW A;  2QB0 A;  4Q8F A;  5KNI A;  2C2R A;  5G5H A;  1NK6 A;  1IXR A;  5J29 A;  4FZM A;  5J2F A;  8ICO A;  2V9W A;  4DLE A;  3TAQ A;  2AH5 A;  4DL2 A;  8ICC A;  1S0V A;  2ZTD A;  3ZDE A;  2KN7 A;  4OJP A;  2ZJ5 A;  4NM2 A;  1NKC A;  4C0Z A;  1NK0 A;  3HPO A;  3SD7 A;  3LYS A;  5JRT A;  4NLZ A;  3HIL A;  4US8 A;  2PMZ F;  2E8M A;  4JV1 A;  2A3V A;  1UCV A;  4J9K A;  4DLG A;  2NRV A;  4KLJ A;  2E1E A;  4O3Q A;  3JPN A;  1UT5 A;  1O03 A;  2R8I A;  4CDG A;  2K4P A;  2LYB A;  4ED3 A;  2YTU A;  1C7Y A;  1KL9 A;  3FYH A;  4RQ6 A;  2QB0 B;  2FPM A;  5KFH A;  4M9H A;  3PO5 A;  4O3P A;  3B9J A;  2DKX A;  1ZQQ A;  1N56 A;  1ZXI A;  3I76 A;  4ECY A;  1ZD4 A;  3BS5 B;  2H5X A;  1NKB A;  4QJF B;  5J0P A;  4JUZ A;  2F44 A;  4B9N A;  4NLK A;  2F8L A;  4BUG A;  4GC6 A;  4CF3 A;  8ICZ A;  4FE3 A;  2KKP A;  4IS7 A;  5CP2 A;  2IOF K;  5A0L A;  4IQV A;  3M9M B;  1PK3 A;  2R8J A;  2LHT A;  4XRH A;  1K1Q A;  3E0F A;  4RNO A;  1S0N A;  4OJ5 A;  1CI4 A;  7ICV A;  3BS5 A;  1BPD A;  1JN3 A;  2K4I A;  5J0T A;  3QE9 Y;  4GFJ A;  2NO5 A;  1SKR A;  4ED1 A;  3ETL A;  3V7K A;  3WK7 A;  2EAO A;  4J9L A;  3GIM A;  4F5O A;  2FE9 A;  4DL6 A;  4KLE A;  4KLT A;  5J2A A;  3GU3 A;  2BGW A;  4KLG A;  3SI8 A;  2WF5 A;  2R8K A;  4F4Z A;  3SV3 A;  3AMZ A;  5E79 U;  2JH7 A;  4U6P A;  3RH6 A;  2VA2 A;  1U4B A;  2OEH A;  2DKZ A;  2ZIW A;  2BCS A;  4M04 A;  3QUT A;  1LV5 A;  3WK5 A;  2XY6 A;  2F1J A;  4NLN A;  1P7D A;  1PZN A;  4PPX A;  4GXJ A;  2C28 A;  2H3F A;  1JUD A;  4DEZ A;  3N97 B;  1N2X A;  2ASD A;  3KHG A;  5B66 U;  3C5F A;  3AU2 A;  5DDY A;  2AQ4 A;  2K4E A;  1A76 A;  1TVA A;  2RLT A;  2R8H A;  2DUY A;  5C0Y A;  1TK5 A;  3QU2 A;  3H8S A;  1IM4 A;  1NK4 A;  2MAX A;  4O3S A;  9ICM A;  1ECW A;  1PVR A;  3F2D A;  2N1R A;  1N5X A;  4KLF A;  3FC4 A;  2DQN B;  2J6U A;  2FDR A;  1D9F A;  1WCL A;  2PFO A;  3IG8 A;  5CJ7 A;  2B0C A;  3RJF A;  5J8Y A;  8ICY A;  2W43 A;  4DSK A;  5KG2 A;  3PX0 A;  2HOQ A;  2W8K A;  4M6W B;  3PSF A;  1D8Y A;  3EW9 A;  1ZQD A;  1L7P A;  4O3N A;  9ICA A;  4Y2Q A;  5KG6 A;  2QAR B;  1S9F A;  5EE0 A;  4DFJ A;  3OSP A;  2CRX A;  4J9O A;  2W9M A;  4B9V A;  1N63 A;  3I1Y A;  5KFI A;  1Z1B A;  1HUO A;  1T3Q A;  2KZM A;  1ZOL A;  2WB1 C;  3MR2 A;  3G6V A;  9ICV A;  9ICJ A;  1RG6 A;  3N7S C;  4PZN A;  4C4T A;  4I2C A;  3MR5 A;  1RQN A;  2F76 X;  1X42 A;  1KEJ A;  4TQR A;  2E8N A;  2G0A A;  2W03 A;  2F77 X;  2M9N A;  3RB4 A;  3PNC A;  3UXO A;  4F4W A;  1JMS A;  1ZQG A;  4QZI A;  9ICG A;  2HDO A;  3DV9 A;  5KFN A;  1KRP A;  9ICQ A;  4XA5 A;  3RBD A;  1CEZ A;  2LPE A;  3PR5 B;  4ELU A;  5ALQ A;  3GV7 B;  4RT2 A;  3LK9 A;  2W7O A;  4DFK A;  4ECX A;  8ICG A;  8ICL A;  4NXZ A;  4DS5 A;  4AYB C;  4DSI A;  1ZQO A;  2DL0 A;  2R8G A;  2ASL A;  2KV2 A;  2D8C A;  4BJQ A;  4QZB A;  5DG8 A;  8ICF A;  1V9P A;  2P66 A;  4JV2 A;  3N7R C;  4O5K A;  3H0L B;  2JR5 A;  4F50 A;  2ZIX A;  4EEN A;  5D49 A;  3RH5 A;  2ASJ A;  5K4L A;  5CRX A;  4O3M A;  4EBE A;  4QWE A;  3PML A;  4FS2 A;  5ALV A;  5AKI A;  2WF6 A;  1ZQI A;  1F0M A;  5ALF A;  2Q0Z X;  4YFK A;  4U7C A;  4RQ4 A;  5KG0 A;  2KFZ A;  4UAS A;  3H8J A;  1T4G A;  5KFX A;  3BQ0 A;  1SL0 A;  1U45 A;  5CA7 A;  3QZ7 A;  3QU9 A;  7ICO A;  4PHA A;  3K1Z A;  4RQM A;  3E58 A;  9ICC A;  1QSY A;  2Z7J A;  3N4M B;  5CHG A;  5J0O A;  4YP3 A;  5ALN A;  2ZUB A;  1JRP A;  1QSL A;  4Z6D A;  3PR4 A;  2JEJ A;  5IIL A;  1NZP A;  3H4B A;  1S8O A;  3RJJ A;  4IQU A;  4CCH A;  2W11 A;  1YZ6 A;  3TAP A;  3RJG A;  3RRG A;  3QUQ A;  4YD1 A;  3I28 A;  2QLT A;  5KFY A;  2KIV A;  2A1J A;  1L7O A;  2YQE A;  3RB3 A;  1L7M A;  5ALZ A;  2D6F C;  2I6X A;  3OHB A;  3RFA A;  2ESE A;  2DPJ A;  1QLN A;  1N61 A;  2KVC A;  3ZD9 A;  1TFR A;  4BWJ A;  4KLL A;  2GO7 A;  4ICA A;  9ICN A;  1Q3U A;  3RAX A;  4Y2X A;  4C4S A;  1NK9 A;  2ZIX B;  4PHE A;  9ICO A;  2AU0 A;  1Z1V A;  1SZP A;  4JV0 A;  2ZIV B;  2F2A B;  4ED8 A;  2G07 A;  8ICX A;  4FBT A;  5KG4 A;  5HNK A;  4UBB A;  2W04 A;  3MBY A;  3C28 A;  3OPX A;  5ALS A;  2IA6 A;  2EZY A;  2KVS A;  1SV0 C;  5KFP A;  2GOL A;  2BCV A;  2LKY A;  5KFV A;  5EWG A;  4M0A A;  3V6K A;  3RF9 A;  7ICE A;  3DDH A;  2CN1 A;  1RXW A;  4K4G A;  3SYZ A;  5L1M A;  4YMN A;  5CWR A;  2F1H A;  2HHX A;  4I2B A;  5GTH U;  2G08 A;  1IV8 A;  3UQ2 A;  4CRX A;  4DSJ A;  1XWL A;  4P0P A;  5AI4 A;  1TV9 A;  4DFM A;  1TAQ A;  3TFS A;  4I2I A;  4UW9 A;  7ICU A;  2RRD A;  1KBU A;  4M9L A;  1B43 A;  3SAH A;  4YCX A;  4PL2 A;  1ZQ1 C;  3HW8 A;  5F3X B;  4DOC A;  3O0F A;  4P0Q A;  2IHM A;  2Y1J A;  4UB5 A;  5ALI A;  4EZ9 A;  3GII A;  1T7P A;  4PJ0 U;  5DB8 A;  1SL1 A;  7ICH A;  5J2C A;  3WKD A;  1N62 A;  2ALZ A;  3UMC A;  2KG5 A;  1Z4N A;  1VJ5 A;  3VC8 A;  2HHT A;  4YD2 A;  1L3U A;  4AYB F;  4O5E A;  3ISD A;  2ZTE A;  2W9B A;  1X6J A;  1COO A;  2Y1I A;  3H0M B;  1NJX A;  2JHD A;  1Q3V A;  1RM6 C;  4RU9 A;  2DF4 B;  5DB6 A;  5DB9 A;  5T14 A;  4C8K A;  5KTQ A;  4PHP A;  1X9S A;  4DS4 A;  4RUC A;  4QWA A;  3PMN A;  4ECZ A;  3H8M A;  4QWB A;  2RHF A;  5KG7 A;  2JZB A;  3K4G A;  2HVI A;  3TI0 A;  2ZUC A;  2WTF A;  4Y2U A;  2KHQ A;  3PW0 A;  5DQI A;  4DOB A;  4EZ6 A;  3PSP A;  2XC9 A;  3C5G A;  1ED1 A;  1UPH A;  4DF8 A;  2ISO A;  4BWM A;  3WKE A;  3KHH A;  4DQI A;  4DO9 A;  4OCZ A;  2LYA A;  1L3S A;  4F5Q A;  2NRT A;  2O6K A;  1K1S A;  2HVH A;  5KFZ A;  2BPC A;  4UB1 A;  2KZ3 A;  7ICL A;  5D46 A;  1WYG A;  3KHL A;  2ZG6 A;  4RPY A;  3M9N B;  1XS9 D;  1NI3 A;  2KIW A;  3SZ2 A;  1J97 A;  1UHU A;  1X6I A;  5KFT A;  2A1A A;  1DXS A;  4F5N A;  8ICI A;  4ELT A;  3RR7 A;  4B9S A;  7ICQ A;  3M6Z A;  4O0I A;  1BNP A;  2MUT A;  5H2F U;  5ALP A;  3AM9 A;  3ICX A;  2WF9 A;  3PO4 A;  3V7J A;  2PI4 A;  4KX3 A;  1YT3 A;  4XUS A;  4EEY A;  3OJU A;  3IV6 A;  2KE7 A;  3CP8 A;  3GFK B;  5L1K A;  3C21 A;  1KSP A;  4PZO A;  3ZDB A;  3M1Y A;  1URJ A;  2F8K A;  3VCB A;  3FDS A;  4IQT A;  3Q8P B;  4F93 B;  1F44 A;  3C23 A;  2YY6 A;  2ZJA A;  4I2H A;  1BVS A;  5FP0 A;  3D2N A;  1JI7 A;  2HBL A;  4FS1 A;  1ZJN A;  1SKS A;  3RB0 A;  4JMU A;  5KG3 A;  3HWT A;  1ZYQ A;  4QWC A;  5DKW A;  3ZDA A;  4RUA A;  3NVY A;  4Q45 A;  4HYK A;  3QYP A;  9ICT A;  1SB3 C;  4KLD A;  2JH1 A;  3EWA A;  4O9M A;  2HSZ A;  1DK2 A;  2C2E A;  1S5L U;  4NLB A;  3EYZ A;  7ICG A;  4Z6C A;  3MR3 A;  7ICS A;  3H40 A;  2P35 A;  2AQ0 A;  3C1Y A;  1UT8 A;  5DLG A;  1RDF A;  3D2Q A;  5IIN A;  2FI1 A;  2HHQ A;  5J0S A;  2A1J B;  5ALL A;  5J0X A;  4RNM A;  2AGO A;  1QQ5 A;  1KTQ A;  1KN5 A;  2WFA A;  8ICK A;  3F2B A;  4J9P A;  4F91 B;  5KL8 B;  3MFI A;  1Q46 A;  1D8B A;  4MFC A;  3H8W A;  3PVX A;  3LDA A;  1NK8 A;  2W8L A;  3C29 A;  4UAY A;  5AKG A;  4ZH4 A;  2IHN A;  4LZG A;  4PGX A;  3RBE A;  1VLB A;  4NY8 A;  8ICT A;  1MC8 A;  4GXK A;  3BS7 A;  9ICB A;  3MDC A;  2OH2 A;  2G5H B;  4HAI A;  3HJE A;  2KHV A;  3KOO A;  4KLO A;  3EPI A;  3SMV A;  4R8U A;  5KFF A;  2B21 A;  2E3T A;  4QZG A;  2VJ4 A;  3LVV A;  3ORY A;  5KFM A;  1RZT A;  2HHU A;  4XQ8 A;  4YR3 A;  4UAZ A;  2Y0S F;  2RDJ A;  3UMB A;  2J6S A;  1X40 A;  2LI6 A;  3GV5 B;  4ED0 A;  1ZQB A;  4UAT A;  2HHS A;  3TQ1 A;  2XI9 A;  2K8B B;  4B9U A;  1ZQL A;  4USA A;  4Y2J A;  4WJ3 B;  3F2C A;  3WK9 A;  8ICM A;  2CPR A;  4DQR A;  2YN4 A;  4FZN A;  1V38 A;  4FO6 A;  5ALK A;  3OTQ A;  2IOF A;  5ALJ A;  1ZD3 A;  8ICV A;  3CYM A;  5C5J A;  1TK0 A;  2XID A;  1MN8 A;  2BCR A;  2AXT U;  4RQN A;  4DOA A;  1NNL A;  5JUM A;  1S0O A;  4KLI A;  5HR7 A;  2K8A A;  2BHN A;  2OHF A;  1ZQP A;  1LKY A;  4QZF A;  2XCP A;  1YZ7 A;  5KAI U;  5DG7 A;  2UVW A;  2F3N A;  4R65 A;  1B4F A;  2H3Z A;  1FO4 A;  3CRX A;  1B0X A;  1N5W A;  2MRL A;  1TK8 A;  8ICB A;  2EH9 A;  4US9 A;  2HHV A;  4MFF A;  1BPB A;  5CEH A;  2AHO B;  4Q43 A;  4FBU A;  5J0U A;  8ICR A;  3Q8M A;  2VA8 A;  4BX9 C;  4EBC A;  5KT7 A;  1ZQZ A;  3UPQ A;  4MFA A;  1KLN A;  3L5K A;  4JB3 A;  3BQ1 A;  4J9M A;  3TAD C;  1NOM A;  5J8Y C;  5KL1 B;  2FMS A;  1SXD A;  3WU2 U;  2EZZ A;  4K4I A;  3NVW A;  9ICK A;  3Q8R B;  1XC9 A;  4P0P B;  2F1I A;  3PV8 A;  1L3T A;  1ZQH A;  8ICA A;  7ICI A;  3NAS A;  1MA7 A;  4Y2P A;  3T3F A;  1NJW A;  7ICN A;  4LJX A;  1A0P A;  2PFQ A;  3HP6 A;  1SZH A;  4ECQ A;  2KSO B;  3BQ7 A;  2IMW P;  3PZP A;  4RNN A;  2H3I A;  3M6K A;  2KJ5 A;  2BQ3 A;  3KZX A;  5JTI A;  4J9R A;  5III A;  3RJK A;  2HMX A;  5D4B A;  3M9O B;  2UVR A;  4I2J A;  4KTQ A;  2MU2 A;  7ICM A;  1SGG A;  4J03 A;  2OYY A;  1WWV A;  1FEZ A;  5L1I A;  1DK3 A;  5IIO A;  2VA3 A;  2FLL A;  5DBA A;  9ICX A;  1ZQX A;  3QZ8 A;  5AI0 A;  4CE6 A;  1N60 A;  3V6H A;  4C80 A;  1XU4 A;  1OW5 A;  4QW9 A;  2WAQ C;  4QIW F;  4TUR A;  2DWQ A;  5KFL A;  2E5S A;  3G6Y A;  8ICP A;  2HBK A;  3M8S A;  3TAR A;  2KEY A;  4GC7 A;  4DL5 A;  5J0Y A;  2K4H A;  4OJO A;  5EOZ A;  3K1R B;  3JPO A;  4YN4 A;  4DQS A;  2XVT A;  1CRX A;  1LB2 B;  5AM5 A;  1NZB A;  3IN5 A;  1HUZ A;  4J9Q A;  1M6Y A;  4X5V A;  2P6U A;  3MAB A;  4ECW A;  2BKE A;  3RTV A;  2VJ5 A;  5KG5 A;  4UB8 U;  1COK A;  3SEI A;  2KP7 A;  3NUQ A;  2XGP A;  3F5E A;  4C8N A;  5KFG A;  1ZQW A;  2BQR A;  3D2S A;  4EEK A;  2UVV A;  2PFN A;  4UAR A;  2LM1 A;  4BDP A;  3C1Z A;  1BPE A;  2EAP A;  4Y2S A;  1LKY B;  5KFW A;  1PVP A;  4M9N A;  5IIK A;  3JPS A;  4DF4 A;  1ZQY A;  4DQQ A;  3T79 A;  2W9C A;  2DGZ A;  1J2N A;  5HHH A;  5HHI A;  5ALO A;  2JV3 A;  1X2I A;  2XIC A;  1A6S A;  5AKY A;  2R18 A;  3RJE A;  1ZQF A;  7ICR A;  2ATL A;  3NTU A;  1TKD A;  2VKQ A;  1WUD A;  2NRZ A;  5AI9 A;  1MSW D;  5KFK A;  3DEE A;  5AKK A;  2Q4T A;  2WAQ F;  4QIW C;  4ZOH C;  4RQ5 A;  4GLX A;  4I2E A;  3V6J A;  2BPG A;  2KSO A;  3KTQ A;  2EDU A;  4F4Y A;  3NRZ A;  4YR0 A;  1RYS A;  5AI8 A;  2EQY A;  5KT4 A;  4F2S A;  4YQW A;  3K75 D;  4JWN A;  4RQ3 A;  4B9M A;  3LWM A;  4I29 A;  1ZD5 A;  4DQP A;  3IRU A;  4OD0 A;  3KFU F;  4I2A A;  4B9L A;  4KX5 A;  4IR9 A;  2M0N A;  3BQT A;  2HW3 A;  5DGA A;  5AM4 A;  1QSS A;  2ZIU A;  3IG5 A;  4QNL A;  4NLC A;  4RT3 A;  2WB1 F;  2A19 A;  1NK5 A;  1ZRN A;  5ALY A;  2W7P A;  2KK0 A;  2W9A A;  2DFL A;  3WK4 A;  3C2M A;  1XNS A;  2FMP A;  5EE9 A;  3JPT A;  2MUT B;  5B5E U;  4UQG A;  4M9G A;  1DRG A;  1SKW A;  2I1Q A;  1BNO A;  3KHR A;  3TAC B;  5HML A;  3U26 A;  1C20 A;  2XY7 A;  5ALD A;  1UA1 A;  2OXO A;  1Q8K A;  4F4K A;  1XO1 A;  2P6R A;  4TUS A;  1JXE A;  5DLF A;  3ALR A;  4Z6F A;  1JXL A;  3R9K A;  1A77 A;  1KKX A;  1QCK A;  4KN4 A;  2KIC A;  2EAM A;  4M6W A;  3RRH A;  3QU5 A;  7ICP A;  4NL9 A;  3JPP A;  5AKZ A;  1GO3 F;  1KW4 A;  4Z6E A;  1SV0 A;  5KFJ A;  3GV8 B;  4YR2 A;  1U49 A;  5J0W A;  9ICI A;  1OUQ A;  3QUC A;  5BPC A;  2V4Q A;  1L8O A;  2CXY A;  5L9X A;  1L3V A;  2YB1 A;  1B22 A;  2UVU A;  1N48 A;  4OO1 J;  3UXP A;  5DQH A;  2H3Q A;  5AM1 A;  3V7L A;  5AKE A;  3PST A;  5ALT A;  4ED7 A;  4LVS A;  5J2E A;  4RPX A;  4O3O A;  9ICH A;  3V72 A;  3BZC A;  4IQW A;  2QKQ A;  3B0X A;  5AKH A;  4RQ7 A;  4QZA A;  1L7N A;  1WCN A;  2Y9T A;  5ALX A;  3FAH A;  3HRD D;  1RYU A;  4QZ8 A;  5J0R A;  3AN1 A;  4KN7 A;  2LM4 A;  2G5I B;  3RAQ A;  4EEL A;  1ZQJ A;  2Y0S C;  4TUQ A;  1PVQ A;  2WHE A;  2ZIU B;  2EZX A;  3H4D A;  5J2D A;  4C8L A;  1TAU A;  3TKA A;  4P2H A;  5AK3 A;  5BOL A;  3UM9 A;  2E8P A;  4CGZ A;  3LWL A;  4R64 A;  2GWS A;  3CW2 C;  3KD3 A;  1FIQ A;  3TAN A;  1T8E A;  3AQE A;  1L8L A;  3GIL A;  2FJ6 A;  4ECV A;  4ED2 A;  5EE3 A;  4C7Y A;  2QAR A;  3M8R A;  3F53 A;  2YB4 A;  2PFP A;  4B6J A;  4DFP A;  4ECS A;  3Q8K A;  3BZK A;  5AK6 A;  4Q8E A;  4E0D A;  9ICS A;  1KFT A;  3A0H U;  3SV4 A;  4Y2R A;  8ICE A;  3WKA A;  3E2E A;  2W9C B;  5TIS U;  3UQ0 A;  3Q8S B;  2I5H A;  5KAF U;  2RP5 A;  1X66 A;  3GIJ A;  1L5U A;  4IC9 A;  1WWU A;  1U48 A;  2FLP A;  4I27 A;  1DOQ A;  2VIX A;  2W9B B;  2V4R A;  1Z00 A;  2AJQ A;  5ALE A;  2L5Y A;  2EAN A;  5KT2 A;  2JRZ A;  5J2G A;  2JGA A;  5JU5 A;  5KFR A;  4NM1 A;  3KKA C;  3ONN A;  7ICF A;  2ODG A;  2ZXI A;  1XSP A;  3MFH A;  1JAL A;  1U47 A;  1NJY A;  2PXI A;  2YMP A;  1IIP A;  1QH9 A;  1UA0 A;  4F71 A;  1RYR A;  8ICN A;  3AQF A;  5AI6 A;  4O5C A;  1ZQE A;  3KBB A;  1ZRM A;  2NYV A;  3EPG A;  3QX7 A;  4KMO B;  5KFS A;  5DG9 A;  1MQ3 A;  1SXE A;  3RB6 A;  4R63 A;  4UAV A;  5HP4 A;  3T5K A;  1HIW A;  3AEV A;  4I2G A;  2VAN A;  5IIM A;  1FFU A;  3PSI A;  4UB6 U;  2J6T A;  4DFD A;  3H0R B;  3A0B U;  4PGY A;  4KLM A;  1TE2 A;  4F92 B;  3SEN A;  4KIT B;  4IL6 U;  4QZC A;  1KDH A;  4KLH A;  2KZZ A;  4UAU A;  4OJL A;  3OSN A;  2K89 A;  4F5R A;  2KJ9 A;  9ICF A;  1CUK A;  4TUP A;  2KFN A;  1V97 A;  4G9B A;  2ZIV A;  1PK1 A;  4ED6 A;  5DQG A;  2XY5 A;  1Y88 A;  4AP9 A;  8ICJ A;  1S97 A;  3C2L A;  3IHQ B;  2LYH A;  5AM0 A;  1WG8 A;  4FZL A;  1S0M A;  3NGD A;  5KT6 A;  4NL9 C;  4UBC A;  2BDP A;  3B0Y A;  3TFR A;  2ISP A;  5AI5 A;  3LVW A;  4QZE A;  3GIK A;  2K8C B;  2E1F A;  2FPL A;  2HCF A;  3QXG A;  4R8U B;  5AIA A;  5F9L A;  1U9L A;  1D8L A;  2HI0 A;  5DBB A;  4YG2 A;  3NS1 A;  1AQ6 A;  4P4P A;  2ZUD A;  1DGS A;  2C2D A;  2W55 A;  4IR1 A;  4UB4 A;  2MSN A;  3PW2 A;  4Y2V A;  5DBC A;  2ES6 A;  3OGU A;  2BZF A;  3NVZ A;  3MGV A;  2YX8 A;  5AK4 A;  1QTM A;  2JEI A;  4ECU A;  2W54 A;  3CNH A;  4RQ0 A;  4RZR A;  3JPQ A;  3HX0 A;  3T5H A;  4KLS A;  3MDA A;  2PKE A;  5DDM A;  1Z4O A;  2XO7 A;  4PGQ A;  4IRC A;  2KOB A;  3N7P D;  5HMM A;  1JIH A;  3ETR A;  4R66 A;  5KFA A;  1Z00 B;  1ZQA A;  9ICP A;  5KT3 A;  1L6N A;  5KFB A;  1Z3E B;  2XCA A;  2D3D A;  3SAG A;  1SWV A;  4I2F A;  1QQ6 A;  1XSL A;  3WK8 A;  5TZV A;  1DGJ A;  1S76 D;  4UB3 A;  1PK1 B;  3PW4 A;  1X9X A;  3Q8Q B;  4BGD A;  3ZI4 A;  4ECT A;  2BR0 A;  4DSE A;  1ARO P;  4F72 A;  1D9D A;  1IG6 A;  5AKJ A;  1JX4 A;  4EYI B;  4CF5 A;  4QZH A;  2NO4 A;  2RDI A;  3MC1 A;  2JEG A;  3ZD8 A;  2AGP A;  1FFV A;  4J9N A;  1XO0 A;  2BCQ A;  4MEY A;  1X9M A;  8ICQ A;  1RXV A;  5EWF A;  2JEF A;  3BDP A;  1ZQU A;  1ZQK A;  5CB1 A;  3GZF A;  1NKE A;  1J2M A;  3FM9 A;  1ZQV A;  2LBO A;  4TQS A;  4QZ9 A;  1BGX T;  2OWO A;  4C4R A;  4MF8 A;  5AKX A;  4BXO B;  4F5P A;  5F9N A;  4C8M A;  4CNQ A;  1ZQS A;  5ALH A; 
#chains in the Genus database with same CATH homology
 3RH6 A;  2VA2 A;  4B9S A;  1U4B A;  7ICQ A;  4O0I A;  1NK5 A;  3RH4 A;  4JWM A;  2BCS A;  2AGQ A;  2MUT A;  3QEA Z;  4M04 A;  1LV5 A;  2W9A A;  3OHA A;  2DFL A;  3PO4 A;  3C2M A;  3V7J A;  2XY6 A;  2F1J A;  2PI4 A;  4DL7 A;  4NLN A;  1PZN A;  2FMP A;  4PPX A;  3JPT A;  4XUS A;  3PW5 A;  4EEY A;  4GXJ A;  2C28 A;  2MUT B;  1SL2 A;  3RJH A;  3OJU A;  4F3O A;  5IIJ A;  4UQG A;  4M9J A;  4DEZ A;  4M9G A;  3GDX A;  2ZTC A;  3N97 B;  1SKW A;  3GFK B;  2I1Q A;  5L1K A;  3C21 A;  1KSP A;  2ASD A;  7ICK A;  3KHG A;  3C5F A;  3ZDB A;  3KHR A;  4RPZ A;  5HML A;  3AU2 A;  3FDS A;  4IQT A;  2XY7 A;  1UA1 A;  5DDY A;  3Q8P B;  3MR6 A;  4F93 B;  2AQ4 A;  1A76 A;  3C23 A;  1TVA A;  2R8H A;  2ZJA A;  4F4K A;  1XO1 A;  1TK5 A;  2P6R A;  4I2H A;  5J2H A;  1BVS A;  3H8S A;  5L1J A;  1IM4 A;  2BCU A;  3PW7 A;  1NK4 A;  2MAX A;  4TUS A;  1ZJN A;  4FS1 A;  4O3S A;  4C8O A;  9ICM A;  1SKS A;  1JXE A;  3RB0 A;  5DLF A;  9ICU A;  4Z6F A;  1JXL A;  1A77 A;  4KN4 A;  4KLF A;  1ZET A;  3MGH A;  2BPF A;  1KFS A;  1D9F A;  1WCL A;  2BQU A;  2PFO A;  8ICH A;  5CJ7 A;  5KG3 A;  3HWT A;  4M6W A;  5DB7 A;  1ZYQ A;  4QWC A;  2FLN A;  3RRH A;  3RJF A;  7ICP A;  8ICY A;  3JPP A;  5DKW A;  3ZDA A;  4RUA A;  4DSK A;  5J2J A;  4Q45 A;  5KG2 A;  4HYK A;  3PX0 A;  9ICT A;  2W8K A;  4KLD A;  2JZB B;  4M6W B;  4Z6E A;  1D8Y A;  9ICL A;  3EW9 A;  3EWA A;  1ZQD A;  8ICS A;  4O9M A;  4DSF A;  4O3N A;  5KFJ A;  3GV8 B;  4YR2 A;  1U49 A;  5J0W A;  9ICA A;  2C2E A;  5KG6 A;  3EYZ A;  4KLQ A;  1S9F A;  9ICI A;  4M2Y A;  3QEB Z;  1BPY A;  7ICG A;  1HJP A;  3GQC A;  4Z6C A;  1ZQM A;  3MR3 A;  4DFJ A;  5BPC A;  2V4Q A;  3C2K A;  8ICU A;  4P4O A;  3OSP A;  7ICS A;  5L9X A;  4J9O A;  9ICR A;  2W9M A;  4DWI A;  5J2I A;  3H40 A;  4B9V A;  1L3V A;  1B22 A;  2UVU A;  3MGI A;  2AQ0 A;  1N48 A;  7ICT A;  5KFI A;  4F8R A;  3C1Y A;  1UT8 A;  5DLG A;  1HUO A;  9ICE A;  3UXP A;  5IIN A;  2FMQ A;  5DQH A;  2HHQ A;  3V7L A;  3THV A;  5J0S A;  2XGQ A;  2A1J B;  2KTQ A;  5KT5 A;  5J0X A;  4RNM A;  4ED7 A;  2KZM A;  2AGO A;  4LVS A;  2DPI A;  7ICJ A;  5J2E A;  4RPX A;  4O3O A;  9ICH A;  3MR2 A;  3G6V A;  9ICV A;  3V72 A;  9ICJ A;  5KFU A;  4IQW A;  1KTQ A;  8ICW A;  4I2C A;  3B0X A;  8ICK A;  3MR5 A;  3AUO A;  4J9P A;  4F91 B;  3MFI A;  4RQ7 A;  4QZA A;  4MFC A;  1KEJ A;  3H8W A;  4YVZ A;  5KFE A;  3PVX A;  1WCN A;  3LDA A;  4TQR A;  1NK8 A;  3BJY A;  2W8L A;  4UAY A;  4QZ8 A;  4J9S A;  4ZH4 A;  2IHN A;  3EZ5 A;  4LZG A;  5J0R A;  4KN7 A;  4PGX A;  3RBE A;  4NY8 A;  2M9N A;  1RPL A;  3RB4 A;  3PNC A;  3RAQ A;  3UXO A;  8ICT A;  4F4W A;  1ZQJ A;  1MC8 A;  4GXK A;  2HHW A;  1JMS A;  1ZQG A;  4I28 A;  3MDC A;  4QZI A;  4TUQ A;  9ICB A;  2ZJ8 A;  4UB2 A;  9ICG A;  4QW8 A;  5KFD A;  4JK1 A;  5KFN A;  1KRP A;  9ICQ A;  3H4D A;  4XA5 A;  5J2D A;  5KFF A;  4R8U A;  3EPI A;  4C8L A;  4KLO A;  2B21 A;  3RBD A;  1BPZ A;  4P4M A;  1CEZ A;  4QZG A;  4P2H A;  3PX4 A;  5BOL A;  4F2R A;  4RQ2 A;  3PR5 B;  2C22 A;  4ELU A;  3ORY A;  5KFM A;  1RZT A;  2HHU A;  4XQ8 A;  3GV7 B;  5L1L A;  4YR3 A;  4RT2 A;  3LK9 A;  4UAZ A;  4NLG A;  4DFK A;  3LWL A;  4ECX A;  4R64 A;  2RDJ A;  8ICG A;  8ICL A;  2GWS A;  4QZD A;  4NXZ A;  4DSL A;  2J6S A;  3PY8 A;  3JPR A;  3TAN A;  3PX6 A;  4QWD A;  3T5J A;  1T8E A;  3GV5 B;  4RQ8 A;  4DS5 A;  4DSI A;  3GIL A;  4ECV A;  4ED2 A;  4ED0 A;  1ZQB A;  1NK7 A;  2HHS A;  3M8R A;  4DL3 A;  1ZQO A;  3TQ1 A;  2R8G A;  1ZQT A;  4B9U A;  2PFP A;  1ZQL A;  2ASL A;  4DFP A;  4ECS A;  3Q8K A;  4QZB A;  8ICF A;  5DG8 A;  4Q8E A;  1V9P A;  4E0D A;  9ICS A;  2P66 A;  8ICM A;  4DQR A;  1KFT A;  4JV2 A;  3SV4 A;  4FO6 A;  4O5K A;  4G3I A;  8ICE A;  1S10 A;  4F50 A;  3E2E A;  5KFO A;  8ICV A;  1MQ2 A;  5C5J A;  5D49 A;  3RH5 A;  2ASJ A;  2W9C B;  1TK0 A;  3UQ0 A;  4PHD A;  2BCR A;  3Q8S B;  2IBK A;  4EBE A;  3UXN A;  4QWE A;  4DOA A;  5JUM A;  3PML A;  1S0O A;  4FS2 A;  3GIJ A;  5KFQ A;  4KLI A;  1L5U A;  2BHN A;  3AU6 A;  1ZQP A;  1U48 A;  2FLP A;  4QZF A;  4EYH B;  4EBD A;  1DOQ A;  4I27 A;  2XCP A;  2W9B B;  1ZQI A;  2V4R A;  3BQ2 A;  1Z00 A;  5DG7 A;  2UVW A;  3ISB A;  2AJQ A;  5J2B A;  4R65 A;  4YFK A;  2Q0Z X;  4RQ4 A;  5CR0 A;  5KT2 A;  1BPX A;  5KG0 A;  5J2G A;  2KFZ A;  3H8J A;  4YXJ A;  1TK8 A;  8ICB A;  5KFR A;  1T4G A;  2I9G A;  5KFX A;  4NM1 A;  3BQ0 A;  4DL4 A;  1SL0 A;  2HHV A;  4MFF A;  7ICF A;  1BPB A;  4Q43 A;  1U45 A;  5CA7 A;  3QZ7 A;  1XSP A;  3MFH A;  5J0U A;  4PHA A;  4FBU A;  7ICO A;  8ICR A;  1U47 A;  1NJY A;  3Q8M A;  1ZQR A;  9ICC A;  1QSY A;  2VA8 A;  4LZD A;  4PH5 A;  4F4X A;  2PXI A;  3N4M B;  5CHG A;  5J0O A;  1X9W A;  4YP3 A;  4EBC A;  2FPK A;  5KT7 A;  1UA0 A;  2ZUB A;  1ZQZ A;  1QSL A;  4Z6D A;  1RYR A;  1EXN A;  3UPQ A;  4MFA A;  4YMM A;  3PR4 A;  1KLN A;  2JEJ A;  8ICN A;  5IIL A;  1H38 A;  1ZQN A;  1ZQE A;  3BQ1 A;  4J9M A;  4O5C A;  1NOM A;  3IM1 A;  3H4B A;  4ELV A;  3RJJ A;  4YMO A;  3EPG A;  3Q8L A;  2FMS A;  5KFC A;  4IQU A;  4CCH A;  4K4I A;  5KFS A;  5DG9 A;  1MQ3 A;  1NJZ A;  9ICK A;  3Q8R B;  3RB6 A;  4R63 A;  3TAP A;  1XC9 A;  3RJG A;  2F1I A;  3PV8 A;  5HP4 A;  1L3T A;  1ZQH A;  3RRG A;  3RJI A;  8ICA A;  4YD1 A;  3T5K A;  4GXI A;  4I2G A;  5KFY A;  7ICI A;  4BXO A;  1T3N A;  2A1J A;  2NRX A;  2VAN A;  5IIM A;  4RQ1 A;  4IRK A;  3T3F A;  3RB3 A;  2NRW A;  1NJW A;  2J6T A;  7ICN A;  4KMU A;  4PGY A;  4KLM A;  1KFD A;  3OHB A;  3HT3 A;  1ZJM A;  4F92 B;  4ECR A;  4KIT B;  5BOM A;  2PFQ A;  4QZC A;  2DPJ A;  1QLN A;  1KDH A;  3ZD9 A;  1TFR A;  4Q44 A;  3HP6 A;  5KG1 A;  4BWJ A;  1XSN A;  4ECQ A;  4KLL A;  4KLH A;  3OJS A;  2IMW P;  9ICN A;  3RAX A;  4RNN A;  2KZZ A;  1S77 D;  3OSN A;  3G6X A;  4F5R A;  2BQ3 A;  1NK9 A;  4IRD A;  4PHE A;  9ICO A;  9ICF A;  5EWE A;  2AU0 A;  1ZQC A;  4J9R A;  1CUK A;  3H7I A;  1SZP A;  4TUP A;  5III A;  3RJK A;  2KFN A;  3ZDD A;  4JV0 A;  4ED8 A;  8ICX A;  5D4B A;  3ISC A;  3M9O B;  2PI5 A;  4B9T A;  2UVR A;  4I2J A;  4FBT A;  5KG4 A;  4KTQ A;  3RR8 A;  5HNK A;  4KLU A;  5J0Q A;  7ICM A;  4ED6 A;  4UBB A;  4MF2 A;  3MBY A;  4I2D A;  5DQG A;  2XY5 A;  4YXM A;  5L1I A;  2IA6 A;  1Y88 A;  5IIO A;  4K4H A;  4O3R A;  8ICJ A;  2VA3 A;  1S97 A;  5KFP A;  3C2L A;  2FLL A;  5DBA A;  9ICX A;  1ZQX A;  3QZ8 A;  3IHQ B;  2LYH A;  2BCV A;  5KFV A;  5EWG A;  1S0M A;  3T5L A;  4M0A A;  3NGD A;  5KT6 A;  3V6H A;  4UBC A;  5J2K A;  3ZDC A;  9ICW A;  3V6K A;  7ICE A;  4MEX A;  5DGB A;  1RXW A;  4M47 A;  1XU4 A;  4K4G A;  2BDP A;  4UAW A;  4QW9 A;  4Q8F A;  3B0Y A;  3SYZ A;  2C2R A;  4TUR A;  3TFR A;  2ISP A;  1NK6 A;  5KFL A;  1IXR A;  4YMN A;  5CWR A;  4QZE A;  3GIK A;  2F1H A;  5J29 A;  3G6Y A;  2HHX A;  8ICP A;  4I2B A;  5J2F A;  3M8S A;  3TAR A;  8ICO A;  2FPL A;  2V9W A;  4DLE A;  4R8U B;  3UQ2 A;  3TAQ A;  4DSJ A;  4GC7 A;  4DL5 A;  5F9L A;  1U9L A;  5J0Y A;  1XWL A;  1D8L A;  4DL2 A;  1TV9 A;  5EOZ A;  4DFM A;  1S0V A;  8ICC A;  2ZTD A;  1TAQ A;  3TFS A;  3ZDE A;  5DBB A;  4YG2 A;  4I2I A;  2KN7 A;  3JPO A;  4YN4 A;  2ZJ5 A;  4NM2 A;  4DQS A;  1NKC A;  7ICU A;  4P4P A;  2ZUD A;  1NK0 A;  3HPO A;  1LB2 B;  1DGS A;  4M9L A;  1B43 A;  2C2D A;  4YCX A;  4NLZ A;  1HUZ A;  4J9Q A;  4IR1 A;  4UB4 A;  3HW8 A;  4DOC A;  3PW2 A;  3OGU A;  5DBC A;  2IHM A;  4UB5 A;  2Y1J A;  4EZ9 A;  3GII A;  4JV1 A;  1QTM A;  1T7P A;  2JEI A;  1SL1 A;  5DB8 A;  4J9K A;  4X5V A;  7ICH A;  2P6U A;  2HVH A;  4ECU A;  4DLG A;  5J2C A;  3MAB A;  2NRV A;  4KLJ A;  4ECW A;  2BKE A;  2ALZ A;  3RTV A;  4RQ0 A;  4O3Q A;  5KG5 A;  4RZR A;  3JPN A;  3JPQ A;  1UT5 A;  3HX0 A;  3T5H A;  4KLS A;  1TAU A;  3MDA A;  2R8I A;  5DDM A;  2XGP A;  4C8N A;  2HHT A;  2XO7 A;  5KFG A;  4YD2 A;  4PGQ A;  4ED3 A;  1ZQW A;  4IRC A;  1L3U A;  2BQR A;  4O5E A;  1C7Y A;  5HMM A;  3FYH A;  1JIH A;  4R66 A;  2UVV A;  2PFN A;  5KFA A;  4BDP A;  3C1Z A;  1Z00 B;  1BPE A;  2ZTE A;  4RQ6 A;  2FPM A;  3ISD A;  2W9B A;  5KFH A;  1ZQA A;  1COO A;  2Y1I A;  9ICP A;  4M9H A;  5KT3 A;  5KFW A;  1NJX A;  3PO5 A;  4O3P A;  4M9N A;  5IIK A;  1ZQQ A;  4RU9 A;  1N56 A;  3JPS A;  4ECY A;  5KFB A;  4DF4 A;  5DB6 A;  5DB9 A;  2H5X A;  1NKB A;  1Z3E B;  1ZQY A;  4DQQ A;  2XCA A;  4C8K A;  5KTQ A;  5J0P A;  4PHP A;  4JUZ A;  2W9C A;  4DS4 A;  1X9S A;  4B9N A;  5HHH A;  4RUC A;  1XSL A;  4QWA A;  4I2F A;  4NLK A;  3PMN A;  5HHI A;  5TZV A;  4ECZ A;  4GC6 A;  4QWB A;  5KG7 A;  2JZB A;  8ICZ A;  3K4G A;  1S76 D;  2HVI A;  3TI0 A;  4UB3 A;  3PW4 A;  2ZUC A;  1X2I A;  2WTF A;  3Q8Q B;  5CP2 A;  4BGD A;  3PW0 A;  3RJE A;  1ZQF A;  7ICR A;  5DQI A;  4DOB A;  2ATL A;  4EZ6 A;  4ECT A;  3NTU A;  4IQV A;  3M9M B;  2BR0 A;  2XC9 A;  4DSE A;  1TKD A;  2NRZ A;  3C5G A;  2R8J A;  4XRH A;  1K1Q A;  1MSW D;  1ARO P;  5KFK A;  4RNO A;  4DF8 A;  2ISO A;  4BWM A;  1D9D A;  1S0N A;  3KHH A;  1JX4 A;  4DQI A;  4EYI B;  4DO9 A;  7ICV A;  4QZH A;  1BPD A;  4RQ5 A;  4GLX A;  2RDI A;  3V6J A;  2JEG A;  4I2E A;  2BPG A;  3ZD8 A;  1L3S A;  3KTQ A;  1JN3 A;  3QE9 Y;  5J0T A;  4J9N A;  2AGP A;  2BCQ A;  1SKR A;  4MEY A;  4YR0 A;  4F5Q A;  2NRT A;  4F4Y A;  4ED1 A;  1K1S A;  1X9M A;  5KT4 A;  1RXV A;  1RYS A;  3ETL A;  5EWF A;  4YQW A;  3V7K A;  2JEF A;  4F2S A;  3BDP A;  3K75 D;  1ZQU A;  5KFZ A;  2BPC A;  4UB1 A;  2KZ3 A;  4J9L A;  1ZQK A;  7ICL A;  5D46 A;  4JWN A;  5CB1 A;  1NKE A;  3KHL A;  4RPY A;  4RQ3 A;  3M9N B;  1XS9 D;  1ZQV A;  3GIM A;  4TQS A;  4QZ9 A;  4B9M A;  1BGX T;  3LWM A;  2OWO A;  4F5O A;  4I29 A;  3SZ2 A;  4MF8 A;  4DL6 A;  4BXO B;  4KLE A;  4DQP A;  4KLT A;  5J2A A;  8ICQ A;  2BGW A;  4KLG A;  4I2A A;  3SI8 A;  2R8K A;  4B9L A;  4IR9 A;  4F5P A;  5F9N A;  3BQT A;  4C8M A;  5KFT A;  4F4Z A;  5DGA A;  1QSS A;  4F5N A;  1ZQS A;  2HW3 A;  4RT3 A;  3SV3 A;  8ICI A;  4ELT A;  2J6U A;  3RR7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...