2AQ0A

Solution structure of the human homodimeric dna repair protein xpf
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
84
structure length
84
Chain Sequence
b'MDSETLPESEKYNPGPQDFLLKMPGVNAKNCRSLMHHVKNIAELAALSQDELTSILGNAANAKQLYDFIHTSFAEVVSKGKGKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA repair endonuclease XPF
publication title The HhH domain of the human DNA repair protein XPF forms stable homodimers
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna repair, hydrolase
total genus 20
structure length 84
sequence length 84
chains with identical sequence B
ec nomenclature ec 3.1.-.-:
pdb deposition date 2005-08-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2aq0A00
4KN4A 3B0YA 2ASDA 3ISCA 2DFLA 3UXOA 4GXJA 4F4ZA 3JPRA 9ICBA 4F5OA 2UVUA 4PHEA 1NK0A 8ICPA 3B0XA 3PW2A 1MQ3A 5IINA 4I2HA 5KFPA 4O0IA 5KFRA 1N48A 3RJGA 1ZQXA 3TANA 3PMLA 4YMMA 4YD1A 4KLTA 3QEAZ 3RB6A 4KITB 5L1JA 5J2EA 2BCSA 8ICLA 1TK5A 5DB9A 5J2AA 1S0NA 4F5QA 1SKRA 2PFOA 1JMSA 9ICHA 4JV2A 8ICZA 3T3FA 1Y88A 4F4YA 4KLSA 1ZYQA 2J6SA 3BDPA 1U49A 5BPCA 4F2RA 3ZDBA 1ZQDA 3PO4A 4M2YA 1S0VA 2ALZA 9ICOA 1ZQNA 3RR8A 1UA1A 4KN7A 2ISPA 3C2KA 1DGSA 1PZNA 3JPSA 2PXIA 5DDMA 5BOLA 4YQWA 4RQ7A 3T5KA 3RJIA 4K4IA 2XY6A 4ECTA 3ISDA 5CHGA 5DBCA 4DFMA 4RU9A 4UQGA 4ECSA 4NLKA 1TAQA 3C2LA 1S0MA 8ICQA 5J0TA 4RPXA 4GXIA 7ICGA 4ECWA 5KFMA 5KT4A 5IILA 4DLEA 1XSPA 4Z6CA 3JPOA 1BPYA 4LZDA 3HP6A 1BPBA 4QZEA 4FBUA 9ICAA 2FPMA 5DBBA 4F4XA 4P2HA 4XRHA 1NK8A 1S10A 4RUAA 5KT3A 4PGYA 3QZ7A 2JEGA 4ELVA 1B43A 1WCNA 5CJ7A 4MFFA 4I2DA 2NRXA 2IMWP 3E2EA 3MR6A 4DO9A 2ZTCA 1ZETA 5KT7A 4K4GA 8ICGA 4YD2A 3GIMA 1L3SA 4DQRA 4I27A 1TV9A 1QLNA 4I2EA 1TK8A 4UB3A 3V72A 2HHQA 4NY8A 1U48A 4O3QA 2XY5A 4YP3A 3C2MA 1HUZA 1T3NA 2PI4A 4DQSA 5J0SA 2FMQA 3BQ1A 4R64A 2XY7A 3EW9A 4RQ6A 4QZBA 1ZQTA 5J2HA 4F4WA 3ZD9A 3HX0A 3ZDCA 2KZZA 4PGQA 1JIHA 3MR5A 2MUTB 4I2BA 2V9WA 2ZJAA 4EBEA 4QZGA 3V7JA 2AJQA 5HNKA 4ECZA 4FBTA 2W9BA 8ICXA 3M9NB 4YR2A 1ZQBA 4QW9A 4ECXA 4TURA 4ED8A 5KTQA 7ICFA 3TAQA 5J2FA 4DL2A 4I29A 2BQ3A 4J9NA 5C5JA 5J0QA 4ECVA 1ZQHA 2J6TA 4PPXA 4XQ8A 7ICPA 5HMMA 1ZQVA 2W9CB 3N97B 3SV3A 1KTQA 5KFWA 2ZTEA 1NJXA 9ICQA 1A77A 3QEBZ 3MFHA 1KDHA 4RQ1A 5JUMA 3MR3A 2F1HA 2HHSA 4QWAA 4JUZA 4F5NA 2R8HA 2AGQA 9ICEA 1KFDA 2W9MA 4RQ5A 3QE9Y 3PR4A 3Q8SB 4GC6A 4YG2A 5KFYA 5J0UA 4DL7A 4P4MA 3V6JA 4ED3A 2V4QA 1NK4A 1Z00A 3PW5A 3H7IA 4B9UA 5TZVA 4QZFA 4QWDA 2XCAA 2IHMA 3MR2A 3V6KA 4Z6FA 1XU4A 5KFOA 5DLFA 2ZTDA 2BHNA 4ECQA 3IM1A 4TUSA 4J9RA 5J2GA 1ZJMA 4KLUA 3M9OB 1TK0A 4IQVA 2LYHA 4ZH4A 2PFPA 8ICBA 4B9LA 3ETLA 2PFNA 4C8NA 4M9GA 7ICLA 4P4PA 4ED1A 1RXVA 3EPIA 3RBDA 5J0OA 1RYRA 3TFSA 3H8WA 3MABA 2PFQA 1NK5A 7ICMA 3FYHA 3TI0A 1UA0A 2ZUBA 1ZQKA 4DQIA 8ICNA 9ICSA 1KEJA 1UT8A 2UVWA 2P6RA 3V6HA 4DSKA 4KLDA 7ICHA 3G6XA 3OGUA 3ORYA 5DG9A 1ZQYA 4MEYA 1C7YA 1TAUA 1N56A 1MC8A 1XSLA 3GV8B 3SYZA 4DFJA 4B9SA 4BWMA 4PHPA 1X9MA 5KFCA 3Q8PB 4RT2A 1XC9A 4YMNA 4PGXA 4B9VA 1U45A 4KMUA 1ZQJA 4C8LA 2OWOA 4F92B 1IM4A 3RH4A 2MAXA 2UVVA 9ICNA 4K4HA 5F9LA 4Z6DA 1NK6A 3H40A 4KLQA 4NM1A 8ICHA 3MFIA 1D9FA 3C1YA 4EYIB 1ZJNA 3RJHA 1T8EA 4YXMA 5KG3A 3PW0A 3RRHA 2C22A 2AGPA 1ZQOA 4DSJA 1X9WA 2JEIA 4QZHA 5KG4A 4GXKA 3T5JA 1JXEA 3OJSA 5KFKA 2XGQA 4JK1A 5HHIA 3G6YA 4NLNA 2JZBB 2VA2A 1ZQAA 2RDIA 3OJUA 4RQ3A 1S77D 1EXNA 1ZQQA 2AU0A 4LVSA 1XS9D 3N4MB 3JPPA 9ICXA 7ICVA 5J2IA 3H4DA 4JWMA 4R65A 2FPKA 4O3OA 3ZD8A 5J2DA 4RQ2A 3SI8A 2C2RA 5KFFA 2BCQA 3KHHA 5KFAA 2C2DA 4M47A 9ICGA 2W8LA 1BGXT 2XCPA 2R8IA 3HWTA 5IIOA 1Z3EB 3C23A 5KG6A 1NKCA 4DWIA 8ICTA 5DQGA 2FLPA 2R8GA 7ICOA 4Q45A 3G6VA 2ZUDA 4YN4A 4ECUA 5L1KA 8ICWA 1ZQMA 4Q44A 1ZQZA 4DL6A 5D49A 3NGDA 4FS1A 3PMNA 3SZ2A 3PW7A 4RPZA 4Q8FA 5KFBA 2R8JA 1RPLA 3NTUA 1RYSA 2HHVA 1L3TA 4M9JA 4PHAA 3EPGA 4MF2A 2KFNA 3MDAA 5J0RA 2P66A 7ICIA 3RAQA 5DBAA 2NRWA 3T5LA 5KFZA 1LV5A 5KFUA 3H8JA 5KT6A 4R63A 2F1IA 3LWMA 3HPOA 4QZDA 3Q8LA 2BCUA 1S97A 2KZ3A 3EYZA 1A76A 1NJYA 3PX0A 1KSPA 3GV7B 3GFKB 1H38A 4DQQA 8ICUA 1KFTA 4YCXA 4J9LA 4DL5A 9ICUA 3GDXA 3GQCA 5IIKA 5DGBA 2XGPA 5L1LA 1NKBA 4C8OA 3FDSA 5KFHA 1QSLA 4B9TA 3C5FA 5DQIA 3PO5A 3PVXA 1U9LA 2IBKA 1MSWD 5KFDA 2ATLA 8ICFA 4UBCA 2WTFA 4RNNA 4KLFA 1JX4A 2BCRA 3V7LA 4GC7A 3MGHA 3PNCA 3Q8KA 4I2AA 4M0AA 9ICRA 4J9PA 3RB4A 5KFVA 3RJJA 5J0PA 4IQWA 4O5CA 4XUSA 4IRDA 3RB3A 4O3PA 5DKWA 9ICPA 5EWFA 1V9PA 2JZBA 5KFXA 5CP2A 4YFKA 5KFQA 3JPTA 1NKEA 1ZQFA 4QWBA 5DDYA 5KFJA 3KHGA 5EOZA 1KRPA 4QW8A 5KFNA 5BOMA 4ECRA 2VA3A 5KG1A 1BPZA 4JWNA 4I2FA 3T5HA 7ICJA 1S9FA 4F5PA 1NJZA 1NOMA 2KN7A 4EZ6A 4ED6A 1SZPA 1S76D 4ELTA 3BQ2A 4O3NA 2ISOA 5J0WA 4DOCA 3HT3A 4DL4A 1LB2B 4JV0A 5DG8A 3BJYA 5DQHA 4Q8EA 5KFEA 5CA7A 4DOAA 4TQRA 4MF8A 2FMSA 3RH6A 8ICSA 3RTVA 3Q8QB 3GV5B 1QTMA 3PW4A 2FLNA 2BR0A 5EWGA 2F1JA 5KFSA 5J2BA 4J9KA 3MBYA 3K4GA 1KLNA 4QWCA 2UVRA 3TQ1A 2AQ0A 4UBBA 1QSYA 4IR1A 4DFPA 7ICRA 4P4OA 5EWEA 3OSNA 1MQ2A 1UT5A 8ICVA 5KG2A 1RZTA 2FMPA 4YVZA 8ICCA 3ISBA 7ICEA 3RJKA 2R8KA 5CR0A 4F2SA 5DG7A 4KLGA 4O3SA 1TVAA 7ICUA 2BKEA 4QZ9A 4MFAA 1D8LA 3M9MB 2W9AA 9ICFA 8ICAA 4M9LA 3OHBA 4O9MA 4DLGA 1DOQA 3GILA 2GWSA 8ICKA 3BQTA 3GIKA 1WCLA 4E0DA 5KG5A 4EZ9A 2ASLA 9ICMA 3QZ8A 2BPGA 4B9NA 2HHUA 4ED0A 3LDAA 1ZQGA 2MUTA 3UXPA 4NLGA 5KG0A 4DQPA 3IHQB 3H8SA 3PV8A 1T7PA 3HW8A 3M8SA 4MFCA 4BGDA 4J9MA 1ZQIA 1ZQWA 4HYKA 2HVIA 3MGIA 1CUKA 9ICCA 2ASJA 5J29A 4DSEA 4IRCA 3UQ2A 5KG7A 4M9HA 1SKWA 2W9BB 2W9CA 4EBCA 4F8RA 4KTQA 4NLZA 9ICWA 4O5KA 4IRKA 4YMOA 4MEXA 2RDJA 3RH5A 1L3UA 4DOBA 4M6WB 4EYHB 4EBDA 1SL1A 4KLIA 4RUCA 4TQSA 3C5GA 4TUPA 2A1JB 2JEJA 1NK9A 1AROP 1ZQLA 2NRVA 2BQRA 1X9SA 4Q43A 5L9XA 4NXZA 3ZDDA 7ICKA 4QWEA 4F91B 3EWAA 3RJEA 3C1ZA 3PX4A 5IIIA 2HVHA 4YR3A 1Z00B 4C8MA 1NK7A 3PR5B 9ICTA 4I2IA 5J0YA 2HW3A 4RNMA 3GIIA 9ICVA 1D9DA 1K1QA 1BPDA 1JXLA 7ICSA 5J0XA 4F3OA 4I28A 1K1SA 2IA6A 4KLMA 4QZ8A 3UXNA 2KZMA 2KTQA 1XO1A 1U4BA 5J2KA 4X5VA 4KLLA 2Q0ZX 4UB2A 4RPYA 4KLOA 3H4BA 2ZJ8A 2DPJA 3MDCA 4O3RA 2W8KA 3RRGA 4J9SA 4Z6EA 4ECYA 5CB1A 5DB6A 4BXOB 3Q8RB 1RXWA 1L5UA 3OHAA 4BWJA 2IHNA 5KT5A 5D46A 4KLEA 5HHHA 1D8YA 1ZQSA 8ICOA 4RQ0A 4R8UB 4QZCA 4FS2A 2HHTA 3JPNA 1ZQUA 3TARA 5DB7A 5F9NA 1NJWA 4F50A 4J9OA 4LZGA 8ICIA 4DSIA 4PHDA 3KHLA 2I9GA 4G3IA 4I2GA 2ZJ5A 2HHXA 4DEZA 3ZDEA 2HHWA 8ICRA 4UAZA 7ICQA 3BQ0A 5KFIA 2DPIA 4DF8A 1COOA 2Y1IA 2BPCA 2NRZA 2ZUCA 1ZQCA 3PY8A 1ZQRA 5KT2A 5DB8A 5IIMA 3RB0A 3GIJA 4F4KA 2FLLA 9ICKA 1B22A 3EZ5A 4I2JA 5D4BA 2FPLA 3PX6A 1BVSA 1ZQPA 4KLJA 5HP4A 4IQUA 2NRTA 4J9QA 4DS4A 3RBEA 8ICMA 4FO6A 2M9NA 2VA8A 3KHRA 4XA5A 4RNOA 4F5RA 4DL3A 4M04A 2H5XA 5CWRA 2AGOA 4M6WA 1ZQEA 3RR7A 4UB5A 5DLGA 4DF4A 7ICTA 4YR0A 7ICNA 1BPEA 3TAPA 4RQ8A 2A1JA 1QSSA 3KTQA 4RT3A 3LK9A 1KFSA 4BDPA 9ICJA 1TFRA 3AU6A 1XWLA 4YXJA 3LWLA 4DFKA 2BDPA 3V7KA 3TFRA 5J2JA 2VANA 3AUOA 5HMLA 1TKDA 3OSPA 1IXRA 4RQ4A 2XC9A 4GLXA 4UAYA 2C2EA 2BCVA 4UB4A 2V4RA 2JEFA 1X2IA 8ICYA 5J2CA 4C8KA 3SV4A 3THVA 1T4GA 2AQ4A 5DGAA 3Q8MA 2P6UA 3M8RA 4EEYA 4RZRA 4UB1A 5KFGA 2XO7A 4JV1A 1SKSA 4KLHA 4UAWA 4B9MA 3JPQA 2B21A 3AU2A 3UQ0A 4O5EA 1CEZA 8ICJA 9ICLA 2C28A 1SL0A 3RJFA 2I1QA 3UPQA 4DSFA 1U47A 1S0OA 1L3VA 1BPXA 4R66A 2PI5A 4I2CA 4IR9A 1JN3A 4M9NA 2J6UA 4NM2A 3K75D 4ELUA 4DS5A 8ICEA 4F93B 5L1IA 4CCHA 1HJPA 4BXOA 5IIJA 4ED7A 4QZIA 2Y1JA 5KFTA 2BPFA 5KFLA 4DSLA 4TUQA 3ZDAA 2BGWA 3RAXA 4ED2A 3C21A 1SL2A 4R8UA 2KFZA 4PH5A 1XSNA 4IQTA 1HUOA 9ICIA 4QZAA 2BQUA
chains in the Genus database with same CATH superfamily
4GXJA 1NK0A 3B0XA 5IINA 2KE7A 5KNIA 3RJGA 2NYVA 4YMMA 1SB3C 2K4PA 4YD1A 3QEAZ 3RB6A 4KITB 2BCSA 5ALEA 1PVPA 2PFOA 9ICHA 8ICZA 4F4YA 3BS7A 2NO5A 3WK8A 1U49A 3E58A 2DL0A 3PO4A 1LVHA 2ALZA 3ED5A 3RR8A 1UA1A 2KKPA 4KN7A 2LHTA 1PK3A 4DFMA 5KAFU 3K1ZA 2MU2A 3TKAA 1S8OA 1TAQA 5ALFA 8ICQA 4GXIA 5KFMA 5IILA 2KOBA 3GU3A 1XSPA 3JPOA 4LZDA 3F53A 3HP6A 2E1EA 4QZEA 5J8YA 2RQ5A 4FBUA 2FPMA 9ICAA 5AIBA 4P0QA 1NK8A 3E2EA 2LYBA 2XVTA 2ZTCA 4I27A 4NL9A 4UB3A 1U48A 3QX7A 1WWUA 3L4PA 1L7PA 3MR5A 2MUTB 2KJ9A 2V9WA 4QZGA 4ECZA 4J03A 8ICXA 1ZQBA 1ED1A 1X9XA 5J2FA 4ECVA 1ZQHA 2MRLA 4CF4A 2J6TA 4PPXA 3N7SC 3SV3A 1NJXA 1N63A 3MFHA 1KDHA 4RQ1A 2YN4A 4QWAA 3I1YA 1KFDA 5AI4A 5ALUA 3PR4A 3QU9A 4P4MA 4ED3A 4B9UA 1Z00A 3PW5A 2WF7A 1P7DA 3MR2A 3SR6A 4Z6FA 1XU4A 5KFOA 5DLFA 2E8PA 3IRUA 4ECQA 3BS5A 1SGGA 1OUQA 5ALOA 4P4PA 3BZCA 3H8WA 2PFQA 3N7PD 4KLDA 4NWIA 5AKZA 5AKEA 1QCKA 5AK6A 3SYZA 4C4TA 2YY6A 4B9VA 1U45A 4KMUA 4C8LA 3HKZC 3RH4A 3QU4A 4K4HA 1N62A 5AM4A 3AQFA 3MFIA 2K4HA 1ZJNA 4YXMA 2AGPA 1ZRNA 4DSJA 2JEIA 2RLTA 1JALA 4GXKA 2EZYA 3T5JA 5KFKA 2JZBB 3IN5A 2DF4B 4RQ3A 2AU0A 2ZIUB 3JPPA 4R65A 3QU5A 2PMZC 3FAHA 3ZD8A 5KFFA 3KHHA 4PL2A 1RM6C 1RG6A 2HCFA 5IIOA 1L6NA 7ICOA 3G6VA 5L1KA 8ICWA 3CNHA 1X40A 4KMOB 4PZNA 3PW7A 4Q8FA 3KFUF 1QH9A 2NO4A 1RYSA 4IC9A 3EPGA 2OXOA 2DBYA 5J0RA 7ICIA 3RAQA 5DBAA 4UASA 2M0NA 1F5SA 3H8JA 4JMUA 3LWMA 2HI0A 4QZDA 1A76A 3A0BU 1KSPA 3SAHA 4J9LA 4DL5A 4ZOHC 1NKBA 4EEKA 4F71A 1U9LA 5KFDA 2ATLA 4UBCA 1S5LU 3V7LA 4A8EA 3KOOA 3IV6A 3BZKA 5K4LA 3RJJA 4JB3A 5DKWA 9ICPA 2JZBA 5KFXA 3UMGA 4QWBA 2Y9UA 3KHGA 2A1AA 1BPZA 1Z4OA 5EE0A 7ICJA 1SV0A 1QQ6A 4ELTA 5ALHA 2E8NA 4DL4A 1FEZA 2WB1F 1HIWA 2FDRA 5KFEA 4MF8A 4FZMA 3RH6A 3Q8QB 4Y2JA 2F1JA 3MBYA 1KLNA 2UVRA 2EANA 4UBBA 1VJ5A 4DFPA 4P4OA 3F5EA 3J81j 1UT5A 8ICVA 5AKHA 5KG2A 8ICCA 7ICEA 4QZ9A 3M9MB 2W9AA 4M9LA 4O9MA 8ICKA 2GWSA 4E0DA 1UCVA 3QZ8A 4CNQA 4B9NA 2BZFA 2IOFK 5KG0A 4DQPA 5ALIA 3H8SA 3PV8A 4BX9C 1ZQWA 2EDUA 1UPHA 5KG7A 1SWWA 2W9CA 4KTQA 4NLZA 1X42A 2CXYA 1QQ5A 3PSFA 4MEXA 5AI6A 2RDJA 4M6WB 2YMPA 4US9A 3C5GA 1NK9A 3DDHA 2BQRA 2F44A 5L9XA 4EX6A 4NXZA 5AM0A 3ICXA 3EWAA 3RJEA 1M6YA 2HVHA 4YR3A 2KV2A 4C7ZA 4C8MA 4I2IA 1D9DA 7ICSA 1K1SA 1J2NA 2IA6A 2G07A 5J2KA 4KLLA 4OJ6A 3DV9A 4OJ5A 3RRGA 4ECYA 3TADC 4BXOB 2Y9TA 5ALYA 2WFAA 5AICA 4Y2VA 4R8UB 2HHTA 3ONNA 3TARA 1A0PA 1DK3A 4G3IA 2HHXA 4DEZA 1XO0A 5KFIA 3EUB2 1ZQ1C 3HJEA 3PY8A 3GIJA 1JUDA 1SV4A 1GO3F 5HP4A 4DS4A 8ICMA 4DL3A 2VA8A 3KHRA 4F5RA 4M6WA 1ZQEA 3RR7A 7ICTA 1QSSA 1KFSA 3PZPA 2Q4TA 4O3MA 3AUOA 2C2EA 1XNSA 2BCVA 2V4RA 3QUBA 3WKBA 3THVA 1T4GA 2AQ4A 5DGAA 1LKYA 5G5GA 2D8CA 4UAWA 2DUYA 4ACOA 3AU2A 9ICLA 1BPXA 1L3VA 2PI5A 2GO7A 4M9NA 3K75D 5L1IA 1FIQA 1KBUA 2VJ4A 2GH1A 4BXOA 4ED7A 2Y1JA 3LVVA 5B66U 1Z19A 2XIDA 2F8LA 3C21A 2DGZA 4R8UA 2KFZA 3D6JA 3HRDD 4QZAA 2BQUA 3B0YA 2ASDA 4F4ZA 4F5OA 8ICPA 4I2HA 4O0IA 1N48A 4KLTA 1URJA 1YZ6A 3R9KA 8ICLA 1X66A 5DB9A 1S0NA 5AIAA 1Y88A 2W3SA 4F2RA 2F76X 1ZQDA 4M2YA 1S0VA 4CDGA 3AEVA 1ZQNA 1ZD5A 2ISPA 3C2KA 2PXIA 1DGJA 3T5KA 3RJIA 4ECTA 3WKCA 3L5KA 4UQGA 2YMMA 4ECSA 5JTIA 3C2LA 2FI1A 1S0MA 5J0TA 7ICGA 4ECWA 5KT4A 4DLEA 1BPBA 4P2HA 4RUAA 2EAMA 5CJ7A 3MR6A 4DO9A 8ICGA 3GIMA 5KL1B 1TV9A 1TK8A 2HHQA 4O3QA 1HUZA 3C2MA 2PI4A 4KX3A 5J0SA 2XY7A 3WK4A 4QZBA 2Z7JA 5H2FU 4F4WA 3ZDCA 3ZD9A 3KZXA 4PGQA 4I2BA 3OTQA 3V7JA 2B0CA 3CYMA 2CRXA 2KJ8A 2CPRA 2D6FC 3M9NB 1FO4A 4ECXA 4TURA 3TAQA 4I29A 5C5JA 7ICPA 3DEEA 1ZQVA 2JXJA 5AI5A 2JV3A 3SEIA 5AM2A 4B6JA 1PVRA 2AGQA 9ICEA 4RQ5A 2W11A 3QE9Y 5ALZA 3Q8SB 3QUQA 1YZ7A 2V4QA 1NK4A 2IOHA 3AN1A 4QWDA 2WF5A 2XICA 2BHNA 5ALQA 5HR6A 4J9RA 2KIVA 3M9OB 2ZIXB 4ZH4A 2PFPA 8ICBA 4B9LA 3ETLA 4C8NA 7ICLA 1RXVA 3MABA 3TI0A 1ZQKA 2ZUBA 4DQIA 8ICNA 9ICSA 1UT8A 4DSKA 3V6HA 3G6XA 2LYAA 1TAUA 2W3RA 4BWMA 1X9MA 4RT2A 1XC9A 4CRXA 1IM4A 1HEKA 2KSOA 2UVVA 9ICNA 4Z6DA 2O6KA 2XI9A 3H40A 4NM1A 4KLQA 1D9FA 3RJHA 5KG3A 1ZQOA 3PW0A 4QZHA 3G6YA 5HHIA 2KIWA 2VA2A 1Q3UA 1S77D 1EXNA 3IDWA 2GOLA 5J2DA 4RQ2A 3SI8A 2C2DA 9ICGA 1JI7A 1BGXT 1FFUA 5KG6A 1YT3A 1O03A 1V85A 2FLPA 2R8GA 3F2BA 4ECUA 3HKZF 5ALLA 3K1RB 4Q44A 1ZQZA 4DL6A 5D49A 3PMNA 3SZ2A 5KAIU 4M9JA 2ZIXA 2AXTU 4Y2XA 5KT6A 2HOFA 2PMZF 2BCUA 5AI9A 3PX0A 3M6KA 1H38A 4DQQA 3GDXA 3GQCA 5DGBA 3FDSA 5DQIA 2K60A 2IBKA 1MSWD 1DRGA 3FM9A 1ZD3A 2LI6A 3PNCA 2WAQC 3RB4A 5J0PA 3KKAA 3LVWA 3QNMA 1ZQFA 5DDYA 5KFJA 5EOZA 4QW8A 3KBBA 2ESEA 5GTIU 5KG1A 1OXJA 2I6XA 1Z4NA 1SZPA 2ZXHA 1LB2B 1KN5A 5DG8A 3BJYA 4Q8EA 4UATA 5ALKA 3RTVA 3UMCA 3MC1A 1QTMA 4U7CA 1N2XA 2BR0A 5GTHU 3IP4B 5J2BA 4QWCA 4PZOA 1QSYA 7ICRA 1MQ2A 3ISBA 2R8KA 2OH2A 2JGAA 2RRDA 4KLGA 4MFAA 3QU2A 1DOQA 3GILA 3BQTA 2G08A 4EZ9A 9ICMA 2BPGA 5ALJA 2KVSA 2MUTA 3UXPA 4NLGA 2AHOB 3HW8A 4BGDA 2PKEA 1ZQIA 1BNPA 1CUKA 2W9BB 4F8RA 2RHFA 5ALNA 4EYHB 1SL1A 2DKZA 4TQSA 2A1JB 5J8YC 4F91B 3PX4A 4MHVA 1NK7A 3PR5B 9ICTA 4NL9C 3GIIA 1MN8A 1K1QA 1ZXIA 1JXLA 4F3OA 5AKYA 4KLMA 2KTQA 1U4BA 3CRXA 4UB2A 5AKGA 4J9SA 5HR7A 1RXWA 2IHNA 1D8YA 1TE2A 4DCCA 4RQ0A 4QZCA 1RQLA 1NJWA 8ICIA 4DSIA 3KHLA 2ZJ5A 2HHWA 7ICQA 4UAZA 3WK5A 4IL6U 4DF8A 1BNOA 2BPCA 2ZUCA 1ZQCA 3F2DA 1J2MA 5DB8A 1PUZA 3RB0A 4F4KA 9ICKA 2ZIUA 1B22A 4I2JA 3NVYA 3PX6A 1OW5A 1ZQPA 4UAUA 4IQUA 3HILA 2H3ZA 4J9QA 2Y0SC 2M9NA 4M04A 4RNOA 4UW9A 4DF4A 4YR0A 1SWVA 3TAPA 2FE9A 2A1JA 4RT3A 3LK9A 9ICJA 3AU6A 4YXJA 3LYSA 5J2JA 2VKQA 4UAYA 1T94A 4UB4A 8ICYA 2YMQA 5J2CA 4LJXA 4FE3A 4RZRA 4UB1A 2XO7A 2OHFA 4B9MA 3JPQA 2B21A 2YMLA 4Y2YA 2NV3A 4O5EA 1CEZA 2YTUA 2E3TA 1JN3A 4DS5A 2LKYA 4US8A 4Y2UA 1HJPA 1WUDA 5IIJA 2W04A 2KK0A 1SL2A 1XSNA 1HUOA 3FC4A 4KN4A 3UXOA 3ETRA 9ICBA 1MQ3A 1FFVA 3WKAA 1X6IA 2JH1A 3PMLA 3RF9A 5L1JA 2ZIVB 1TK5A 1SKRA 1JMSA 3BQ7A 4JV2A 1ZOLA 2J6SA 3BDPA 1V97A 3ZDBA 9ICOA 2H3QA 3JPSA 5DDMA 5BOLA 4K4IA 2XY6A 3ISDA 5DBCA 4RU9A 4RQMA 4RPXA 2QARB 4RQNA 5ALMA 1BPYA 3MGVA 2H3IA 2W43A 5DBBA 3S6JA 1S10A 5KT3A 4ELVA 2JEGA 1F0MA 4EX7A 1B43A 4I2DA 4K4GA 4YD2A 1NZPA 3H0LB 3PSIA 4DQRA 5ALGA 1QLNA 4NY8A 3B9JA 2XY5A 4YP3A 5ALSA 4EENA 1T3NA 4DQSA 4R64A 3EW9A 1ZQTA 4Y2SA 3HX0A 2K4EA 3VCBA 1SXDA 2ZJAA 4EBEA 2EAOA 2AJQA 1O08A 4OJOA 4FBTA 5JU5A 4YR2A 1B4FA 4ED8A 7ICFA 1L8OA 4DL2A 2BQ3A 4J9NA 5J0QA 5HMMA 3N97B 3E0FA 2ZIVA 1A77A 3QEBZ 3MR3A 2LPEA 4JUZA 4F5NA 1L7NA 4FZNA 2R8HA 2KICA 1COKA 2DKXA 2W9MA 4GC6A 3H7IA 4U6PA 5ALWA 3SENA 2IHMA 2WF6A 2JHDA 5J2GA 2OEHA 4KLUA 4IQVA 4C7YA 2PFNA 4NLCA 4ED1A 3RBDA 5J0OA 3TFSA 4C0ZA 3FYHA 1UA0A 1J97A 3SMVA 1C20A 3CP8A 3OGUA 4MEYA 3WK6A 1N56A 1MC8A 4DFJA 2HBMA 4B9SA 4PHPA 5KFCA 3QYPA 3Q8PB 4YMNA 4PGXA 1ZQJA 2OYYA 4F92B 2MAXA 5F9LA 1NK6A 1MA7A 8ICHA 2W7PA 4AP9A 3C1YA 2DWQA 2HBJA 2C22A 2L5YA 3WU2U 3OJSA 2JRZA 3QUCA 2RDIA 1DK2A 5AI0A 1ZQQA 1XS9D 5AK5A 5AKIA 1RQNA 9ICXA 2FPKA 2C2RA 3O0FA 2H3VA 4M47A 5KFAA 3HWTA 1Z3EB 3C23A 1NKCA 4DWIA 5DQGA 4Q45A 2ZUDA 4YN4A 1ZQMA 3D2QA 3ALRA 3NGDA 4UB6U 4RPZA 5KFBA 5AKXA 2R8JA 1RPLA 2HHVA 4EELA 1L3TA 3OPXA 4AYBC 2KFNA 1IG6A 2P66A 2NRWA 1LV5A 1S97A 2KZ3A 3EYZA 3GV7B 8ICUA 9ICUA 2K8AA 5L1LA 4C8OA 2G5IB 5AM1A 1QSLA 4B9TA 3PO5A 3SQIA 3PVXA 5EE9A 3WKEA 8ICFA 1X6JA 1SZHA 2WTFA 4RNNA 1JX4A 3F2CA 4GC7A 3IG8A 4I2AA 4M0AA 3PSTA 1SIJA 4O5CA 2KD1A 2YQEA 2W55A 4Y2RA 1V9PA 4YFKA 5CP2A 1NKEA 1KRPA 5AKJA 4ECRA 5KFNA 2VA3A 4JWNA 4I2FA 3T5HA 1NOMA 1PVQA 2KN7A 4EZ6A 1S76D 3BQ2A 4O3NA 2ISOA 2I5HA 5J0WA 5G5HA 4JV0A 3AQEA 3QUTA 4QIWF 5DQHA 4DOAA 1WYGA 3NASA 4OCZA 2FLNA 5EWGA 1F44A 2WAQF 2HBKA 2VJ5A 4IR1A 5EWEA 1KKXA 3GZFA 1RZTA 4YVZA 3RJKA 5ALXA 5DG7A 4O3SA 1TVAA 4P0QB 2BKEA 9ICFA 1D8LA 3F5AA 3OHBA 1TAMA 3GIKA 1AQ6A 2HHUA 3LDAA 2JR5A 2HBLA 1L7MA 3NRWA 5AM5A 3IHQB 3M1YA 5ALVA 4J9MA 4HYKA 2HVIA 9ICCA 2ASJA 5J29A 4DSEA 4IRCA 3UQ2A 4M9HA 1SKWA 4EBCA 5AM3A 9ICWA 4IRKA 2P35A 4DOBA 4EBDA 3D2SA 1AROP 2VIXA 4Q43A 3ZDDA 7ICKA 4QWEA 2ZXIA 5AK3A 1WWVA 3C1ZA 3ZI4A 5IIIA 1V38A 2KMDA 1Z00B 4FZLA 4USAA 5J0YA 2HW3A 4RNMA 4WJ3B 2JMGA 2ZIWB 2G5HB 4I28A 3BS5B 4P0PB 2KZMA 3UXNA 1XO1A 3UMBA 4RPYA 2QB0B 2F77X 2ZJ8A 3IG5A 4IS7A 4O3RA 2AH5A 4Z6EA 5CB1A 4CF3A 1L5UA 4BWJA 3PSPA 4GIBA 4QIWC 4FS2A 3TACB 5DB7A 5F9NA 4QJFB 4J9OA 4F50A 2QLTA 2I9GA 3M6ZA 3ZDEA 5ALRA 3BQ0A 1COOA 2E8MA 1T3QA 2FJ6A 1ZQRA 1SXEA 5KT2A 5IIMA 4UARA 2FLLA 5AHXA 1BVSA 4KLJA 2NRTA 5CEHA 2RP5A 2H5XA 5CWRA 2OCEA 2AGOA 4FFDA 3WK7A 4UB5A 5DLGA 3T79A 3NS1A 1BPEA 4CGZA 1TFRA 1RYUA 3TFRA 2VANA 5HMLA 1TKDA 2HDOA 2XC9A 4CF5A 2JEFA 1X2IA 2E1FA 1Q3VA 1VDVA 2P6UA 3M8RA 4EEYA 2ZIWA 3AM9A 1SKSA 2YX8A 3UQ0A 4P0PA 8ICJA 2C28A 5FP0A 2EZZA 3RJFA 3UPQA 4DSFA 1U47A 2K4IA 4R66A 4I2CA 1JROA 3UM9A 2Y0SF 2QB0A 2LM4A 4KX5A 5T14A 4NLBA 2KHQA 4QZIA 2YB1A 5KFTA 4DSLA 5KFLA 2BGWA 4ED2A 3I76A 4PH5A 3AL0B 3ISCA 2DFLA 3JPRA 2UVUA 4PHEA 3PW2A 5KFPA 5KFRA 1NNLA 4C4SA 1ZQXA 3TANA 2ES6A 5J2EA 5J2AA 5B5EU 4F5QA 3AMZA 3T3FA 4KLSA 1ZYQA 3NVVA 4Y2QA 5BPCA 5AK4A 5KL8B 1ZRMA 1DGSA 1PZNA 4YQWA 4RQ7A 1Q8KA 5CHGA 1Q46A 4NLKA 3D2NA 2JH7A 2ODGA 2LBOA 3C29A 4UAVA 4Z6CA 5AKKA 4F72A 1IV8A 4F4XA 4XRHA 4PGYA 3QZ7A 1WCNA 4MFFA 3WK9A 2NRXA 2DQNB 2HMXA 2IMWP 1ZETA 5KT7A 3KZIU 1L3SA 1A6SA 4I2EA 3V72A 2EQYA 3KKAC 2FMQA 3BQ1A 5ALTA 4RQ6A 5J2HA 2KZZA 1JIHA 3CW2C 4GFJA 5HNKA 3TADA 2W9BA 2W7OA 4QW9A 5KTQA 4XQ8A 2W9CB 1KTQA 2KNJA 2ZTEA 5KFWA 9ICQA 5JUMA 2F1HA 2HHSA 3SD7A 4OD0A 2LM1A 1UQVA 4YG2A 5KFYA 5J0UA 4DL7A 3V6JA 1ECWA 5TZVA 4QZFA 2XCAA 3V6KA 4G9BA 2ZTDA 2EAPA 2KJ5A 3IM1A 4TUSA 1ZJMA 1TK0A 1ZD4A 2LYHA 1KQQA 4M9GA 3EPIA 1RYRA 2YB4A 1NK5A 7ICMA 1L7OA 4QNLA 1KEJA 2UVWA 2P6RA 7ICHA 2MA1A 3ORYA 5DG9A 1ZQYA 3NUQA 4Y2PA 1K5OA 1C7YA 1XSLA 3GV8B 2G06A 2OWOA 3RFAA 5AI8A 4EYIB 1T8EA 1KW4A 2K8BB 3RRHA 1X9WA 5KG4A 1JXEA 2XGQA 4JK1A 4NLNA 4PL1A 2HOIA 3WKDA 1ZQAA 3OJUA 5C0YA 4LVSA 3N4MB 7ICVA 5J2IA 3H4DA 4JWMA 3M7DA 4C4RA 4O3OA 2BCQA 2W8LA 2XCPA 1Z1VA 2R8IA 2HOQA 1CI4A 1N5XA 8ICTA 4BUGA 2WF8A 2LMRA 5JRTA 3C28A 4FS1A 2CN1A 2KEYA 4C80A 3NTUA 4OJPA 1N60A 4PHAA 4MF2A 3MDAA 1LKYB 3T5LA 5KFZA 5KFUA 4R63A 2F1IA 2KKVA 3HPOA 3Q8LA 3N28A 4Y2TA 4BJQA 3U26A 2W03A 2HSZA 1NJYA 2KVCA 3GFKB 1KFTA 3A0HU 4YCXA 5IIKA 2XGPA 1IIPA 5KFHA 3C5FA 3QXGA 1SV0C 2W54A 2WB1C 4HAIA 1L8LA 4KLFA 3H0MB 2BCRA 5EE1A 1UHUA 3MGHA 3Q8KA 9ICRA 2QKQA 3QU7A 4J9PA 4CE6A 5KFVA 4IQWA 4XUSA 3H8MA 4IRDA 2F3NA 2ZG6A 4AYBF 3RB3A 4O3PA 1CRXA 5EWFA 3JPTA 1N5WA 5KFQA 2EH9A 5BOMA 2KHVA 1S9FA 4F5PA 1NJZA 5TISU 4ED6A 2MSNA 4DOCA 2K8CB 3HT3A 3N7RC 4DFDA 2QARA 5CA7A 2F2AB 4TQRA 2FMSA 8ICSA 3GV5B 1NZBA 3PW4A 2R18A 2F8KA 5KFSA 4J9KA 3K4GA 3TQ1A 5CRXA 2AQ0A 3OSNA 3SAGA 2FMPA 4F2SA 2N1RA 5CR0A 7ICUA 5EE3A 8ICAA 2WF9A 4DLGA 1WCLA 5KG5A 1PK1B 1RDFA 2QB1A 2ASLA 3NVZA 4ED0A 1ZQGA 5ALPA 2IOFA 1T7PA 4MFCA 3M8SA 1DXSA 2A19A 4OO1J 3MGIA 2OM6A 4ICAA 5ALDA 4O5KA 4YMOA 1L3UA 3RH5A 2H3FA 4KLIA 4RUCA 2G09A 4TUPA 1NI3A 2JEJA 1ZQLA 2NRVA 1QQ7A 1X9SA 4OJLA 5F3XB 3SAFA 2BDUA 2GLEA 1JRPA 1KL9A 9ICVA 1BPDA 1ZD2P 3I28A 3KD3A 5J0XA 4QZ8A 4X5VA 2Q0ZX 1VLBA 4KLOA 3H4BA 2DPJA 3VC8A 3MDCA 2W8KA 1D8BA 5E79U 5DB6A 3Q8RB 3L3FX 3OHAA 5KT5A 5D46A 4KLEA 5HHHA 1ZQSA 1N61A 8ICOA 2G0AA 2WHEA 1PK1A 3JPNA 1ZQUA 2K89A 4LZGA 4PHDA 4I2GA 8ICRA 2DPIA 2KSOB 2E5SA 2Y1IA 2NRZA 2A3VA 3EZ5A 5D4BA 2FPLA 3RBEA 4FO6A 4XA5A 3NRZA 5A0LA 7ICNA 2EZXA 2KP7A 4RQ8A 3KTQA 2B6GA 4BDPA 2KG5A 1XWLA 3LWLA 4DFKA 2BDPA 3V7KA 3OSPA 1IXRA 4RQ4A 4GLXA 4C8KA 3SV4A 3NVWA 3Q8MA 5KFGA 2E8OA 4JV1A 4KLHA 1WG8A 4UB8U 5L1MA 1B0XA 4PJ0U 2I1QA 1SL0A 1S0OA 4IR9A 2J6UA 4NM2A 5AKLA 4ELUA 8ICEA 4NJ8A 4F93B 4CCHA 3H0RB 2BPFA 4TUQA 3ZDAA 3RAXA 4NV0A 1Z1BA 4IQTA 9ICIA 2D3DA
chains in the Genus database with same CATH topology
4KN4A 3B0YA 2ASDA 3ISCA 2DFLA 3UXOA 4GXJA 4F4ZA 3JPRA 9ICBA 4F5OA 2UVUA 4PHEA 1NK0A 8ICPA 3B0XA 3PW2A 1MQ3A 5IINA 4I2HA 5KFPA 4O0IA 5KFRA 1N48A 3RJGA 1ZQXA 3TANA 3PMLA 4YMMA 4YD1A 4KLTA 3QEAZ 3RB6A 4KITB 5L1JA 5J2EA 2BCSA 8ICLA 1TK5A 5DB9A 5J2AA 1S0NA 4F5QA 1SKRA 2PFOA 1JMSA 9ICHA 4JV2A 8ICZA 3T3FA 1Y88A 4F4YA 4KLSA 1ZYQA 2J6SA 3BDPA 1U49A 5BPCA 4F2RA 3ZDBA 1ZQDA 3PO4A 4M2YA 1S0VA 2ALZA 9ICOA 1ZQNA 3RR8A 1UA1A 4KN7A 2ISPA 3C2KA 1DGSA 1PZNA 3JPSA 2PXIA 5DDMA 5BOLA 4YQWA 4RQ7A 3T5KA 3RJIA 4K4IA 2XY6A 4ECTA 3ISDA 5CHGA 5DBCA 4DFMA 4RU9A 4UQGA 4ECSA 4NLKA 1TAQA 3C2LA 1S0MA 8ICQA 5J0TA 4RPXA 4GXIA 7ICGA 4ECWA 5KFMA 5KT4A 5IILA 4DLEA 1XSPA 4Z6CA 3JPOA 1BPYA 4LZDA 3HP6A 1BPBA 4QZEA 4FBUA 9ICAA 2FPMA 5DBBA 4F4XA 4P2HA 4XRHA 1NK8A 1S10A 4RUAA 5KT3A 4PGYA 3QZ7A 2JEGA 4ELVA 1B43A 1WCNA 5CJ7A 4MFFA 4I2DA 2NRXA 2IMWP 3E2EA 3MR6A 4DO9A 2ZTCA 1ZETA 5KT7A 4K4GA 8ICGA 4YD2A 3GIMA 1L3SA 4DQRA 4I27A 1TV9A 1QLNA 4I2EA 1TK8A 4UB3A 3V72A 2HHQA 4NY8A 1U48A 4O3QA 2XY5A 4YP3A 3C2MA 1HUZA 1T3NA 2PI4A 4DQSA 5J0SA 2FMQA 3BQ1A 4R64A 2XY7A 3EW9A 4RQ6A 4QZBA 1ZQTA 5J2HA 4F4WA 3ZD9A 3HX0A 3ZDCA 2KZZA 4PGQA 1JIHA 3MR5A 2MUTB 4I2BA 2V9WA 2ZJAA 4EBEA 4QZGA 3V7JA 2AJQA 5HNKA 4ECZA 4FBTA 2W9BA 8ICXA 3M9NB 4YR2A 1ZQBA 4QW9A 4ECXA 4TURA 4ED8A 5KTQA 7ICFA 3TAQA 5J2FA 4DL2A 4I29A 2BQ3A 4J9NA 5C5JA 5J0QA 4ECVA 1ZQHA 2J6TA 4PPXA 4XQ8A 7ICPA 5HMMA 1ZQVA 2W9CB 3N97B 3SV3A 1KTQA 5KFWA 2ZTEA 1NJXA 9ICQA 1A77A 3QEBZ 3MFHA 1KDHA 4RQ1A 5JUMA 3MR3A 2F1HA 2HHSA 4QWAA 4JUZA 4F5NA 2R8HA 2AGQA 9ICEA 1KFDA 2W9MA 4RQ5A 3QE9Y 3PR4A 3Q8SB 4GC6A 4YG2A 5KFYA 5J0UA 4DL7A 4P4MA 3V6JA 4ED3A 2V4QA 1NK4A 1Z00A 3PW5A 3H7IA 4B9UA 5TZVA 4QZFA 4QWDA 2XCAA 2IHMA 3MR2A 3V6KA 4Z6FA 1XU4A 5KFOA 5DLFA 2ZTDA 2BHNA 4ECQA 3IM1A 4TUSA 4J9RA 5J2GA 1ZJMA 4KLUA 3M9OB 1TK0A 4IQVA 2LYHA 4ZH4A 2PFPA 8ICBA 4B9LA 3ETLA 2PFNA 4C8NA 4M9GA 7ICLA 4P4PA 4ED1A 1RXVA 3EPIA 3RBDA 5J0OA 1RYRA 3TFSA 3H8WA 3MABA 2PFQA 1NK5A 7ICMA 3FYHA 3TI0A 1UA0A 2ZUBA 1ZQKA 4DQIA 8ICNA 9ICSA 1KEJA 1UT8A 2UVWA 2P6RA 3V6HA 4DSKA 4KLDA 7ICHA 3G6XA 3OGUA 3ORYA 5DG9A 1ZQYA 4MEYA 1C7YA 1TAUA 1N56A 1MC8A 1XSLA 3GV8B 3SYZA 4DFJA 4B9SA 4BWMA 4PHPA 1X9MA 5KFCA 3Q8PB 4RT2A 1XC9A 4YMNA 4PGXA 4B9VA 1U45A 4KMUA 1ZQJA 4C8LA 2OWOA 4F92B 1IM4A 3RH4A 2MAXA 2UVVA 9ICNA 4K4HA 5F9LA 4Z6DA 1NK6A 3H40A 4KLQA 4NM1A 8ICHA 3MFIA 1D9FA 3C1YA 4EYIB 1ZJNA 3RJHA 1T8EA 4YXMA 5KG3A 3PW0A 3RRHA 2C22A 2AGPA 1ZQOA 4DSJA 1X9WA 2JEIA 4QZHA 5KG4A 4GXKA 3T5JA 1JXEA 3OJSA 5KFKA 2XGQA 4JK1A 5HHIA 3G6YA 4NLNA 2JZBB 2VA2A 1ZQAA 2RDIA 3OJUA 4RQ3A 1S77D 1EXNA 1ZQQA 2AU0A 4LVSA 1XS9D 3N4MB 3JPPA 9ICXA 7ICVA 5J2IA 3H4DA 4JWMA 4R65A 2FPKA 4O3OA 3ZD8A 5J2DA 4RQ2A 3SI8A 2C2RA 5KFFA 2BCQA 3KHHA 5KFAA 2C2DA 4M47A 9ICGA 2W8LA 1BGXT 2XCPA 2R8IA 3HWTA 5IIOA 1Z3EB 3C23A 5KG6A 1NKCA 4DWIA 8ICTA 5DQGA 2FLPA 2R8GA 7ICOA 4Q45A 3G6VA 2ZUDA 4YN4A 4ECUA 5L1KA 8ICWA 1ZQMA 4Q44A 1ZQZA 4DL6A 5D49A 3NGDA 4FS1A 3PMNA 3SZ2A 3PW7A 4RPZA 4Q8FA 5KFBA 2R8JA 1RPLA 3NTUA 1RYSA 2HHVA 1L3TA 4M9JA 4PHAA 3EPGA 4MF2A 2KFNA 3MDAA 5J0RA 2P66A 7ICIA 3RAQA 5DBAA 2NRWA 3T5LA 5KFZA 1LV5A 5KFUA 3H8JA 5KT6A 4R63A 2F1IA 3LWMA 3HPOA 4QZDA 3Q8LA 2BCUA 1S97A 2KZ3A 3EYZA 1A76A 1NJYA 3PX0A 1KSPA 3GV7B 3GFKB 1H38A 4DQQA 8ICUA 1KFTA 4YCXA 4J9LA 4DL5A 9ICUA 3GDXA 3GQCA 5IIKA 5DGBA 2XGPA 5L1LA 1NKBA 4C8OA 3FDSA 5KFHA 1QSLA 4B9TA 3C5FA 5DQIA 3PO5A 3PVXA 1U9LA 2IBKA 1MSWD 5KFDA 2ATLA 8ICFA 4UBCA 2WTFA 4RNNA 4KLFA 1JX4A 2BCRA 3V7LA 4GC7A 3MGHA 3PNCA 3Q8KA 4I2AA 4M0AA 9ICRA 4J9PA 3RB4A 5KFVA 3RJJA 5J0PA 4IQWA 4O5CA 4XUSA 4IRDA 3RB3A 4O3PA 5DKWA 9ICPA 5EWFA 1V9PA 2JZBA 5KFXA 5CP2A 4YFKA 5KFQA 3JPTA 1NKEA 1ZQFA 4QWBA 5DDYA 5KFJA 3KHGA 5EOZA 1KRPA 4QW8A 5KFNA 5BOMA 4ECRA 2VA3A 5KG1A 1BPZA 4JWNA 4I2FA 3T5HA 7ICJA 1S9FA 4F5PA 1NJZA 1NOMA 2KN7A 4EZ6A 4ED6A 1SZPA 1S76D 4ELTA 3BQ2A 4O3NA 2ISOA 5J0WA 4DOCA 3HT3A 4DL4A 1LB2B 4JV0A 5DG8A 3BJYA 5DQHA 4Q8EA 5KFEA 5CA7A 4DOAA 4TQRA 4MF8A 2FMSA 3RH6A 8ICSA 3RTVA 3Q8QB 3GV5B 1QTMA 3PW4A 2FLNA 2BR0A 5EWGA 2F1JA 5KFSA 5J2BA 4J9KA 3MBYA 3K4GA 1KLNA 4QWCA 2UVRA 3TQ1A 2AQ0A 4UBBA 1QSYA 4IR1A 4DFPA 7ICRA 4P4OA 5EWEA 3OSNA 1MQ2A 1UT5A 8ICVA 5KG2A 1RZTA 2FMPA 4YVZA 8ICCA 3ISBA 7ICEA 3RJKA 2R8KA 5CR0A 4F2SA 5DG7A 4KLGA 4O3SA 1TVAA 7ICUA 2BKEA 4QZ9A 4MFAA 1D8LA 3M9MB 2W9AA 9ICFA 8ICAA 4M9LA 3OHBA 4O9MA 4DLGA 1DOQA 3GILA 2GWSA 8ICKA 3BQTA 3GIKA 1WCLA 4E0DA 5KG5A 4EZ9A 2ASLA 9ICMA 3QZ8A 2BPGA 4B9NA 2HHUA 4ED0A 3LDAA 1ZQGA 2MUTA 3UXPA 4NLGA 5KG0A 4DQPA 3IHQB 3H8SA 3PV8A 1T7PA 3HW8A 3M8SA 4MFCA 4BGDA 4J9MA 1ZQIA 1ZQWA 4HYKA 2HVIA 3MGIA 1CUKA 9ICCA 2ASJA 5J29A 4DSEA 4IRCA 3UQ2A 5KG7A 4M9HA 1SKWA 2W9BB 2W9CA 4EBCA 4F8RA 4KTQA 4NLZA 9ICWA 4O5KA 4IRKA 4YMOA 4MEXA 2RDJA 3RH5A 1L3UA 4DOBA 4M6WB 4EYHB 4EBDA 1SL1A 4KLIA 4RUCA 4TQSA 3C5GA 4TUPA 2A1JB 2JEJA 1NK9A 1AROP 1ZQLA 2NRVA 2BQRA 1X9SA 4Q43A 5L9XA 4NXZA 3ZDDA 7ICKA 4QWEA 4F91B 3EWAA 3RJEA 3C1ZA 3PX4A 5IIIA 2HVHA 4YR3A 1Z00B 4C8MA 1NK7A 3PR5B 9ICTA 4I2IA 5J0YA 2HW3A 4RNMA 3GIIA 9ICVA 1D9DA 1K1QA 1BPDA 1JXLA 7ICSA 5J0XA 4F3OA 4I28A 1K1SA 2IA6A 4KLMA 4QZ8A 3UXNA 2KZMA 2KTQA 1XO1A 1U4BA 5J2KA 4X5VA 4KLLA 2Q0ZX 4UB2A 4RPYA 4KLOA 3H4BA 2ZJ8A 2DPJA 3MDCA 4O3RA 2W8KA 3RRGA 4J9SA 4Z6EA 4ECYA 5CB1A 5DB6A 4BXOB 3Q8RB 1RXWA 1L5UA 3OHAA 4BWJA 2IHNA 5KT5A 5D46A 4KLEA 5HHHA 1D8YA 1ZQSA 8ICOA 4RQ0A 4R8UB 4QZCA 4FS2A 2HHTA 3JPNA 1ZQUA 3TARA 5DB7A 5F9NA 1NJWA 4F50A 4J9OA 4LZGA 8ICIA 4DSIA 4PHDA 3KHLA 2I9GA 4G3IA 4I2GA 2ZJ5A 2HHXA 4DEZA 3ZDEA 2HHWA 8ICRA 4UAZA 7ICQA 3BQ0A 5KFIA 2DPIA 4DF8A 1COOA 2Y1IA 2BPCA 2NRZA 2ZUCA 1ZQCA 3PY8A 1ZQRA 5KT2A 5DB8A 5IIMA 3RB0A 3GIJA 4F4KA 2FLLA 9ICKA 1B22A 3EZ5A 4I2JA 5D4BA 2FPLA 3PX6A 1BVSA 1ZQPA 4KLJA 5HP4A 4IQUA 2NRTA 4J9QA 4DS4A 3RBEA 8ICMA 4FO6A 2M9NA 2VA8A 3KHRA 4XA5A 4RNOA 4F5RA 4DL3A 4M04A 2H5XA 5CWRA 2AGOA 4M6WA 1ZQEA 3RR7A 4UB5A 5DLGA 4DF4A 7ICTA 4YR0A 7ICNA 1BPEA 3TAPA 4RQ8A 2A1JA 1QSSA 3KTQA 4RT3A 3LK9A 1KFSA 4BDPA 9ICJA 1TFRA 3AU6A 1XWLA 4YXJA 3LWLA 4DFKA 2BDPA 3V7KA 3TFRA 5J2JA 2VANA 3AUOA 5HMLA 1TKDA 3OSPA 1IXRA 4RQ4A 2XC9A 4GLXA 4UAYA 2C2EA 2BCVA 4UB4A 2V4RA 2JEFA 1X2IA 8ICYA 5J2CA 4C8KA 3SV4A 3THVA 1T4GA 2AQ4A 5DGAA 3Q8MA 2P6UA 3M8RA 4EEYA 4RZRA 4UB1A 5KFGA 2XO7A 4JV1A 1SKSA 4KLHA 4UAWA 4B9MA 3JPQA 2B21A 3AU2A 3UQ0A 4O5EA 1CEZA 8ICJA 9ICLA 2C28A 1SL0A 3RJFA 2I1QA 3UPQA 4DSFA 1U47A 1S0OA 1L3VA 1BPXA 4R66A 2PI5A 4I2CA 4IR9A 1JN3A 4M9NA 2J6UA 4NM2A 3K75D 4ELUA 4DS5A 8ICEA 4F93B 5L1IA 4CCHA 1HJPA 4BXOA 5IIJA 4ED7A 4QZIA 2Y1JA 5KFTA 2BPFA 5KFLA 4DSLA 4TUQA 3ZDAA 2BGWA 3RAXA 4ED2A 3C21A 1SL2A 4R8UA 2KFZA 4PH5A 1XSNA 4IQTA 1HUOA 9ICIA 4QZAA 2BQUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KN4 A;  3B0Y A;  2ASD A;  3ISC A;  2DFL A;  3UXO A;  4GXJ A;  4F4Z A;  3JPR A;  9ICB A;  4F5O A;  2UVU A;  4PHE A;  1NK0 A;  8ICP A;  3B0X A;  3PW2 A;  1MQ3 A;  5IIN A;  4I2H A;  5KFP A;  4O0I A;  5KFR A;  1N48 A;  3RJG A;  1ZQX A;  3TAN A;  3PML A;  4YMM A;  4YD1 A;  4KLT A;  3QEA Z;  3RB6 A;  4KIT B;  5L1J A;  5J2E A;  2BCS A;  8ICL A;  1TK5 A;  5DB9 A;  5J2A A;  1S0N A;  4F5Q A;  1SKR A;  2PFO A;  1JMS A;  9ICH A;  4JV2 A;  8ICZ A;  3T3F A;  1Y88 A;  4F4Y A;  4KLS A;  1ZYQ A;  2J6S A;  3BDP A;  1U49 A;  5BPC A;  4F2R A;  3ZDB A;  1ZQD A;  3PO4 A;  4M2Y A;  1S0V A;  2ALZ A;  9ICO A;  1ZQN A;  3RR8 A;  1UA1 A;  4KN7 A;  2ISP A;  3C2K A;  1DGS A;  1PZN A;  3JPS A;  2PXI A;  5DDM A;  5BOL A;  4YQW A;  4RQ7 A;  3T5K A;  3RJI A;  4K4I A;  2XY6 A;  4ECT A;  3ISD A;  5CHG A;  5DBC A;  4DFM A;  4RU9 A;  4UQG A;  4ECS A;  4NLK A;  1TAQ A;  3C2L A;  1S0M A;  8ICQ A;  5J0T A;  4RPX A;  4GXI A;  7ICG A;  4ECW A;  5KFM A;  5KT4 A;  5IIL A;  4DLE A;  1XSP A;  4Z6C A;  3JPO A;  1BPY A;  4LZD A;  3HP6 A;  1BPB A;  4QZE A;  4FBU A;  9ICA A;  2FPM A;  5DBB A;  4F4X A;  4P2H A;  4XRH A;  1NK8 A;  1S10 A;  4RUA A;  5KT3 A;  4PGY A;  3QZ7 A;  2JEG A;  4ELV A;  1B43 A;  1WCN A;  5CJ7 A;  4MFF A;  4I2D A;  2NRX A;  2IMW P;  3E2E A;  3MR6 A;  4DO9 A;  2ZTC A;  1ZET A;  5KT7 A;  4K4G A;  8ICG A;  4YD2 A;  3GIM A;  1L3S A;  4DQR A;  4I27 A;  1TV9 A;  1QLN A;  4I2E A;  1TK8 A;  4UB3 A;  3V72 A;  2HHQ A;  4NY8 A;  1U48 A;  4O3Q A;  2XY5 A;  4YP3 A;  3C2M A;  1HUZ A;  1T3N A;  2PI4 A;  4DQS A;  5J0S A;  2FMQ A;  3BQ1 A;  4R64 A;  2XY7 A;  3EW9 A;  4RQ6 A;  4QZB A;  1ZQT A;  5J2H A;  4F4W A;  3ZD9 A;  3HX0 A;  3ZDC A;  2KZZ A;  4PGQ A;  1JIH A;  3MR5 A;  2MUT B;  4I2B A;  2V9W A;  2ZJA A;  4EBE A;  4QZG A;  3V7J A;  2AJQ A;  5HNK A;  4ECZ A;  4FBT A;  2W9B A;  8ICX A;  3M9N B;  4YR2 A;  1ZQB A;  4QW9 A;  4ECX A;  4TUR A;  4ED8 A;  5KTQ A;  7ICF A;  3TAQ A;  5J2F A;  4DL2 A;  4I29 A;  2BQ3 A;  4J9N A;  5C5J A;  5J0Q A;  4ECV A;  1ZQH A;  2J6T A;  4PPX A;  4XQ8 A;  7ICP A;  5HMM A;  1ZQV A;  2W9C B;  3N97 B;  3SV3 A;  1KTQ A;  5KFW A;  2ZTE A;  1NJX A;  9ICQ A;  1A77 A;  3QEB Z;  3MFH A;  1KDH A;  4RQ1 A;  5JUM A;  3MR3 A;  2F1H A;  2HHS A;  4QWA A;  4JUZ A;  4F5N A;  2R8H A;  2AGQ A;  9ICE A;  1KFD A;  2W9M A;  4RQ5 A;  3QE9 Y;  3PR4 A;  3Q8S B;  4GC6 A;  4YG2 A;  5KFY A;  5J0U A;  4DL7 A;  4P4M A;  3V6J A;  4ED3 A;  2V4Q A;  1NK4 A;  1Z00 A;  3PW5 A;  3H7I A;  4B9U A;  5TZV A;  4QZF A;  4QWD A;  2XCA A;  2IHM A;  3MR2 A;  3V6K A;  4Z6F A;  1XU4 A;  5KFO A;  5DLF A;  2ZTD A;  2BHN A;  4ECQ A;  3IM1 A;  4TUS A;  4J9R A;  5J2G A;  1ZJM A;  4KLU A;  3M9O B;  1TK0 A;  4IQV A;  2LYH A;  4ZH4 A;  2PFP A;  8ICB A;  4B9L A;  3ETL A;  2PFN A;  4C8N A;  4M9G A;  7ICL A;  4P4P A;  4ED1 A;  1RXV A;  3EPI A;  3RBD A;  5J0O A;  1RYR A;  3TFS A;  3H8W A;  3MAB A;  2PFQ A;  1NK5 A;  7ICM A;  3FYH A;  3TI0 A;  1UA0 A;  2ZUB A;  1ZQK A;  4DQI A;  8ICN A;  9ICS A;  1KEJ A;  1UT8 A;  2UVW A;  2P6R A;  3V6H A;  4DSK A;  4KLD A;  7ICH A;  3G6X A;  3OGU A;  3ORY A;  5DG9 A;  1ZQY A;  4MEY A;  1C7Y A;  1TAU A;  1N56 A;  1MC8 A;  1XSL A;  3GV8 B;  3SYZ A;  4DFJ A;  4B9S A;  4BWM A;  4PHP A;  1X9M A;  5KFC A;  3Q8P B;  4RT2 A;  1XC9 A;  4YMN A;  4PGX A;  4B9V A;  1U45 A;  4KMU A;  1ZQJ A;  4C8L A;  2OWO A;  4F92 B;  1IM4 A;  3RH4 A;  2MAX A;  2UVV A;  9ICN A;  4K4H A;  5F9L A;  4Z6D A;  1NK6 A;  3H40 A;  4KLQ A;  4NM1 A;  8ICH A;  3MFI A;  1D9F A;  3C1Y A;  4EYI B;  1ZJN A;  3RJH A;  1T8E A;  4YXM A;  5KG3 A;  3PW0 A;  3RRH A;  2C22 A;  2AGP A;  1ZQO A;  4DSJ A;  1X9W A;  2JEI A;  4QZH A;  5KG4 A;  4GXK A;  3T5J A;  1JXE A;  3OJS A;  5KFK A;  2XGQ A;  4JK1 A;  5HHI A;  3G6Y A;  4NLN A;  2JZB B;  2VA2 A;  1ZQA A;  2RDI A;  3OJU A;  4RQ3 A;  1S77 D;  1EXN A;  1ZQQ A;  2AU0 A;  4LVS A;  1XS9 D;  3N4M B;  3JPP A;  9ICX A;  7ICV A;  5J2I A;  3H4D A;  4JWM A;  4R65 A;  2FPK A;  4O3O A;  3ZD8 A;  5J2D A;  4RQ2 A;  3SI8 A;  2C2R A;  5KFF A;  2BCQ A;  3KHH A;  5KFA A;  2C2D A;  4M47 A;  9ICG A;  2W8L A;  1BGX T;  2XCP A;  2R8I A;  3HWT A;  5IIO A;  1Z3E B;  3C23 A;  5KG6 A;  1NKC A;  4DWI A;  8ICT A;  5DQG A;  2FLP A;  2R8G A;  7ICO A;  4Q45 A;  3G6V A;  2ZUD A;  4YN4 A;  4ECU A;  5L1K A;  8ICW A;  1ZQM A;  4Q44 A;  1ZQZ A;  4DL6 A;  5D49 A;  3NGD A;  4FS1 A;  3PMN A;  3SZ2 A;  3PW7 A;  4RPZ A;  4Q8F A;  5KFB A;  2R8J A;  1RPL A;  3NTU A;  1RYS A;  2HHV A;  1L3T A;  4M9J A;  4PHA A;  3EPG A;  4MF2 A;  2KFN A;  3MDA A;  5J0R A;  2P66 A;  7ICI A;  3RAQ A;  5DBA A;  2NRW A;  3T5L A;  5KFZ A;  1LV5 A;  5KFU A;  3H8J A;  5KT6 A;  4R63 A;  2F1I A;  3LWM A;  3HPO A;  4QZD A;  3Q8L A;  2BCU A;  1S97 A;  2KZ3 A;  3EYZ A;  1A76 A;  1NJY A;  3PX0 A;  1KSP A;  3GV7 B;  3GFK B;  1H38 A;  4DQQ A;  8ICU A;  1KFT A;  4YCX A;  4J9L A;  4DL5 A;  9ICU A;  3GDX A;  3GQC A;  5IIK A;  5DGB A;  2XGP A;  5L1L A;  1NKB A;  4C8O A;  3FDS A;  5KFH A;  1QSL A;  4B9T A;  3C5F A;  5DQI A;  3PO5 A;  3PVX A;  1U9L A;  2IBK A;  1MSW D;  5KFD A;  2ATL A;  8ICF A;  4UBC A;  2WTF A;  4RNN A;  4KLF A;  1JX4 A;  2BCR A;  3V7L A;  4GC7 A;  3MGH A;  3PNC A;  3Q8K A;  4I2A A;  4M0A A;  9ICR A;  4J9P A;  3RB4 A;  5KFV A;  3RJJ A;  5J0P A;  4IQW A;  4O5C A;  4XUS A;  4IRD A;  3RB3 A;  4O3P A;  5DKW A;  9ICP A;  5EWF A;  1V9P A;  2JZB A;  5KFX A;  5CP2 A;  4YFK A;  5KFQ A;  3JPT A;  1NKE A;  1ZQF A;  4QWB A;  5DDY A;  5KFJ A;  3KHG A;  5EOZ A;  1KRP A;  4QW8 A;  5KFN A;  5BOM A;  4ECR A;  2VA3 A;  5KG1 A;  1BPZ A;  4JWN A;  4I2F A;  3T5H A;  7ICJ A;  1S9F A;  4F5P A;  1NJZ A;  1NOM A;  2KN7 A;  4EZ6 A;  4ED6 A;  1SZP A;  1S76 D;  4ELT A;  3BQ2 A;  4O3N A;  2ISO A;  5J0W A;  4DOC A;  3HT3 A;  4DL4 A;  1LB2 B;  4JV0 A;  5DG8 A;  3BJY A;  5DQH A;  4Q8E A;  5KFE A;  5CA7 A;  4DOA A;  4TQR A;  4MF8 A;  2FMS A;  3RH6 A;  8ICS A;  3RTV A;  3Q8Q B;  3GV5 B;  1QTM A;  3PW4 A;  2FLN A;  2BR0 A;  5EWG A;  2F1J A;  5KFS A;  5J2B A;  4J9K A;  3MBY A;  3K4G A;  1KLN A;  4QWC A;  2UVR A;  3TQ1 A;  2AQ0 A;  4UBB A;  1QSY A;  4IR1 A;  4DFP A;  7ICR A;  4P4O A;  5EWE A;  3OSN A;  1MQ2 A;  1UT5 A;  8ICV A;  5KG2 A;  1RZT A;  2FMP A;  4YVZ A;  8ICC A;  3ISB A;  7ICE A;  3RJK A;  2R8K A;  5CR0 A;  4F2S A;  5DG7 A;  4KLG A;  4O3S A;  1TVA A;  7ICU A;  2BKE A;  4QZ9 A;  4MFA A;  1D8L A;  3M9M B;  2W9A A;  9ICF A;  8ICA A;  4M9L A;  3OHB A;  4O9M A;  4DLG A;  1DOQ A;  3GIL A;  2GWS A;  8ICK A;  3BQT A;  3GIK A;  1WCL A;  4E0D A;  5KG5 A;  4EZ9 A;  2ASL A;  9ICM A;  3QZ8 A;  2BPG A;  4B9N A;  2HHU A;  4ED0 A;  3LDA A;  1ZQG A;  2MUT A;  3UXP A;  4NLG A;  5KG0 A;  4DQP A;  3IHQ B;  3H8S A;  3PV8 A;  1T7P A;  3HW8 A;  3M8S A;  4MFC A;  4BGD A;  4J9M A;  1ZQI A;  1ZQW A;  4HYK A;  2HVI A;  3MGI A;  1CUK A;  9ICC A;  2ASJ A;  5J29 A;  4DSE A;  4IRC A;  3UQ2 A;  5KG7 A;  4M9H A;  1SKW A;  2W9B B;  2W9C A;  4EBC A;  4F8R A;  4KTQ A;  4NLZ A;  9ICW A;  4O5K A;  4IRK A;  4YMO A;  4MEX A;  2RDJ A;  3RH5 A;  1L3U A;  4DOB A;  4M6W B;  4EYH B;  4EBD A;  1SL1 A;  4KLI A;  4RUC A;  4TQS A;  3C5G A;  4TUP A;  2A1J B;  2JEJ A;  1NK9 A;  1ARO P;  1ZQL A;  2NRV A;  2BQR A;  1X9S A;  4Q43 A;  5L9X A;  4NXZ A;  3ZDD A;  7ICK A;  4QWE A;  4F91 B;  3EWA A;  3RJE A;  3C1Z A;  3PX4 A;  5III A;  2HVH A;  4YR3 A;  1Z00 B;  4C8M A;  1NK7 A;  3PR5 B;  9ICT A;  4I2I A;  5J0Y A;  2HW3 A;  4RNM A;  3GII A;  9ICV A;  1D9D A;  1K1Q A;  1BPD A;  1JXL A;  7ICS A;  5J0X A;  4F3O A;  4I28 A;  1K1S A;  2IA6 A;  4KLM A;  4QZ8 A;  3UXN A;  2KZM A;  2KTQ A;  1XO1 A;  1U4B A;  5J2K A;  4X5V A;  4KLL A;  2Q0Z X;  4UB2 A;  4RPY A;  4KLO A;  3H4B A;  2ZJ8 A;  2DPJ A;  3MDC A;  4O3R A;  2W8K A;  3RRG A;  4J9S A;  4Z6E A;  4ECY A;  5CB1 A;  5DB6 A;  4BXO B;  3Q8R B;  1RXW A;  1L5U A;  3OHA A;  4BWJ A;  2IHN A;  5KT5 A;  5D46 A;  4KLE A;  5HHH A;  1D8Y A;  1ZQS A;  8ICO A;  4RQ0 A;  4R8U B;  4QZC A;  4FS2 A;  2HHT A;  3JPN A;  1ZQU A;  3TAR A;  5DB7 A;  5F9N A;  1NJW A;  4F50 A;  4J9O A;  4LZG A;  8ICI A;  4DSI A;  4PHD A;  3KHL A;  2I9G A;  4G3I A;  4I2G A;  2ZJ5 A;  2HHX A;  4DEZ A;  3ZDE A;  2HHW A;  8ICR A;  4UAZ A;  7ICQ A;  3BQ0 A;  5KFI A;  2DPI A;  4DF8 A;  1COO A;  2Y1I A;  2BPC A;  2NRZ A;  2ZUC A;  1ZQC A;  3PY8 A;  1ZQR A;  5KT2 A;  5DB8 A;  5IIM A;  3RB0 A;  3GIJ A;  4F4K A;  2FLL A;  9ICK A;  1B22 A;  3EZ5 A;  4I2J A;  5D4B A;  2FPL A;  3PX6 A;  1BVS A;  1ZQP A;  4KLJ A;  5HP4 A;  4IQU A;  2NRT A;  4J9Q A;  4DS4 A;  3RBE A;  8ICM A;  4FO6 A;  2M9N A;  2VA8 A;  3KHR A;  4XA5 A;  4RNO A;  4F5R A;  4DL3 A;  4M04 A;  2H5X A;  5CWR A;  2AGO A;  4M6W A;  1ZQE A;  3RR7 A;  4UB5 A;  5DLG A;  4DF4 A;  7ICT A;  4YR0 A;  7ICN A;  1BPE A;  3TAP A;  4RQ8 A;  2A1J A;  1QSS A;  3KTQ A;  4RT3 A;  3LK9 A;  1KFS A;  4BDP A;  9ICJ A;  1TFR A;  3AU6 A;  1XWL A;  4YXJ A;  3LWL A;  4DFK A;  2BDP A;  3V7K A;  3TFR A;  5J2J A;  2VAN A;  3AUO A;  5HML A;  1TKD A;  3OSP A;  1IXR A;  4RQ4 A;  2XC9 A;  4GLX A;  4UAY A;  2C2E A;  2BCV A;  4UB4 A;  2V4R A;  2JEF A;  1X2I A;  8ICY A;  5J2C A;  4C8K A;  3SV4 A;  3THV A;  1T4G A;  2AQ4 A;  5DGA A;  3Q8M A;  2P6U A;  3M8R A;  4EEY A;  4RZR A;  4UB1 A;  5KFG A;  2XO7 A;  4JV1 A;  1SKS A;  4KLH A;  4UAW A;  4B9M A;  3JPQ A;  2B21 A;  3AU2 A;  3UQ0 A;  4O5E A;  1CEZ A;  8ICJ A;  9ICL A;  2C28 A;  1SL0 A;  3RJF A;  2I1Q A;  3UPQ A;  4DSF A;  1U47 A;  1S0O A;  1L3V A;  1BPX A;  4R66 A;  2PI5 A;  4I2C A;  4IR9 A;  1JN3 A;  4M9N A;  2J6U A;  4NM2 A;  3K75 D;  4ELU A;  4DS5 A;  8ICE A;  4F93 B;  5L1I A;  4CCH A;  1HJP A;  4BXO A;  5IIJ A;  4ED7 A;  4QZI A;  2Y1J A;  5KFT A;  2BPF A;  5KFL A;  4DSL A;  4TUQ A;  3ZDA A;  2BGW A;  3RAX A;  4ED2 A;  3C21 A;  1SL2 A;  4R8U A;  2KFZ A;  4PH5 A;  1XSN A;  4IQT A;  1HUO A;  9ICI A;  4QZA A;  2BQU A; 
#chains in the Genus database with same CATH topology
 4GXJ A;  1NK0 A;  3B0X A;  5IIN A;  2KE7 A;  5KNI A;  3RJG A;  2NYV A;  4YMM A;  1SB3 C;  2K4P A;  4YD1 A;  3QEA Z;  3RB6 A;  4KIT B;  2BCS A;  5ALE A;  1PVP A;  2PFO A;  9ICH A;  8ICZ A;  4F4Y A;  3BS7 A;  2NO5 A;  3WK8 A;  1U49 A;  3E58 A;  2DL0 A;  3PO4 A;  1LVH A;  2ALZ A;  3ED5 A;  3RR8 A;  1UA1 A;  2KKP A;  4KN7 A;  2LHT A;  1PK3 A;  4DFM A;  5KAF U;  3K1Z A;  2MU2 A;  3TKA A;  1S8O A;  1TAQ A;  5ALF A;  8ICQ A;  4GXI A;  5KFM A;  5IIL A;  2KOB A;  3GU3 A;  1XSP A;  3JPO A;  4LZD A;  3F53 A;  3HP6 A;  2E1E A;  4QZE A;  5J8Y A;  2RQ5 A;  4FBU A;  2FPM A;  9ICA A;  5AIB A;  4P0Q A;  1NK8 A;  3E2E A;  2LYB A;  2XVT A;  2ZTC A;  4I27 A;  4NL9 A;  4UB3 A;  1U48 A;  3QX7 A;  1WWU A;  3L4P A;  1L7P A;  3MR5 A;  2MUT B;  2KJ9 A;  2V9W A;  4QZG A;  4ECZ A;  4J03 A;  8ICX A;  1ZQB A;  1ED1 A;  1X9X A;  5J2F A;  4ECV A;  1ZQH A;  2MRL A;  4CF4 A;  2J6T A;  4PPX A;  3N7S C;  3SV3 A;  1NJX A;  1N63 A;  3MFH A;  1KDH A;  4RQ1 A;  2YN4 A;  4QWA A;  3I1Y A;  1KFD A;  5AI4 A;  5ALU A;  3PR4 A;  3QU9 A;  4P4M A;  4ED3 A;  4B9U A;  1Z00 A;  3PW5 A;  2WF7 A;  1P7D A;  3MR2 A;  3SR6 A;  4Z6F A;  1XU4 A;  5KFO A;  5DLF A;  2E8P A;  3IRU A;  4ECQ A;  3BS5 A;  1SGG A;  1OUQ A;  5ALO A;  4P4P A;  3BZC A;  3H8W A;  2PFQ A;  3N7P D;  4KLD A;  4NWI A;  5AKZ A;  5AKE A;  1QCK A;  5AK6 A;  3SYZ A;  4C4T A;  2YY6 A;  4B9V A;  1U45 A;  4KMU A;  4C8L A;  3HKZ C;  3RH4 A;  3QU4 A;  4K4H A;  1N62 A;  5AM4 A;  3AQF A;  3MFI A;  2K4H A;  1ZJN A;  4YXM A;  2AGP A;  1ZRN A;  4DSJ A;  2JEI A;  2RLT A;  1JAL A;  4GXK A;  2EZY A;  3T5J A;  5KFK A;  2JZB B;  3IN5 A;  2DF4 B;  4RQ3 A;  2AU0 A;  2ZIU B;  3JPP A;  4R65 A;  3QU5 A;  2PMZ C;  3FAH A;  3ZD8 A;  5KFF A;  3KHH A;  4PL2 A;  1RM6 C;  1RG6 A;  2HCF A;  5IIO A;  1L6N A;  7ICO A;  3G6V A;  5L1K A;  8ICW A;  3CNH A;  1X40 A;  4KMO B;  4PZN A;  3PW7 A;  4Q8F A;  3KFU F;  1QH9 A;  2NO4 A;  1RYS A;  4IC9 A;  3EPG A;  2OXO A;  2DBY A;  5J0R A;  7ICI A;  3RAQ A;  5DBA A;  4UAS A;  2M0N A;  1F5S A;  3H8J A;  4JMU A;  3LWM A;  2HI0 A;  4QZD A;  1A76 A;  3A0B U;  1KSP A;  3SAH A;  4J9L A;  4DL5 A;  4ZOH C;  1NKB A;  4EEK A;  4F71 A;  1U9L A;  5KFD A;  2ATL A;  4UBC A;  1S5L U;  3V7L A;  4A8E A;  3KOO A;  3IV6 A;  3BZK A;  5K4L A;  3RJJ A;  4JB3 A;  5DKW A;  9ICP A;  2JZB A;  5KFX A;  3UMG A;  4QWB A;  2Y9U A;  3KHG A;  2A1A A;  1BPZ A;  1Z4O A;  5EE0 A;  7ICJ A;  1SV0 A;  1QQ6 A;  4ELT A;  5ALH A;  2E8N A;  4DL4 A;  1FEZ A;  2WB1 F;  1HIW A;  2FDR A;  5KFE A;  4MF8 A;  4FZM A;  3RH6 A;  3Q8Q B;  4Y2J A;  2F1J A;  3MBY A;  1KLN A;  2UVR A;  2EAN A;  4UBB A;  1VJ5 A;  4DFP A;  4P4O A;  3F5E A;  3J81 j;  1UT5 A;  8ICV A;  5AKH A;  5KG2 A;  8ICC A;  7ICE A;  4QZ9 A;  3M9M B;  2W9A A;  4M9L A;  4O9M A;  8ICK A;  2GWS A;  4E0D A;  1UCV A;  3QZ8 A;  4CNQ A;  4B9N A;  2BZF A;  2IOF K;  5KG0 A;  4DQP A;  5ALI A;  3H8S A;  3PV8 A;  4BX9 C;  1ZQW A;  2EDU A;  1UPH A;  5KG7 A;  1SWW A;  2W9C A;  4KTQ A;  4NLZ A;  1X42 A;  2CXY A;  1QQ5 A;  3PSF A;  4MEX A;  5AI6 A;  2RDJ A;  4M6W B;  2YMP A;  4US9 A;  3C5G A;  1NK9 A;  3DDH A;  2BQR A;  2F44 A;  5L9X A;  4EX6 A;  4NXZ A;  5AM0 A;  3ICX A;  3EWA A;  3RJE A;  1M6Y A;  2HVH A;  4YR3 A;  2KV2 A;  4C7Z A;  4C8M A;  4I2I A;  1D9D A;  7ICS A;  1K1S A;  1J2N A;  2IA6 A;  2G07 A;  5J2K A;  4KLL A;  4OJ6 A;  3DV9 A;  4OJ5 A;  3RRG A;  4ECY A;  3TAD C;  4BXO B;  2Y9T A;  5ALY A;  2WFA A;  5AIC A;  4Y2V A;  4R8U B;  2HHT A;  3ONN A;  3TAR A;  1A0P A;  1DK3 A;  4G3I A;  2HHX A;  4DEZ A;  1XO0 A;  5KFI A;  3EUB 2;  1ZQ1 C;  3HJE A;  3PY8 A;  3GIJ A;  1JUD A;  1SV4 A;  1GO3 F;  5HP4 A;  4DS4 A;  8ICM A;  4DL3 A;  2VA8 A;  3KHR A;  4F5R A;  4M6W A;  1ZQE A;  3RR7 A;  7ICT A;  1QSS A;  1KFS A;  3PZP A;  2Q4T A;  4O3M A;  3AUO A;  2C2E A;  1XNS A;  2BCV A;  2V4R A;  3QUB A;  3WKB A;  3THV A;  1T4G A;  2AQ4 A;  5DGA A;  1LKY A;  5G5G A;  2D8C A;  4UAW A;  2DUY A;  4ACO A;  3AU2 A;  9ICL A;  1BPX A;  1L3V A;  2PI5 A;  2GO7 A;  4M9N A;  3K75 D;  5L1I A;  1FIQ A;  1KBU A;  2VJ4 A;  2GH1 A;  4BXO A;  4ED7 A;  2Y1J A;  3LVV A;  5B66 U;  1Z19 A;  2XID A;  2F8L A;  3C21 A;  2DGZ A;  4R8U A;  2KFZ A;  3D6J A;  3HRD D;  4QZA A;  2BQU A;  3B0Y A;  2ASD A;  4F4Z A;  4F5O A;  8ICP A;  4I2H A;  4O0I A;  1N48 A;  4KLT A;  1URJ A;  1YZ6 A;  3R9K A;  8ICL A;  1X66 A;  5DB9 A;  1S0N A;  5AIA A;  1Y88 A;  2W3S A;  4F2R A;  2F76 X;  1ZQD A;  4M2Y A;  1S0V A;  4CDG A;  3AEV A;  1ZQN A;  1ZD5 A;  2ISP A;  3C2K A;  2PXI A;  1DGJ A;  3T5K A;  3RJI A;  4ECT A;  3WKC A;  3L5K A;  4UQG A;  2YMM A;  4ECS A;  5JTI A;  3C2L A;  2FI1 A;  1S0M A;  5J0T A;  7ICG A;  4ECW A;  5KT4 A;  4DLE A;  1BPB A;  4P2H A;  4RUA A;  2EAM A;  5CJ7 A;  3MR6 A;  4DO9 A;  8ICG A;  3GIM A;  5KL1 B;  1TV9 A;  1TK8 A;  2HHQ A;  4O3Q A;  1HUZ A;  3C2M A;  2PI4 A;  4KX3 A;  5J0S A;  2XY7 A;  3WK4 A;  4QZB A;  2Z7J A;  5H2F U;  4F4W A;  3ZDC A;  3ZD9 A;  3KZX A;  4PGQ A;  4I2B A;  3OTQ A;  3V7J A;  2B0C A;  3CYM A;  2CRX A;  2KJ8 A;  2CPR A;  2D6F C;  3M9N B;  1FO4 A;  4ECX A;  4TUR A;  3TAQ A;  4I29 A;  5C5J A;  7ICP A;  3DEE A;  1ZQV A;  2JXJ A;  5AI5 A;  2JV3 A;  3SEI A;  5AM2 A;  4B6J A;  1PVR A;  2AGQ A;  9ICE A;  4RQ5 A;  2W11 A;  3QE9 Y;  5ALZ A;  3Q8S B;  3QUQ A;  1YZ7 A;  2V4Q A;  1NK4 A;  2IOH A;  3AN1 A;  4QWD A;  2WF5 A;  2XIC A;  2BHN A;  5ALQ A;  5HR6 A;  4J9R A;  2KIV A;  3M9O B;  2ZIX B;  4ZH4 A;  2PFP A;  8ICB A;  4B9L A;  3ETL A;  4C8N A;  7ICL A;  1RXV A;  3MAB A;  3TI0 A;  1ZQK A;  2ZUB A;  4DQI A;  8ICN A;  9ICS A;  1UT8 A;  4DSK A;  3V6H A;  3G6X A;  2LYA A;  1TAU A;  2W3R A;  4BWM A;  1X9M A;  4RT2 A;  1XC9 A;  4CRX A;  1IM4 A;  1HEK A;  2KSO A;  2UVV A;  9ICN A;  4Z6D A;  2O6K A;  2XI9 A;  3H40 A;  4NM1 A;  4KLQ A;  1D9F A;  3RJH A;  5KG3 A;  1ZQO A;  3PW0 A;  4QZH A;  3G6Y A;  5HHI A;  2KIW A;  2VA2 A;  1Q3U A;  1S77 D;  1EXN A;  3IDW A;  2GOL A;  5J2D A;  4RQ2 A;  3SI8 A;  2C2D A;  9ICG A;  1JI7 A;  1BGX T;  1FFU A;  5KG6 A;  1YT3 A;  1O03 A;  1V85 A;  2FLP A;  2R8G A;  3F2B A;  4ECU A;  3HKZ F;  5ALL A;  3K1R B;  4Q44 A;  1ZQZ A;  4DL6 A;  5D49 A;  3PMN A;  3SZ2 A;  5KAI U;  4M9J A;  2ZIX A;  2AXT U;  4Y2X A;  5KT6 A;  2HOF A;  2PMZ F;  2BCU A;  5AI9 A;  3PX0 A;  3M6K A;  1H38 A;  4DQQ A;  3GDX A;  3GQC A;  5DGB A;  3FDS A;  5DQI A;  2K60 A;  2IBK A;  1MSW D;  1DRG A;  3FM9 A;  1ZD3 A;  2LI6 A;  3PNC A;  2WAQ C;  3RB4 A;  5J0P A;  3KKA A;  3LVW A;  3QNM A;  1ZQF A;  5DDY A;  5KFJ A;  5EOZ A;  4QW8 A;  3KBB A;  2ESE A;  5GTI U;  5KG1 A;  1OXJ A;  2I6X A;  1Z4N A;  1SZP A;  2ZXH A;  1LB2 B;  1KN5 A;  5DG8 A;  3BJY A;  4Q8E A;  4UAT A;  5ALK A;  3RTV A;  3UMC A;  3MC1 A;  1QTM A;  4U7C A;  1N2X A;  2BR0 A;  5GTH U;  3IP4 B;  5J2B A;  4QWC A;  4PZO A;  1QSY A;  7ICR A;  1MQ2 A;  3ISB A;  2R8K A;  2OH2 A;  2JGA A;  2RRD A;  4KLG A;  4MFA A;  3QU2 A;  1DOQ A;  3GIL A;  3BQT A;  2G08 A;  4EZ9 A;  9ICM A;  2BPG A;  5ALJ A;  2KVS A;  2MUT A;  3UXP A;  4NLG A;  2AHO B;  3HW8 A;  4BGD A;  2PKE A;  1ZQI A;  1BNP A;  1CUK A;  2W9B B;  4F8R A;  2RHF A;  5ALN A;  4EYH B;  1SL1 A;  2DKZ A;  4TQS A;  2A1J B;  5J8Y C;  4F91 B;  3PX4 A;  4MHV A;  1NK7 A;  3PR5 B;  9ICT A;  4NL9 C;  3GII A;  1MN8 A;  1K1Q A;  1ZXI A;  1JXL A;  4F3O A;  5AKY A;  4KLM A;  2KTQ A;  1U4B A;  3CRX A;  4UB2 A;  5AKG A;  4J9S A;  5HR7 A;  1RXW A;  2IHN A;  1D8Y A;  1TE2 A;  4DCC A;  4RQ0 A;  4QZC A;  1RQL A;  1NJW A;  8ICI A;  4DSI A;  3KHL A;  2ZJ5 A;  2HHW A;  7ICQ A;  4UAZ A;  3WK5 A;  4IL6 U;  4DF8 A;  1BNO A;  2BPC A;  2ZUC A;  1ZQC A;  3F2D A;  1J2M A;  5DB8 A;  1PUZ A;  3RB0 A;  4F4K A;  9ICK A;  2ZIU A;  1B22 A;  4I2J A;  3NVY A;  3PX6 A;  1OW5 A;  1ZQP A;  4UAU A;  4IQU A;  3HIL A;  2H3Z A;  4J9Q A;  2Y0S C;  2M9N A;  4M04 A;  4RNO A;  4UW9 A;  4DF4 A;  4YR0 A;  1SWV A;  3TAP A;  2FE9 A;  2A1J A;  4RT3 A;  3LK9 A;  9ICJ A;  3AU6 A;  4YXJ A;  3LYS A;  5J2J A;  2VKQ A;  4UAY A;  1T94 A;  4UB4 A;  8ICY A;  2YMQ A;  5J2C A;  4LJX A;  4FE3 A;  4RZR A;  4UB1 A;  2XO7 A;  2OHF A;  4B9M A;  3JPQ A;  2B21 A;  2YML A;  4Y2Y A;  2NV3 A;  4O5E A;  1CEZ A;  2YTU A;  2E3T A;  1JN3 A;  4DS5 A;  2LKY A;  4US8 A;  4Y2U A;  1HJP A;  1WUD A;  5IIJ A;  2W04 A;  2KK0 A;  1SL2 A;  1XSN A;  1HUO A;  3FC4 A;  4KN4 A;  3UXO A;  3ETR A;  9ICB A;  1MQ3 A;  1FFV A;  3WKA A;  1X6I A;  2JH1 A;  3PML A;  3RF9 A;  5L1J A;  2ZIV B;  1TK5 A;  1SKR A;  1JMS A;  3BQ7 A;  4JV2 A;  1ZOL A;  2J6S A;  3BDP A;  1V97 A;  3ZDB A;  9ICO A;  2H3Q A;  3JPS A;  5DDM A;  5BOL A;  4K4I A;  2XY6 A;  3ISD A;  5DBC A;  4RU9 A;  4RQM A;  4RPX A;  2QAR B;  4RQN A;  5ALM A;  1BPY A;  3MGV A;  2H3I A;  2W43 A;  5DBB A;  3S6J A;  1S10 A;  5KT3 A;  4ELV A;  2JEG A;  1F0M A;  4EX7 A;  1B43 A;  4I2D A;  4K4G A;  4YD2 A;  1NZP A;  3H0L B;  3PSI A;  4DQR A;  5ALG A;  1QLN A;  4NY8 A;  3B9J A;  2XY5 A;  4YP3 A;  5ALS A;  4EEN A;  1T3N A;  4DQS A;  4R64 A;  3EW9 A;  1ZQT A;  4Y2S A;  3HX0 A;  2K4E A;  3VCB A;  1SXD A;  2ZJA A;  4EBE A;  2EAO A;  2AJQ A;  1O08 A;  4OJO A;  4FBT A;  5JU5 A;  4YR2 A;  1B4F A;  4ED8 A;  7ICF A;  1L8O A;  4DL2 A;  2BQ3 A;  4J9N A;  5J0Q A;  5HMM A;  3N97 B;  3E0F A;  2ZIV A;  1A77 A;  3QEB Z;  3MR3 A;  2LPE A;  4JUZ A;  4F5N A;  1L7N A;  4FZN A;  2R8H A;  2KIC A;  1COK A;  2DKX A;  2W9M A;  4GC6 A;  3H7I A;  4U6P A;  5ALW A;  3SEN A;  2IHM A;  2WF6 A;  2JHD A;  5J2G A;  2OEH A;  4KLU A;  4IQV A;  4C7Y A;  2PFN A;  4NLC A;  4ED1 A;  3RBD A;  5J0O A;  3TFS A;  4C0Z A;  3FYH A;  1UA0 A;  1J97 A;  3SMV A;  1C20 A;  3CP8 A;  3OGU A;  4MEY A;  3WK6 A;  1N56 A;  1MC8 A;  4DFJ A;  2HBM A;  4B9S A;  4PHP A;  5KFC A;  3QYP A;  3Q8P B;  4YMN A;  4PGX A;  1ZQJ A;  2OYY A;  4F92 B;  2MAX A;  5F9L A;  1NK6 A;  1MA7 A;  8ICH A;  2W7P A;  4AP9 A;  3C1Y A;  2DWQ A;  2HBJ A;  2C22 A;  2L5Y A;  3WU2 U;  3OJS A;  2JRZ A;  3QUC A;  2RDI A;  1DK2 A;  5AI0 A;  1ZQQ A;  1XS9 D;  5AK5 A;  5AKI A;  1RQN A;  9ICX A;  2FPK A;  2C2R A;  3O0F A;  2H3V A;  4M47 A;  5KFA A;  3HWT A;  1Z3E B;  3C23 A;  1NKC A;  4DWI A;  5DQG A;  4Q45 A;  2ZUD A;  4YN4 A;  1ZQM A;  3D2Q A;  3ALR A;  3NGD A;  4UB6 U;  4RPZ A;  5KFB A;  5AKX A;  2R8J A;  1RPL A;  2HHV A;  4EEL A;  1L3T A;  3OPX A;  4AYB C;  2KFN A;  1IG6 A;  2P66 A;  2NRW A;  1LV5 A;  1S97 A;  2KZ3 A;  3EYZ A;  3GV7 B;  8ICU A;  9ICU A;  2K8A A;  5L1L A;  4C8O A;  2G5I B;  5AM1 A;  1QSL A;  4B9T A;  3PO5 A;  3SQI A;  3PVX A;  5EE9 A;  3WKE A;  8ICF A;  1X6J A;  1SZH A;  2WTF A;  4RNN A;  1JX4 A;  3F2C A;  4GC7 A;  3IG8 A;  4I2A A;  4M0A A;  3PST A;  1SIJ A;  4O5C A;  2KD1 A;  2YQE A;  2W55 A;  4Y2R A;  1V9P A;  4YFK A;  5CP2 A;  1NKE A;  1KRP A;  5AKJ A;  4ECR A;  5KFN A;  2VA3 A;  4JWN A;  4I2F A;  3T5H A;  1NOM A;  1PVQ A;  2KN7 A;  4EZ6 A;  1S76 D;  3BQ2 A;  4O3N A;  2ISO A;  2I5H A;  5J0W A;  5G5H A;  4JV0 A;  3AQE A;  3QUT A;  4QIW F;  5DQH A;  4DOA A;  1WYG A;  3NAS A;  4OCZ A;  2FLN A;  5EWG A;  1F44 A;  2WAQ F;  2HBK A;  2VJ5 A;  4IR1 A;  5EWE A;  1KKX A;  3GZF A;  1RZT A;  4YVZ A;  3RJK A;  5ALX A;  5DG7 A;  4O3S A;  1TVA A;  4P0Q B;  2BKE A;  9ICF A;  1D8L A;  3F5A A;  3OHB A;  1TAM A;  3GIK A;  1AQ6 A;  2HHU A;  3LDA A;  2JR5 A;  2HBL A;  1L7M A;  3NRW A;  5AM5 A;  3IHQ B;  3M1Y A;  5ALV A;  4J9M A;  4HYK A;  2HVI A;  9ICC A;  2ASJ A;  5J29 A;  4DSE A;  4IRC A;  3UQ2 A;  4M9H A;  1SKW A;  4EBC A;  5AM3 A;  9ICW A;  4IRK A;  2P35 A;  4DOB A;  4EBD A;  3D2S A;  1ARO P;  2VIX A;  4Q43 A;  3ZDD A;  7ICK A;  4QWE A;  2ZXI A;  5AK3 A;  1WWV A;  3C1Z A;  3ZI4 A;  5III A;  1V38 A;  2KMD A;  1Z00 B;  4FZL A;  4USA A;  5J0Y A;  2HW3 A;  4RNM A;  4WJ3 B;  2JMG A;  2ZIW B;  2G5H B;  4I28 A;  3BS5 B;  4P0P B;  2KZM A;  3UXN A;  1XO1 A;  3UMB A;  4RPY A;  2QB0 B;  2F77 X;  2ZJ8 A;  3IG5 A;  4IS7 A;  4O3R A;  2AH5 A;  4Z6E A;  5CB1 A;  4CF3 A;  1L5U A;  4BWJ A;  3PSP A;  4GIB A;  4QIW C;  4FS2 A;  3TAC B;  5DB7 A;  5F9N A;  4QJF B;  4J9O A;  4F50 A;  2QLT A;  2I9G A;  3M6Z A;  3ZDE A;  5ALR A;  3BQ0 A;  1COO A;  2E8M A;  1T3Q A;  2FJ6 A;  1ZQR A;  1SXE A;  5KT2 A;  5IIM A;  4UAR A;  2FLL A;  5AHX A;  1BVS A;  4KLJ A;  2NRT A;  5CEH A;  2RP5 A;  2H5X A;  5CWR A;  2OCE A;  2AGO A;  4FFD A;  3WK7 A;  4UB5 A;  5DLG A;  3T79 A;  3NS1 A;  1BPE A;  4CGZ A;  1TFR A;  1RYU A;  3TFR A;  2VAN A;  5HML A;  1TKD A;  2HDO A;  2XC9 A;  4CF5 A;  2JEF A;  1X2I A;  2E1F A;  1Q3V A;  1VDV A;  2P6U A;  3M8R A;  4EEY A;  2ZIW A;  3AM9 A;  1SKS A;  2YX8 A;  3UQ0 A;  4P0P A;  8ICJ A;  2C28 A;  5FP0 A;  2EZZ A;  3RJF A;  3UPQ A;  4DSF A;  1U47 A;  2K4I A;  4R66 A;  4I2C A;  1JRO A;  3UM9 A;  2Y0S F;  2QB0 A;  2LM4 A;  4KX5 A;  5T14 A;  4NLB A;  2KHQ A;  4QZI A;  2YB1 A;  5KFT A;  4DSL A;  5KFL A;  2BGW A;  4ED2 A;  3I76 A;  4PH5 A;  3AL0 B;  3ISC A;  2DFL A;  3JPR A;  2UVU A;  4PHE A;  3PW2 A;  5KFP A;  5KFR A;  1NNL A;  4C4S A;  1ZQX A;  3TAN A;  2ES6 A;  5J2E A;  5J2A A;  5B5E U;  4F5Q A;  3AMZ A;  3T3F A;  4KLS A;  1ZYQ A;  3NVV A;  4Y2Q A;  5BPC A;  5AK4 A;  5KL8 B;  1ZRM A;  1DGS A;  1PZN A;  4YQW A;  4RQ7 A;  1Q8K A;  5CHG A;  1Q46 A;  4NLK A;  3D2N A;  2JH7 A;  2ODG A;  2LBO A;  3C29 A;  4UAV A;  4Z6C A;  5AKK A;  4F72 A;  1IV8 A;  4F4X A;  4XRH A;  4PGY A;  3QZ7 A;  1WCN A;  4MFF A;  3WK9 A;  2NRX A;  2DQN B;  2HMX A;  2IMW P;  1ZET A;  5KT7 A;  3KZI U;  1L3S A;  1A6S A;  4I2E A;  3V72 A;  2EQY A;  3KKA C;  2FMQ A;  3BQ1 A;  5ALT A;  4RQ6 A;  5J2H A;  2KZZ A;  1JIH A;  3CW2 C;  4GFJ A;  5HNK A;  3TAD A;  2W9B A;  2W7O A;  4QW9 A;  5KTQ A;  4XQ8 A;  2W9C B;  1KTQ A;  2KNJ A;  2ZTE A;  5KFW A;  9ICQ A;  5JUM A;  2F1H A;  2HHS A;  3SD7 A;  4OD0 A;  2LM1 A;  1UQV A;  4YG2 A;  5KFY A;  5J0U A;  4DL7 A;  3V6J A;  1ECW A;  5TZV A;  4QZF A;  2XCA A;  3V6K A;  4G9B A;  2ZTD A;  2EAP A;  2KJ5 A;  3IM1 A;  4TUS A;  1ZJM A;  1TK0 A;  1ZD4 A;  2LYH A;  1KQQ A;  4M9G A;  3EPI A;  1RYR A;  2YB4 A;  1NK5 A;  7ICM A;  1L7O A;  4QNL A;  1KEJ A;  2UVW A;  2P6R A;  7ICH A;  2MA1 A;  3ORY A;  5DG9 A;  1ZQY A;  3NUQ A;  4Y2P A;  1K5O A;  1C7Y A;  1XSL A;  3GV8 B;  2G06 A;  2OWO A;  3RFA A;  5AI8 A;  4EYI B;  1T8E A;  1KW4 A;  2K8B B;  3RRH A;  1X9W A;  5KG4 A;  1JXE A;  2XGQ A;  4JK1 A;  4NLN A;  4PL1 A;  2HOI A;  3WKD A;  1ZQA A;  3OJU A;  5C0Y A;  4LVS A;  3N4M B;  7ICV A;  5J2I A;  3H4D A;  4JWM A;  3M7D A;  4C4R A;  4O3O A;  2BCQ A;  2W8L A;  2XCP A;  1Z1V A;  2R8I A;  2HOQ A;  1CI4 A;  1N5X A;  8ICT A;  4BUG A;  2WF8 A;  2LMR A;  5JRT A;  3C28 A;  4FS1 A;  2CN1 A;  2KEY A;  4C80 A;  3NTU A;  4OJP A;  1N60 A;  4PHA A;  4MF2 A;  3MDA A;  1LKY B;  3T5L A;  5KFZ A;  5KFU A;  4R63 A;  2F1I A;  2KKV A;  3HPO A;  3Q8L A;  3N28 A;  4Y2T A;  4BJQ A;  3U26 A;  2W03 A;  2HSZ A;  1NJY A;  2KVC A;  3GFK B;  1KFT A;  3A0H U;  4YCX A;  5IIK A;  2XGP A;  1IIP A;  5KFH A;  3C5F A;  3QXG A;  1SV0 C;  2W54 A;  2WB1 C;  4HAI A;  1L8L A;  4KLF A;  3H0M B;  2BCR A;  5EE1 A;  1UHU A;  3MGH A;  3Q8K A;  9ICR A;  2QKQ A;  3QU7 A;  4J9P A;  4CE6 A;  5KFV A;  4IQW A;  4XUS A;  3H8M A;  4IRD A;  2F3N A;  2ZG6 A;  4AYB F;  3RB3 A;  4O3P A;  1CRX A;  5EWF A;  3JPT A;  1N5W A;  5KFQ A;  2EH9 A;  5BOM A;  2KHV A;  1S9F A;  4F5P A;  1NJZ A;  5TIS U;  4ED6 A;  2MSN A;  4DOC A;  2K8C B;  3HT3 A;  3N7R C;  4DFD A;  2QAR A;  5CA7 A;  2F2A B;  4TQR A;  2FMS A;  8ICS A;  3GV5 B;  1NZB A;  3PW4 A;  2R18 A;  2F8K A;  5KFS A;  4J9K A;  3K4G A;  3TQ1 A;  5CRX A;  2AQ0 A;  3OSN A;  3SAG A;  2FMP A;  4F2S A;  2N1R A;  5CR0 A;  7ICU A;  5EE3 A;  8ICA A;  2WF9 A;  4DLG A;  1WCL A;  5KG5 A;  1PK1 B;  1RDF A;  2QB1 A;  2ASL A;  3NVZ A;  4ED0 A;  1ZQG A;  5ALP A;  2IOF A;  1T7P A;  4MFC A;  3M8S A;  1DXS A;  2A19 A;  4OO1 J;  3MGI A;  2OM6 A;  4ICA A;  5ALD A;  4O5K A;  4YMO A;  1L3U A;  3RH5 A;  2H3F A;  4KLI A;  4RUC A;  2G09 A;  4TUP A;  1NI3 A;  2JEJ A;  1ZQL A;  2NRV A;  1QQ7 A;  1X9S A;  4OJL A;  5F3X B;  3SAF A;  2BDU A;  2GLE A;  1JRP A;  1KL9 A;  9ICV A;  1BPD A;  1ZD2 P;  3I28 A;  3KD3 A;  5J0X A;  4QZ8 A;  4X5V A;  2Q0Z X;  1VLB A;  4KLO A;  3H4B A;  2DPJ A;  3VC8 A;  3MDC A;  2W8K A;  1D8B A;  5E79 U;  5DB6 A;  3Q8R B;  3L3F X;  3OHA A;  5KT5 A;  5D46 A;  4KLE A;  5HHH A;  1ZQS A;  1N61 A;  8ICO A;  2G0A A;  2WHE A;  1PK1 A;  3JPN A;  1ZQU A;  2K89 A;  4LZG A;  4PHD A;  4I2G A;  8ICR A;  2DPI A;  2KSO B;  2E5S A;  2Y1I A;  2NRZ A;  2A3V A;  3EZ5 A;  5D4B A;  2FPL A;  3RBE A;  4FO6 A;  4XA5 A;  3NRZ A;  5A0L A;  7ICN A;  2EZX A;  2KP7 A;  4RQ8 A;  3KTQ A;  2B6G A;  4BDP A;  2KG5 A;  1XWL A;  3LWL A;  4DFK A;  2BDP A;  3V7K A;  3OSP A;  1IXR A;  4RQ4 A;  4GLX A;  4C8K A;  3SV4 A;  3NVW A;  3Q8M A;  5KFG A;  2E8O A;  4JV1 A;  4KLH A;  1WG8 A;  4UB8 U;  5L1M A;  1B0X A;  4PJ0 U;  2I1Q A;  1SL0 A;  1S0O A;  4IR9 A;  2J6U A;  4NM2 A;  5AKL A;  4ELU A;  8ICE A;  4NJ8 A;  4F93 B;  4CCH A;  3H0R B;  2BPF A;  4TUQ A;  3ZDA A;  3RAX A;  4NV0 A;  1Z1B A;  4IQT A;  9ICI A;  2D3D A; 
#chains in the Genus database with same CATH homology
 4KN4 A;  3B0Y A;  2ASD A;  3ISC A;  2DFL A;  3UXO A;  4GXJ A;  4F4Z A;  3JPR A;  9ICB A;  4F5O A;  2UVU A;  4PHE A;  1NK0 A;  8ICP A;  3B0X A;  3PW2 A;  1MQ3 A;  5IIN A;  4I2H A;  5KFP A;  4O0I A;  5KFR A;  1N48 A;  3RJG A;  1ZQX A;  3TAN A;  3PML A;  4YMM A;  4YD1 A;  4KLT A;  3QEA Z;  3RB6 A;  4KIT B;  5L1J A;  5J2E A;  2BCS A;  8ICL A;  1TK5 A;  5DB9 A;  5J2A A;  1S0N A;  4F5Q A;  1SKR A;  2PFO A;  1JMS A;  9ICH A;  4JV2 A;  8ICZ A;  3T3F A;  1Y88 A;  4F4Y A;  4KLS A;  1ZYQ A;  2J6S A;  3BDP A;  1U49 A;  5BPC A;  4F2R A;  3ZDB A;  1ZQD A;  3PO4 A;  4M2Y A;  1S0V A;  2ALZ A;  9ICO A;  1ZQN A;  3RR8 A;  1UA1 A;  4KN7 A;  2ISP A;  3C2K A;  1DGS A;  1PZN A;  3JPS A;  2PXI A;  5DDM A;  5BOL A;  4YQW A;  4RQ7 A;  3T5K A;  3RJI A;  4K4I A;  2XY6 A;  4ECT A;  3ISD A;  5CHG A;  5DBC A;  4DFM A;  4RU9 A;  4UQG A;  4ECS A;  4NLK A;  1TAQ A;  3C2L A;  1S0M A;  8ICQ A;  5J0T A;  4RPX A;  4GXI A;  7ICG A;  4ECW A;  5KFM A;  5KT4 A;  5IIL A;  4DLE A;  1XSP A;  4Z6C A;  3JPO A;  1BPY A;  4LZD A;  3HP6 A;  1BPB A;  4QZE A;  4FBU A;  9ICA A;  2FPM A;  5DBB A;  4F4X A;  4P2H A;  4XRH A;  1NK8 A;  1S10 A;  4RUA A;  5KT3 A;  4PGY A;  3QZ7 A;  2JEG A;  4ELV A;  1B43 A;  1WCN A;  5CJ7 A;  4MFF A;  4I2D A;  2NRX A;  2IMW P;  3E2E A;  3MR6 A;  4DO9 A;  2ZTC A;  1ZET A;  5KT7 A;  4K4G A;  8ICG A;  4YD2 A;  3GIM A;  1L3S A;  4DQR A;  4I27 A;  1TV9 A;  1QLN A;  4I2E A;  1TK8 A;  4UB3 A;  3V72 A;  2HHQ A;  4NY8 A;  1U48 A;  4O3Q A;  2XY5 A;  4YP3 A;  3C2M A;  1HUZ A;  1T3N A;  2PI4 A;  4DQS A;  5J0S A;  2FMQ A;  3BQ1 A;  4R64 A;  2XY7 A;  3EW9 A;  4RQ6 A;  4QZB A;  1ZQT A;  5J2H A;  4F4W A;  3ZD9 A;  3HX0 A;  3ZDC A;  2KZZ A;  4PGQ A;  1JIH A;  3MR5 A;  2MUT B;  4I2B A;  2V9W A;  2ZJA A;  4EBE A;  4QZG A;  3V7J A;  2AJQ A;  5HNK A;  4ECZ A;  4FBT A;  2W9B A;  8ICX A;  3M9N B;  4YR2 A;  1ZQB A;  4QW9 A;  4ECX A;  4TUR A;  4ED8 A;  5KTQ A;  7ICF A;  3TAQ A;  5J2F A;  4DL2 A;  4I29 A;  2BQ3 A;  4J9N A;  5C5J A;  5J0Q A;  4ECV A;  1ZQH A;  2J6T A;  4PPX A;  4XQ8 A;  7ICP A;  5HMM A;  1ZQV A;  2W9C B;  3N97 B;  3SV3 A;  1KTQ A;  5KFW A;  2ZTE A;  1NJX A;  9ICQ A;  1A77 A;  3QEB Z;  3MFH A;  1KDH A;  4RQ1 A;  5JUM A;  3MR3 A;  2F1H A;  2HHS A;  4QWA A;  4JUZ A;  4F5N A;  2R8H A;  2AGQ A;  9ICE A;  1KFD A;  2W9M A;  4RQ5 A;  3QE9 Y;  3PR4 A;  3Q8S B;  4GC6 A;  4YG2 A;  5KFY A;  5J0U A;  4DL7 A;  4P4M A;  3V6J A;  4ED3 A;  2V4Q A;  1NK4 A;  1Z00 A;  3PW5 A;  3H7I A;  4B9U A;  5TZV A;  4QZF A;  4QWD A;  2XCA A;  2IHM A;  3MR2 A;  3V6K A;  4Z6F A;  1XU4 A;  5KFO A;  5DLF A;  2ZTD A;  2BHN A;  4ECQ A;  3IM1 A;  4TUS A;  4J9R A;  5J2G A;  1ZJM A;  4KLU A;  3M9O B;  1TK0 A;  4IQV A;  2LYH A;  4ZH4 A;  2PFP A;  8ICB A;  4B9L A;  3ETL A;  2PFN A;  4C8N A;  4M9G A;  7ICL A;  4P4P A;  4ED1 A;  1RXV A;  3EPI A;  3RBD A;  5J0O A;  1RYR A;  3TFS A;  3H8W A;  3MAB A;  2PFQ A;  1NK5 A;  7ICM A;  3FYH A;  3TI0 A;  1UA0 A;  2ZUB A;  1ZQK A;  4DQI A;  8ICN A;  9ICS A;  1KEJ A;  1UT8 A;  2UVW A;  2P6R A;  3V6H A;  4DSK A;  4KLD A;  7ICH A;  3G6X A;  3OGU A;  3ORY A;  5DG9 A;  1ZQY A;  4MEY A;  1C7Y A;  1TAU A;  1N56 A;  1MC8 A;  1XSL A;  3GV8 B;  3SYZ A;  4DFJ A;  4B9S A;  4BWM A;  4PHP A;  1X9M A;  5KFC A;  3Q8P B;  4RT2 A;  1XC9 A;  4YMN A;  4PGX A;  4B9V A;  1U45 A;  4KMU A;  1ZQJ A;  4C8L A;  2OWO A;  4F92 B;  1IM4 A;  3RH4 A;  2MAX A;  2UVV A;  9ICN A;  4K4H A;  5F9L A;  4Z6D A;  1NK6 A;  3H40 A;  4KLQ A;  4NM1 A;  8ICH A;  3MFI A;  1D9F A;  3C1Y A;  4EYI B;  1ZJN A;  3RJH A;  1T8E A;  4YXM A;  5KG3 A;  3PW0 A;  3RRH A;  2C22 A;  2AGP A;  1ZQO A;  4DSJ A;  1X9W A;  2JEI A;  4QZH A;  5KG4 A;  4GXK A;  3T5J A;  1JXE A;  3OJS A;  5KFK A;  2XGQ A;  4JK1 A;  5HHI A;  3G6Y A;  4NLN A;  2JZB B;  2VA2 A;  1ZQA A;  2RDI A;  3OJU A;  4RQ3 A;  1S77 D;  1EXN A;  1ZQQ A;  2AU0 A;  4LVS A;  1XS9 D;  3N4M B;  3JPP A;  9ICX A;  7ICV A;  5J2I A;  3H4D A;  4JWM A;  4R65 A;  2FPK A;  4O3O A;  3ZD8 A;  5J2D A;  4RQ2 A;  3SI8 A;  2C2R A;  5KFF A;  2BCQ A;  3KHH A;  5KFA A;  2C2D A;  4M47 A;  9ICG A;  2W8L A;  1BGX T;  2XCP A;  2R8I A;  3HWT A;  5IIO A;  1Z3E B;  3C23 A;  5KG6 A;  1NKC A;  4DWI A;  8ICT A;  5DQG A;  2FLP A;  2R8G A;  7ICO A;  4Q45 A;  3G6V A;  2ZUD A;  4YN4 A;  4ECU A;  5L1K A;  8ICW A;  1ZQM A;  4Q44 A;  1ZQZ A;  4DL6 A;  5D49 A;  3NGD A;  4FS1 A;  3PMN A;  3SZ2 A;  3PW7 A;  4RPZ A;  4Q8F A;  5KFB A;  2R8J A;  1RPL A;  3NTU A;  1RYS A;  2HHV A;  1L3T A;  4M9J A;  4PHA A;  3EPG A;  4MF2 A;  2KFN A;  3MDA A;  5J0R A;  2P66 A;  7ICI A;  3RAQ A;  5DBA A;  2NRW A;  3T5L A;  5KFZ A;  1LV5 A;  5KFU A;  3H8J A;  5KT6 A;  4R63 A;  2F1I A;  3LWM A;  3HPO A;  4QZD A;  3Q8L A;  2BCU A;  1S97 A;  2KZ3 A;  3EYZ A;  1A76 A;  1NJY A;  3PX0 A;  1KSP A;  3GV7 B;  3GFK B;  1H38 A;  4DQQ A;  8ICU A;  1KFT A;  4YCX A;  4J9L A;  4DL5 A;  9ICU A;  3GDX A;  3GQC A;  5IIK A;  5DGB A;  2XGP A;  5L1L A;  1NKB A;  4C8O A;  3FDS A;  5KFH A;  1QSL A;  4B9T A;  3C5F A;  5DQI A;  3PO5 A;  3PVX A;  1U9L A;  2IBK A;  1MSW D;  5KFD A;  2ATL A;  8ICF A;  4UBC A;  2WTF A;  4RNN A;  4KLF A;  1JX4 A;  2BCR A;  3V7L A;  4GC7 A;  3MGH A;  3PNC A;  3Q8K A;  4I2A A;  4M0A A;  9ICR A;  4J9P A;  3RB4 A;  5KFV A;  3RJJ A;  5J0P A;  4IQW A;  4O5C A;  4XUS A;  4IRD A;  3RB3 A;  4O3P A;  5DKW A;  9ICP A;  5EWF A;  1V9P A;  2JZB A;  5KFX A;  5CP2 A;  4YFK A;  5KFQ A;  3JPT A;  1NKE A;  1ZQF A;  4QWB A;  5DDY A;  5KFJ A;  3KHG A;  5EOZ A;  1KRP A;  4QW8 A;  5KFN A;  5BOM A;  4ECR A;  2VA3 A;  5KG1 A;  1BPZ A;  4JWN A;  4I2F A;  3T5H A;  7ICJ A;  1S9F A;  4F5P A;  1NJZ A;  1NOM A;  2KN7 A;  4EZ6 A;  4ED6 A;  1SZP A;  1S76 D;  4ELT A;  3BQ2 A;  4O3N A;  2ISO A;  5J0W A;  4DOC A;  3HT3 A;  4DL4 A;  1LB2 B;  4JV0 A;  5DG8 A;  3BJY A;  5DQH A;  4Q8E A;  5KFE A;  5CA7 A;  4DOA A;  4TQR A;  4MF8 A;  2FMS A;  3RH6 A;  8ICS A;  3RTV A;  3Q8Q B;  3GV5 B;  1QTM A;  3PW4 A;  2FLN A;  2BR0 A;  5EWG A;  2F1J A;  5KFS A;  5J2B A;  4J9K A;  3MBY A;  3K4G A;  1KLN A;  4QWC A;  2UVR A;  3TQ1 A;  2AQ0 A;  4UBB A;  1QSY A;  4IR1 A;  4DFP A;  7ICR A;  4P4O A;  5EWE A;  3OSN A;  1MQ2 A;  1UT5 A;  8ICV A;  5KG2 A;  1RZT A;  2FMP A;  4YVZ A;  8ICC A;  3ISB A;  7ICE A;  3RJK A;  2R8K A;  5CR0 A;  4F2S A;  5DG7 A;  4KLG A;  4O3S A;  1TVA A;  7ICU A;  2BKE A;  4QZ9 A;  4MFA A;  1D8L A;  3M9M B;  2W9A A;  9ICF A;  8ICA A;  4M9L A;  3OHB A;  4O9M A;  4DLG A;  1DOQ A;  3GIL A;  2GWS A;  8ICK A;  3BQT A;  3GIK A;  1WCL A;  4E0D A;  5KG5 A;  4EZ9 A;  2ASL A;  9ICM A;  3QZ8 A;  2BPG A;  4B9N A;  2HHU A;  4ED0 A;  3LDA A;  1ZQG A;  2MUT A;  3UXP A;  4NLG A;  5KG0 A;  4DQP A;  3IHQ B;  3H8S A;  3PV8 A;  1T7P A;  3HW8 A;  3M8S A;  4MFC A;  4BGD A;  4J9M A;  1ZQI A;  1ZQW A;  4HYK A;  2HVI A;  3MGI A;  1CUK A;  9ICC A;  2ASJ A;  5J29 A;  4DSE A;  4IRC A;  3UQ2 A;  5KG7 A;  4M9H A;  1SKW A;  2W9B B;  2W9C A;  4EBC A;  4F8R A;  4KTQ A;  4NLZ A;  9ICW A;  4O5K A;  4IRK A;  4YMO A;  4MEX A;  2RDJ A;  3RH5 A;  1L3U A;  4DOB A;  4M6W B;  4EYH B;  4EBD A;  1SL1 A;  4KLI A;  4RUC A;  4TQS A;  3C5G A;  4TUP A;  2A1J B;  2JEJ A;  1NK9 A;  1ARO P;  1ZQL A;  2NRV A;  2BQR A;  1X9S A;  4Q43 A;  5L9X A;  4NXZ A;  3ZDD A;  7ICK A;  4QWE A;  4F91 B;  3EWA A;  3RJE A;  3C1Z A;  3PX4 A;  5III A;  2HVH A;  4YR3 A;  1Z00 B;  4C8M A;  1NK7 A;  3PR5 B;  9ICT A;  4I2I A;  5J0Y A;  2HW3 A;  4RNM A;  3GII A;  9ICV A;  1D9D A;  1K1Q A;  1BPD A;  1JXL A;  7ICS A;  5J0X A;  4F3O A;  4I28 A;  1K1S A;  2IA6 A;  4KLM A;  4QZ8 A;  3UXN A;  2KZM A;  2KTQ A;  1XO1 A;  1U4B A;  5J2K A;  4X5V A;  4KLL A;  2Q0Z X;  4UB2 A;  4RPY A;  4KLO A;  3H4B A;  2ZJ8 A;  2DPJ A;  3MDC A;  4O3R A;  2W8K A;  3RRG A;  4J9S A;  4Z6E A;  4ECY A;  5CB1 A;  5DB6 A;  4BXO B;  3Q8R B;  1RXW A;  1L5U A;  3OHA A;  4BWJ A;  2IHN A;  5KT5 A;  5D46 A;  4KLE A;  5HHH A;  1D8Y A;  1ZQS A;  8ICO A;  4RQ0 A;  4R8U B;  4QZC A;  4FS2 A;  2HHT A;  3JPN A;  1ZQU A;  3TAR A;  5DB7 A;  5F9N A;  1NJW A;  4F50 A;  4J9O A;  4LZG A;  8ICI A;  4DSI A;  4PHD A;  3KHL A;  2I9G A;  4G3I A;  4I2G A;  2ZJ5 A;  2HHX A;  4DEZ A;  3ZDE A;  2HHW A;  8ICR A;  4UAZ A;  7ICQ A;  3BQ0 A;  5KFI A;  2DPI A;  4DF8 A;  1COO A;  2Y1I A;  2BPC A;  2NRZ A;  2ZUC A;  1ZQC A;  3PY8 A;  1ZQR A;  5KT2 A;  5DB8 A;  5IIM A;  3RB0 A;  3GIJ A;  4F4K A;  2FLL A;  9ICK A;  1B22 A;  3EZ5 A;  4I2J A;  5D4B A;  2FPL A;  3PX6 A;  1BVS A;  1ZQP A;  4KLJ A;  5HP4 A;  4IQU A;  2NRT A;  4J9Q A;  4DS4 A;  3RBE A;  8ICM A;  4FO6 A;  2M9N A;  2VA8 A;  3KHR A;  4XA5 A;  4RNO A;  4F5R A;  4DL3 A;  4M04 A;  2H5X A;  5CWR A;  2AGO A;  4M6W A;  1ZQE A;  3RR7 A;  4UB5 A;  5DLG A;  4DF4 A;  7ICT A;  4YR0 A;  7ICN A;  1BPE A;  3TAP A;  4RQ8 A;  2A1J A;  1QSS A;  3KTQ A;  4RT3 A;  3LK9 A;  1KFS A;  4BDP A;  9ICJ A;  1TFR A;  3AU6 A;  1XWL A;  4YXJ A;  3LWL A;  4DFK A;  2BDP A;  3V7K A;  3TFR A;  5J2J A;  2VAN A;  3AUO A;  5HML A;  1TKD A;  3OSP A;  1IXR A;  4RQ4 A;  2XC9 A;  4GLX A;  4UAY A;  2C2E A;  2BCV A;  4UB4 A;  2V4R A;  2JEF A;  1X2I A;  8ICY A;  5J2C A;  4C8K A;  3SV4 A;  3THV A;  1T4G A;  2AQ4 A;  5DGA A;  3Q8M A;  2P6U A;  3M8R A;  4EEY A;  4RZR A;  4UB1 A;  5KFG A;  2XO7 A;  4JV1 A;  1SKS A;  4KLH A;  4UAW A;  4B9M A;  3JPQ A;  2B21 A;  3AU2 A;  3UQ0 A;  4O5E A;  1CEZ A;  8ICJ A;  9ICL A;  2C28 A;  1SL0 A;  3RJF A;  2I1Q A;  3UPQ A;  4DSF A;  1U47 A;  1S0O A;  1L3V A;  1BPX A;  4R66 A;  2PI5 A;  4I2C A;  4IR9 A;  1JN3 A;  4M9N A;  2J6U A;  4NM2 A;  3K75 D;  4ELU A;  4DS5 A;  8ICE A;  4F93 B;  5L1I A;  4CCH A;  1HJP A;  4BXO A;  5IIJ A;  4ED7 A;  4QZI A;  2Y1J A;  5KFT A;  2BPF A;  5KFL A;  4DSL A;  4TUQ A;  3ZDA A;  2BGW A;  3RAX A;  4ED2 A;  3C21 A;  1SL2 A;  4R8U A;  2KFZ A;  4PH5 A;  1XSN A;  4IQT A;  1HUO A;  9ICI A;  4QZA A;  2BQU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...