2AQ0A

Solution structure of the human homodimeric dna repair protein xpf
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
84
structure length
84
Chain Sequence
MDSETLPESEKYNPGPQDFLLKMPGVNAKNCRSLMHHVKNIAELAALSQDELTSILGNAANAKQLYDFIHTSFAEVVSKGKGKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA repair endonuclease XPF
publication title The HhH domain of the human DNA repair protein XPF forms stable homodimers
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna repair, hydrolase
total genus 20
structure length 84
sequence length 84
chains with identical sequence B
ec nomenclature ec 3.1.-.-:
pdb deposition date 2005-08-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2aq0A00
3MFHA 8ICLA 2F1JA 2V9WA 3RBEA 1RYSA 1ZQNA 5DDYA 4NM2A 5KFUA 4YR0A 1ZQBA 7ICPA 3T5KA 3UPQA 1D8YA 2HHVA 4DO9A 4KLFA 3B0YA 1WCNA 3PX4A 4IQVA 4EYIB 1KRPA 2ZTEA 7ICMA 4XUSA 5KG4A 2MAXA 1XO1A 1NJYA 4KLEA 9ICOA 2ZUBA 3ZD9A 4LVSA 4BXOB 3GIIA 3RRHA 4QZBA 3UXPA 4UBBA 4NLNA 1AROP 3MDCA 4F91B 7ICKA 4DFJA 3H40A 5F9LA 5D49A 4YP3A 3V6KA 3N4MB 1ZJNA 1MQ2A 4ECVA 4PGYA 2BR0A 8ICYA 4MFCA 5KFWA 5KFJA 2NRTA 3ETLA 4ECYA 4IR1A 2VA2A 1B22A 4IQUA 1KEJA 3T5JA 1NJZA 1KFSA 2R8GA 5TZVA 2AGPA 2BGWA 2KZ3A 2C2DA 1ZQOA 5EWGA 3G6YA 3C2MA 2JEFA 4KLJA 9ICJA 4BDPA 2J6TA 1T3NA 7ICUA 3IHQB 4O3PA 5KT6A 3OSNA 5J2DA 1XU4A 3H8JA 3TI0A 3KHRA 3SV4A 4M6WB 3V6HA 1ZQHA 3V7JA 8ICFA 3B0XA 1BPDA 3OHBA 4P4OA 2ISOA 2DPIA 1BGXT 2FLPA 4UQGA 3GIKA 4GXKA 3C21A 1ZQSA 5CWRA 5DGBA 3N97B 1RZTA 3ZDAA 5KG3A 5CJ7A 5KFOA 2ASDA 1NJWA 2W8LA 3SV3A 1T8EA 4DQSA 8ICUA 9ICVA 4J9PA 5DBBA 4JK1A 9ICRA 3M9NB 3M8RA 5HHHA 4I2HA 4I2DA 4DS5A 4F4KA 3TFRA 4Q8EA 2FLNA 5BOMA 4J9QA 4UB3A 4DQRA 4YMMA 2RDJA 2FLLA 4M0AA 3LWMA 5KG5A 2XC9A 3Q8PB 4ELTA 3EWAA 4I29A 4B9MA 1DOQA 9ICTA 4GC6A 4DWIA 4UAZA 4QWBA 5DGAA 2MUTB 4NM1A 1QLNA 2V4RA 5KFDA 5KG0A 5L1KA 1RXWA 4EBEA 2BKEA 2FPKA 5KFQA 3PW0A 3RAXA 4MFAA 1JIHA 1NK4A 3MGIA 9ICMA 3GILA 1RYRA 5J0TA 4QWEA 2W9BB 3Q8LA 1ZETA 4F5OA 4RNOA 4QZCA 3ISDA 3GFKB 2VA3A 2IHNA 4DL7A 4O5CA 4BXOA 1U48A 2FPMA 5HNKA 1U47A 1MQ3A 4DLEA 1N48A 4IRCA 2AU0A 2XCPA 3C2LA 1QSLA 2MUTA 5KT7A 7ICRA 5DB7A 2VANA 4QZGA 3PX6A 1UT8A 1ZQAA 4F5QA 4O3RA 5KFLA 2PFNA 4DLGA 1UT5A 5DB8A 5KFCA 2ZUDA 1WCLA 5HMMA 2R8KA 3RR8A 4QW9A 3BDPA 3PX0A 3G6XA 1D8LA 7ICJA 4R64A 2IMWP 9ICXA 1L3TA 3TAPA 4B9TA 7ICGA 3JPSA 4DSJA 2HHUA 4B9VA 4GLXA 2BQUA 8ICQA 1ZQPA 9ICPA 3MR3A 2PFQA 2XY6A 4C8LA 1ZQDA 3MR5A 4O0IA 3M8SA 2R8HA 4QZIA 4IR9A 3AU2A 8ICZA 1KFDA 9ICBA 5J0SA 1ZQCA 2BQ3A 5J2EA 4DFMA 4ECXA 1RPLA 4QZHA 4J9OA 4GXIA 5CHGA 4ED2A 4FO6A 4YR3A 2NRVA 3PR5B 3PY8A 2KTQA 2KFNA 4RNNA 1COOA 4I2CA 1ZQMA 4DFKA 4Q8FA 1BPBA 1ZQYA 2ZTCA 5DKWA 4YD2A 5DBCA 3PW2A 3EZ5A 4RUAA 4ED8A 3THVA 3PO5A 4M9HA 3TANA 3GIMA 4F8RA 1DGSA 2AQ0A 4UB5A 3RJIA 4I2JA 4DL4A 4YCXA 3ISCA 3MDAA 2C2RA 4O3OA 3H8WA 5KT5A 9ICQA 3JPRA 2ISPA 3QZ8A 4J9RA 1KFTA 5KG6A 2R8IA 4QW8A 8ICCA 5J0UA 9ICFA 4KLQA 4DSLA 1L3UA 4KLGA 4RQ0A 3AU6A 8ICSA 2W9AA 8ICNA 4TUSA 1NKCA 2H5XA 4PHPA 3PW5A 3H4DA 9ICAA 2W9MA 5J2FA 2W9CA 4NLKA 3ZDEA 7ICTA 4XRHA 5KFIA 3MR6A 1NK0A 1MC8A 1BPXA 4RT2A 4DSEA 5DLFA 3PVXA 3RJGA 4TUQA 2C22A 5DQHA 4DF8A 4M04A 3PW7A 4ZH4A 3RJHA 5DG9A 4M9LA 5J0PA 3Q8SB 1TAQA 4KLDA 4O3SA 3GQCA 3ORYA 3LDAA 4KN7A 3RH6A 4ED6A 1S9FA 4DL3A 3JPTA 3HWTA 4J9LA 4RQ8A 1KSPA 3BJYA 1ZJMA 4EEYA 2JEGA 1TVAA 8ICRA 5D46A 3JPQA 3K4GA 8ICEA 2XGQA 1B43A 4YXMA 1BVSA 4RQ5A 2W8KA 4J9NA 2NRWA 3MGHA 1H38A 4NY8A 4RU9A 4ECQA 4QZ8A 4PHAA 3V7LA 4DEZA 4RT3A 1TKDA 2GWSA 4M9JA 4RPYA 3EPIA 4YN4A 5J0OA 4R63A 2FMPA 2JZBB 9ICSA 3T3FA 9ICGA 2FPLA 3AUOA 4O5EA 1TFRA 2NRXA 3TFSA 3EW9A 4DQIA 2BCRA 4EBDA 4UAYA 2IA6A 3MBYA 8ICTA 1ZYQA 4EBCA 4KLOA 7ICHA 2KN7A 1CEZA 1Z3EB 3GV8B 4ECZA 3T5HA 2XO7A 4MEYA 3UQ2A 4DOBA 3RJKA 4KLMA 2AJQA 5EWFA 4RQ6A 1K1SA 4M9GA 3ISBA 5L1JA 1NK8A 2DPJA 4TQSA 1JX4A 9ICUA 1BPEA 2B21A 5IIIA 3RJEA 4J9MA 4DF4A 1NK5A 3H4BA 5D4BA 1IXRA 1ZQIA 3C5GA 4KN4A 4DOCA 5IILA 1JN3A 4FBTA 3KHGA 5IIMA 1QSYA 3IM1A 3JPOA 5KFMA 5KFKA 2ALZA 5F9NA 2JZBA 5DLGA 3BQ2A 4F4YA 4F5PA 3MR2A 1TK0A 4ECSA 3RJJA 3TARA 1C7YA 4QZAA 3RRGA 4YR2A 1S77D 2UVRA 5IIOA 5HP4A 7ICSA 4F92B 1X9SA 5L9XA 4NLZA 9ICIA 5DB9A 4R66A 3Q8MA 2A1JB 1NKBA 8ICWA 8ICXA 4I27A 2Y1JA 4PGQA 4XA5A 2XCAA 4O3QA 5J2JA 3PO4A 3LK9A 1ZQVA 4Z6DA 5L1IA 2BCUA 3Q8RB 8ICHA 3MABA 4PGXA 3GV7B 5J29A 3BQTA 2AGQA 4MFFA 3TQ1A 8ICOA 4DL6A 3GV5B 2DFLA 3V72A 3E2EA 4K4HA 4R8UB 1U49A 2JEIA 2C28A 1IM4A 4YFKA 4RQ2A 7ICOA 3OJSA 1ZQRA 4DSIA 4QZDA 1EXNA 3LWLA 4QZ9A 4ED3A 5DDMA 2A1JA 1ZQJA 3SZ2A 4DS4A 4PHEA 4LZDA 4DQPA 1ZQQA 4IQWA 4ECTA 4F50A 5J2CA 3PMNA 2F1IA 3V6JA 4DL5A 1SKRA 4F2SA 4O5KA 4TQRA 1XSNA 5DBAA 3ZDBA 1LB2B 4NLGA 4JV2A 4DOAA 5EWEA 4KITB 4RNMA 2BQRA 2BCVA 1NK7A 5KT3A 9ICLA 2P6RA 4JV1A 2AQ4A 4UB2A 4UB1A 4B9SA 5KFTA 9ICHA 1CUKA 4BWMA 1D9FA 5HHIA 4Q45A 2PXIA 4R8UA 1NOMA 5KFHA 2W9CB 4ECWA 5KG1A 5IINA 1XSLA 1ZQLA 1JMSA 2UVVA 4ELVA 5KFRA 5J2BA 5J2HA 4J9KA 3RH5A 4E0DA 8ICKA 3H7IA 5KFSA 3K75D 4Z6EA 1SZPA 4C8KA 3FYHA 2HHXA 3C2KA 7ICVA 3KHHA 4QWAA 4P4MA 2LYHA 3PV8A 4FS1A 4I28A 1MSWD 3PR4A 3RJFA 4KLSA 1KTQA 4YG2A 3Q8QB 3HW8A 2PFOA 2PFPA 8ICBA 3OGUA 3PMLA 1NK6A 1JXLA 2FMQA 3KTQA 4QWCA 1T4GA 4GC7A 4PH5A 1SKWA 5J2IA 5KT4A 3NGDA 4I2EA 3RTVA 2HW3A 4R65A 1KDHA 5J0YA 2HHTA 9ICNA 4JV0A 1SKSA 3KHLA 4KLHA 2HHSA 2BPGA 2HHWA 3RB3A 2Q0ZX 4GXJA 8ICAA 2R8JA 5KFZA 3OHAA 1S97A 1U45A 3HX0A 4I2FA 4LZGA 1UA0A 3TAQA 4ELUA 1V9PA 3PNCA 3MFIA 3GIJA 1X9WA 2HVHA 7ICIA 1X2IA 4MF2A 1ZQEA 2F1HA 4O9MA 5BPCA 2IBKA 4YD1A 2KZMA 5KFBA 1ZQWA 4I2BA 1BPYA 4P2HA 3OSPA 2ZJ5A 4RPXA 3V7KA 2J6UA 1S76D 1XC9A 4O3NA 5J2KA 1HUZA 1TK5A 2I1QA 4Q43A 2BDPA 5J0RA 1ZQTA 1HUOA 4HYKA 1S10A 4YMNA 4C8OA 3SYZA 2Y1IA 4K4IA 4C8MA 4KLIA 3BQ0A 4F5RA 2C2EA 4M47A 9ICEA 5KFPA 3HT3A 4I2IA 2UVWA 4YQWA 5DQGA 1NKEA 1QTMA 4KLUA 4RQ1A 5CB1A 4QWDA 1NK9A 3RB4A 2I9GA 3EPGA 3T5LA 8ICMA 1JXEA 8ICIA 3C23A 2NRZA 4P4PA 1BPZA 4BWJA 2ZTDA 3M9MB 5KFNA 4EYHB 4ED0A 4ED1A 5DG7A 1XSPA 1T7PA 4B9LA 3UXOA 4I2GA 2VA8A 1SL1A 5IIJA 2ASJA 2PI5A 5HMLA 9ICCA 3HP6A 2P66A 4IRDA 4RPZA 4DFPA 2IHMA 1TV9A 1S0VA 2J6SA 1UA1A 3EYZA 5JUMA 1ZQFA 4ECRA 2WTFA 3GDXA 1HJPA 4RZRA 1QSSA 3PW4A 1SL2A 2BCSA 4UBCA 4Z6CA 4C8NA 1D9DA 4EZ9A 2BHNA 5KFYA 1ZQGA 1L5UA 4G3IA 2XY5A 1L3SA 1TAUA 4RQ7A 3HPOA 3RH4A 4M6WA 5EOZA 4YMOA 4RUCA 1S0NA 2OWOA 8ICGA 5KG7A 3Q8KA 4UB4A 4F4ZA 1ZQZA 1K1QA 4MF8A 5KFAA 3QEBZ 2BPFA 1X9MA 2KFZA 7ICLA 1U4BA 4DSFA 7ICFA 5KFFA 5C5JA 4F2RA 4B9NA 4F3OA 5CP2A 3BQ1A 4J9SA 4KTQA 5KG2A 3QE9Y 4JUZA 5KFGA 3QEAZ 5J0WA 4JWNA 2HHQA 4UAWA 3ZD8A 3NTUA 5BOLA 4IQTA 2ZUCA 3C1YA 3RB0A 3RAQA 4CCHA 4MEXA 1ZQKA 8ICVA 7ICQA 4RQ3A 1Z00B 1ZQXA 4K4GA 4KLLA 4EZ6A 4QZEA 4NXZA 3FDSA 5J2GA 4KLTA 4Q44A 4FS2A 1NJXA 9ICKA 1ZQUA 4Z6FA 1Y88A 5KFVA 5KTQA 5KT2A 4PHDA 4M2YA 5DQIA 1L3VA 4YVZA 2BPCA 4TURA 3QZ7A 4DQQA 1RXVA 3RB6A 3JPPA 4X5VA 5KFEA 3UXNA 3OJUA 2ASLA 5J0XA 4F5NA 1XS9D 4JWMA 2V4QA 4BGDA 1N56A 2BCQA 2AGOA 2KZZA 4DSKA 2M9NA 2ZJAA 7ICEA 1PZNA 3H8SA 2FMSA 4ECUA 5J2AA 5CR0A 3M9OB 1TK8A 4QZFA 5IIKA 3G6VA 4KMUA 4ED7A 3RBDA 2P6UA 1S0OA 1LV5A 5DB6A 3RR7A 3ZDDA 2UVUA 1Z00A 5KFXA 4YXJA 5L1LA 9ICWA 4FBUA 2W9BA 4I2AA 1A76A 4F93B 4F4WA 1SL0A 2ZJ8A 3C5FA 4B9UA 1U9LA 3SI8A 2HVIA 4RQ4A 1S0MA 2JEJA 1A77A 1XWLA 4TUPA 2XY7A 3C1ZA 4XQ8A 3ZDCA 4F4XA 5J0QA 4M9NA 4DL2A 2RDIA 5CA7A 2PI4A 4IRKA 4PPXA 2XGPA 2ATLA 1KLNA 3UQ0A 8ICJA 3JPNA 7ICNA 8ICPA 5DG8A
chains in the Genus database with same CATH superfamily
4C80A 3MFHA 2V9WA 5DDYA 5KFUA 1ZQBA 5ALSA 4DO9A 3PX4A 4EYIB 2ZTEA 2MAXA 1NJYA 4KLEA 2KHVA 1AROP 2JR5A 4RQNA 5F9LA 4YP3A 1ZJNA 3N4MB 5HR7A 1MQ2A 1X40A 4PGYA 4RQMA 5KFJA 4ACOA 2KSOA 5TZVA 2C2DA 1RQLA 7ICUA 3MGVA 5KT6A 5J2DA 3KHRA 3IRUA 4P4OA 2W04A 2DPIA 2FLPA 4OJ5A 4UQGA 4GXKA 1ZQSA 5CWRA 4Y2UA 5KFOA 2ASDA 2W8LA 1T8EA 2W55A 2NO4A 2MRLA 9ICRA 4DS5A 4F4KA 5BOMA 1SV0C 3DDHA 3LWMA 1QCKA 4Y2QA 2HBJA 1DOQA 1F44A 2CRXA 3QU5A 2MUTB 3K1ZA 5L1KA 2LHTA 1TAMA 2FPKA 3RAXA 2LBOA 3Q8LA 4RNOA 3ISDA 2VA3A 4NJ8A 2AU0A 2XCPA 4O3RA 2VANA 4QZGA 1UT8A 2PFNA 4DLGA 5KFCA 3RR8A 4QW9A 3T79A 3BDPA 1X42A 2YB4A 2LMRA 4B9TA 3JPSA 4DSJA 1QQ6A 1WWUA 2F3NA 4C0ZA 4QZIA 1KFDA 9ICBA 1ZQCA 2BQ3A 4QZHA 2DQNB 3PY8A 2KTQA 4I2CA 4DFKA 4Q8FA 5DBCA 3AQEA 3EZ5A 1X6IA 3F2DA 4ED8A 3TANA 4F8RA 2AQ0A 4I2JA 2K8CB 4O3OA 4EX6A 3QZ8A 2PKEA 8ICCA 4KLQA 4KLGA 2KK0A 8ICSA 5KL8B 3AU6A 2FJ6A 2H3FA 3ZDEA 1XO0A 3MR6A 2JH7A 4PZOA 3PVXA 4TUQA 2C22A 4DF8A 2EAOA 1ZD3A 4OJOA 1RYUA 3I28A 3HWTA 3BJYA 3QX7A 4EEYA 1CI4A 4RQ5A 4RU9A 4ECQA 4QZ8A 4PHAA 3V7LA 2GWSA 3PSTA 2JZBB 5CEHA 1TFRA 3EW9A 2EAPA 3MBYA 3SAFA 8ICTA 4EBCA 7ICHA 2KG5A 4G9BA 2XO7A 2AJQA 3HKZC 1K1SA 3M7DA 5ALVA 5L1JA 3KKAC 4TQSA 1BPEA 4J9MA 5D4BA 1ZQIA 4KN4A 5IILA 1JN3A 1YZ6A 4FBTA 1QSYA 3JPOA 5KFKA 2K89A 5DLGA 4F4YA 2H3IA 4F5PA 4ECSA 1O08A 1C7YA 1S77D 4KX3A 5IIOA 7ICSA 5AKYA 3PSFA 3D2SA 2QARA 2A1JB 5J8YA 2Y1JA 4XA5A 3LK9A 2JRZA 3NS1A 5J29A 3N7PD 5ALTA 1LKYA 2E8PA 4P0QB 2Y0SF 2C28A 1ZQRA 4DSIA 4QZDA 3LWLA 3IG5A 2YQEA 4PHEA 4LZDA 4DQPA 1Q46A 1HEKA 4TQRA 1V85A 4UW9A 4NLGA 3CNHA 5KT3A 2DKZA 2P6RA 4UB2A 1N61A 5HHIA 5KFHA 1ZQLA 5KG1A 1JMSA 4ELVA 3RH5A 1SZPA 3FYHA 4NL9A 2ZIUA 4FS1A 3QYPA 2PFPA 2FMQA 2KIWA 4QWCA 4PH5A 4I2EA 3MC1A 3KHLA 4CRXA 4BJQA 8ICAA 1T94A 5KFZA 1U45A 2LYAA 3TAQA 3PNCA 2YMMA 1X9WA 7ICIA 2HSZA 1ZQEA 2K8BB 5BPCA 2IBKA 4YD1A 5KFBA 1ZQWA 4UB6U 2J6UA 2ZJ5A 2VIXA 2CPRA 5J2KA 2BDPA 1ZQTA 2Y1IA 4K4IA 4KLIA 3BQ0A 4F5RA 2C2EA 3K1RB 5DQGA 1QTMA 1KQQA 1NK9A 5AK6A 2I9GA 3EPGA 8ICMA 2LM4A 5KFNA 4ED0A 5IIJA 2ASJA 2Y9TA 4MHVA 2PI5A 5ALNA 3HP6A 4IRDA 2AHOB 4CE6A 1ZQFA 3GDXA 4RZRA 3CP8A 4UBCA 2XY5A 2O6KA 1TAUA 3TKAA 1SXEA 3HPOA 5ALFA 1OXJA 4YMOA 5KG7A 2KICA 1K1QA 2BPFA 5AI5A 1JALA 2EH9A 3U26A 4J9SA 5ALZA 1L8LA 5AHXA 3WU2U 4EENA 4UAWA 3CRXA 4IQTA 3CYMA 4RQ3A 1Z00B 2K4HA 4KLLA 4EZ6A 2WF6A 5J2GA 1NNLA 1PVRA 4KLTA 3SENA 4PHDA 2BPCA 4X5VA 3UXNA 3OJUA 5ALYA 2V4QA 4BGDA 2M9NA 2ZJAA 1PZNA 3H8SA 3TADC 1VDVA 5AM1A 5J2AA 4QZFA 5DB6A 2UVUA 4YXJA 1N2XA 2OH2A 4B9UA 3SI8A 5C0YA 1S0MA 5GTHU 4XQ8A 3ZDCA 3ETRA 1TE2A 2RDIA 4PPXA 2XGPA 1KLNA 1ED1A 3KBBA 7ICNA 8ICPA 3RBEA 2R18A 1DGJA 4NM2A 4CDGA 7ICPA 4C7ZA 3H0LB 1D8YA 4KLFA 5ALMA 2FI1A 4CF4A 3GIIA 3UXPA 4UBBA 4F91B 7ICKA 3H40A 5D49A 3I1YA 4OD0A 4ECVA 2XIDA 3GZFA 8ICYA 4MFCA 1WYGA 2NRTA 1NJZA 1GO3F 2AGPA 2KZ3A 1UQVA 5EWGA 3G6YA 2JEFA 4KLJA 2J6TA 1T3NA 1ZD5A 3BS5B 5AK3A 3OSNA 3PSIA 3QNMA 2EDUA 3B0XA 2B0CA 3C21A 3L4PA 5DGBA 2KE7A 1ZD2P 5CJ7A 4DQSA 3CW2C 4J9PA 5DBBA 2E8MA 3M9NB 3M8RA 2G07A 4I2DA 5ALQA 3TFRA 3SR6A 2RDJA 2AH5A 2KP7A 5KG5A 1CRXA 3QUCA 4B9MA 4GC6A 2A3VA 4DWIA 4QWBA 5DGAA 4A8EA 3PSPA 1RXWA 4CF5A 3IV6A 2BKEA 2QB1A 2W3RA 5T14A 5KFQA 2GH1A 3PW0A 4NL9C 9ICMA 3SMVA 1RYRA 2YMLA 3NVYA 2NV3A 2G5IB 1ZETA 2WB1F 4QZCA 2IHNA 4O5CA 1MQ3A 3KKAA 4DLEA 4FE3A 3NRZA 2D8CA 7ICRA 5KT7A 2YN4A 4PZNA 2WAQC 5KFLA 5HMMA 4UARA 1N60A 1QQ5A 2HI0A 2PMZF 5AK5A 7ICGA 2HHUA 1Z1VA 3MR5A 4O0IA 2R8HA 4IR9A 3AM9A 5J0SA 5J2EA 3PR5B 2NRVA 4P0QA 2KFNA 3N7RC 1ECWA 3QUTA 1ZQMA 1BPBA 1PK3A 1ZQYA 2KOBA 2ZTCA 5DKWA 4YD2A 5AIAA 2I5HA 3PW2A 1D8BA 4RUAA 3THVA 4M9HA 3GIMA 4UB5A 3MDAA 2HBLA 3JPRA 2OYYA 4J9RA 2VJ5A 4FFDA 2R8IA 5J0UA 4RQ0A 3PW5A 2W9MA 5J2FA 3IP4B 1MN8A 4NLKA 7ICTA 2AXTU 1MC8A 1BPXA 3AMZA 4DSEA 4NWIA 1RM6C 5DQHA 2MU2A 2Q4TA 2KKVA 5J0PA 3Q8SB 4KLDA 3GQCA 4DL3A 2EZYA 3JPTA 1KSPA 2YB1A 2IOFA 2KEYA 1TVAA 3JPQA 2W8KA 1BVSA 2ZIWB 4UAUA 3EPIA 5J0OA 9ICGA 2FPLA 2DL0A 2NRXA 3SEIA 4EBDA 5AKXA 1L7PA 3AN1A 1CEZA 3WKCA 3GV8B 4DOBA 4MEYA 4KLMA 3RJKA 5EWFA 4RQ6A 4M9GA 1NK8A 1JX4A 9ICUA 2B21A 1X66A 3RF9A 1YT3A 2W7OA 3IM1A 2ALZA 5KFMA 3MR2A 1KBUA 3RJJA 4YR2A 5L9XA 4NLZA 3Q8MA 3E58A 4I27A 4USAA 4O3QA 5J2JA 3PO4A 2KKPA 2BCUA 5L1IA 8ICHA 3MABA 2GLEA 1JUDA 3GV7B 2AGQA 5AM5A 5EE3A 4DL6A 4IC9A 2DFLA 3V72A 1U49A 1K5OA 7ICOA 4YFKA 1RQNA 4RQ2A 1EXNA 2YX8A 3SZ2A 2ZIXA 4F50A 2H3ZA 5J2CA 3V6JA 1PUZA 4F2SA 4KITB 4RNMA 2G0AA 2AQ4A 4UB1A 2QKQA 4LJXA 3I76A 2PXIA 4Q45A 4ECWA 4R8UA 2UVVA 4OJLA 5KFRA 5J2BA 5J2HA 4J9KA 3KZXA 8ICKA 3H7IA 5KFSA 4C8KA 2HHXA 4QWAA 3F53A 3NVWA 1NZPA 4I28A 3RJFA 3DV9A 1KTQA 4YG2A 2BDUA 3HW8A 2PFOA 3OGUA 3PMLA 1NK6A 1JXLA 1SKWA 1PK1A 5J0YA 5ALPA 3LVVA 2HHWA 3R9KA 4I2FA 4LZGA 3TADA 1UA0A 2DWQA 1V9PA 3GIJA 1X2IA 4EEKA 3ICXA 3V7KA 1SZHA 1S10A 3BZKA 5JRTA 1KKXA 3SYZA 4P0PB 3E0FA 4M47A 4I2IA 3SD7A 1BNPA 5KAIU 1QH9A 5CB1A 3ED5A 1O03A 3C23A 2NRZA 1BPZA 4HAIA 4BWJA 2ZTDA 4EYHB 4B9LA 5DG7A 4ED1A 3UXOA 5F3XB 2NYVA 2E8OA 9ICCA 2P66A 3M6ZA 4DFPA 2J6SA 3IDWA 1UA1A 2KIVA 4Y2TA 4Y2YA 2EANA 4Z6CA 4G3IA 1LVHA 2BHNA 5KFYA 3OPXA 3RH4A 5AKZA 1OUQA 4RUCA 2I6XA 8ICGA 3Q8KA 4UB4A 4F72A 3TACB 3QEBZ 1X9MA 4DSFA 4DCCA 4JB3A 5EE0A 7ICFA 5C5JA 4PL1A 4B9NA 5CP2A 5ALLA 2LYBA 3QEAZ 5J0WA 3ZD8A 5AKEA 3NTUA 3RAQA 5AM2A 4CCHA 3C1YA 3RB0A 8ICVA 1ZQKA 1FFUA 2EAMA 4NXZA 3FDSA 3LYSA 4FS2A 1NJXA 2CXYA 5AI4A 5KT2A 4M2YA 1L3VA 2GO7A 4CGZA 4F5NA 4NV0A 3O0FA 4JWMA 2BCQA 2AGOA 2KZZA 1RDFA 2LI6A 9ICOA 3RBDA 5IIKA 4ED7A 3RR7A 3ZDDA 2A19A 4I2AA 2K4EA 4F93B 2VJ4A 1SL0A 4F71A 2G08A 1XWLA 2XY7A 5J0QA 4M9NA 3WKEA 4DL2A 2ATLA 3UQ0A 3HKZF 8ICJA 5AICA 1L6NA 5DG8A 1RYSA 1ZQNA 4YR0A 4OJPA 2P35A 3QU9A 3T5KA 3UPQA 2HHVA 3B0YA 1KRPA 2M0NA 7ICMA 4XUSA 2W54A 2WF5A 1XO1A 3ZD9A 4LVSA 4BXOB 1WWVA 3RRHA 4QZBA 4NLNA 5B66U 4DFJA 5ALHA 4IR1A 2VA2A 1B22A 4IQUA 3T5JA 1KFSA 3UMCA 2BGWA 5ALGA 3C2MA 2Z7JA 4GFJA 3C29A 3BQ7A 3TI0A 4QIWC 3SV4A 4M6WB 3H8MA 1SWVA 3WK4A 8ICFA 1BPDA 1J2NA 3OHBA 1PVQA 5KG3A 3C28A 5G5HA 1UPHA 1NJWA 9ICVA 2RQ5A 3WKDA 5HHHA 3WK5A 3WKBA 2FLNA 4UB3A 4IS7A 2FLLA 2XVTA 2W03A 1T3QA 2ZIWA 2XC9A 3Q8PB 3EWAA 9ICTA 3VCBA 4UAZA 2WHEA 4NM1A 3M1YA 2OEHA 2V4RA 5KG0A 2WF9A 3AEVA 4C4TA 4EBEA 2HOIA 5A0LA 1SXDA 1P7DA 2W9BB 1C20A 4F5OA 5FP0A 2L5YA 5AM4A 4DL7A 1SGGA 1U47A 1N48A 3C2LA 2W43A 2MUTA 5DB7A 1ZQAA 3NRWA 5DB8A 1WCLA 2R8KA 3H0RB 3G6XA 1D8LA 7ICJA 3TAPA 2HOQA 4B9VA 2BQUA 8ICQA 1ZQPA 9ICPA 2XY6A 4C8LA 3N28A 1ZQDA 3M8SA 3AU2A 4DFMA 1L7OA 4GXIA 1RPLA 5CHGA 5KL1B 4ED2A 4FO6A 2W3SA 1COOA 5ALXA 2DF4B 3WK9A 3PO5A 4DL4A 3ISCA 4YCXA 1IG6A 3H8WA 5KT5A 2JGAA 2ISPA 5KG6A 4QW8A 9ICFA 4DSLA 2W9AA 2ZIVB 2LKYA 3H4DA 9ICAA 2MA1A 4XRHA 2WB1C 1M6YA 4RT2A 5DLFA 3RJGA 3AQFA 4M04A 3D6JA 3PW7A 4M9LA 1TAQA 2KV2A 5G5GA 1B0XA 3ORYA 4KN7A 3RH6A 4ED6A 3HJEA 4Y2VA 4J9LA 3RFAA 4RQ8A 1ZJMA 2CN1A 5TISU 8ICRA 3K4GA 3J81j 8ICEA 1B43A 1H38A 2F8LA 2NRWA 2JV3A 4NY8A 4AYBF 4RT3A 4DEZA 4M9JA 1ZQ1C 4YN4A 4KMOB 3QUQA 2E5SA 2FMPA 1COKA 5AKHA 3T3FA 3AUOA 4O5EA 4DQIA 2K4PA 2BCRA 4KLOA 5AKJA 1Z3EB 4ECZA 1Z4NA 3T5HA 2QARB 2F77X 2DPJA 5IIIA 3RJEA 2F76X 4DF4A 3H4BA 2HMXA 4GIBA 3C5GA 4DOCA 4P0PA 3KHGA 5IIMA 4C7YA 1V38A 3BQ2A 2JZBA 5AK4A 1KN5A 4WJ3B 1V97A 1OW5A 3RRGA 4QZAA 2KNJA 4F92B 1IIPA 1UHUA 9ICIA 5DB9A 4R66A 5AI6A 2HOFA 8ICXA 3BQTA 5AI9A 3TQ1A 8ICOA 3GV5B 2HDOA 1A0PA 2WF7A 3E2EA 3BZCA 2JHDA 4QZ9A 2K60A 4ED3A 2A1JA 1ZQJA 4DS4A 2ZIUB 4FZMA 1ZQQA 4IQWA 4O5KA 2EQYA 2F1IA 1SKRA 2YMPA 5DBAA 4JV2A 4DOAA 5EWEA 2BQRA 2BCVA 1NK7A 1JI7A 9ICLA 4B9SA 9ICHA 4BWMA 1D9FA 5AM3A 2W9CB 2JXJA 2KHQA 3OTQA 4Z6EA 3EUB2 3KOOA 3C2KA 7ICVA 2LYHA 2IOFK 2KD1A 3F2CA 4KLSA 3KTQA 4UAVA 5K4LA 5J2IA 5KT4A 3NGDA 3IN5A 3SQIA 1VLBA 9ICNA 1B4FA 2HHSA 3RB3A 2Q0ZX 4GXJA 1FEZA 1S97A 2G09A 5ALWA 4OO1J 4J03A 1FFVA 1AQ6A 1WG8A 2F1HA 5AKGA 4O9MA 5ALRA 4US8A 3M6KA 4P2HA 1S76D 4RPXA 1A6SA 1TK5A 2I1QA 4Q43A 3BS7A 2ZXHA 1DK2A 2KJ9A 4C8MA 5EE9A 2D3DA 3L3FX 3HT3A 2UVWA 4YQWA 3PZPA 2FE9A 3FC4A 3RB4A 3NVVA 1J2MA 2QB0B 2WAQF 4P4PA 4BXOA 3M9MB 1XSPA 1T7PA 4I2GA 2DGZA 2YTUA 1JROA 1SL1A 1SV4A 5HMLA 4BUGA 4KX5A 2IHMA 1TV9A 1S0VA 3EYZA 5JUMA 2B6GA 2JMGA 2LPEA 2WTFA 4ECRA 3VC8A 1MA7A 3WK7A 2BCSA 4C8NA 1D9DA 4EZ9A 1ZQGA 1L5UA 2GOLA 4M6WA 2OWOA 4F4ZA 1KL9A 2NO5A 4MF8A 5KFAA 2KFZA 7ICLA 2BZFA 4F2RA 4F3OA 3BQ1A 4KTQA 5KG2A 4JUZA 2XI9A 5KFGA 3S6JA 5BOLA 2ZUCA 7ICQA 4FZLA 1ZQXA 1WUDA 3LVWA 1DRGA 5AI8A 2F8KA 2K4IA 5KTQA 4Z6FA 1Y88A 1Q8KA 5KFVA 4YVZA 4TURA 3UMGA 4DQQA 3RB6A 3JPPA 2RP5A 5KFEA 2ASLA 5J0XA 1ZRNA 1XS9D 2LM1A 1N56A 4DSKA 2KJ5A 7ICEA 2E3TA 1ZRMA 1URJA 4ECUA 1S0OA 3G6VA 4KMUA 1JRPA 5AKIA 1Z00A 5L1LA 2W9BA 5ALIA 2ZJ8A 1U9LA 4RQ4A 2JEJA 1SIJA 4UB8U 2KMDA 2K8AA 2PI4A 8ICLA 2F1JA 2VKQA 5H2FU 5AI0A 3N7SC 2F2AB 1WCNA 4IQVA 2EZZA 5KG4A 3FM9A 2ZUBA 3WKAA 3A0BU 1F5SA 2Y0SC 2RLTA 3MDCA 4JMUA 3V6KA 3D2NA 2BR0A 5KFWA 2QLTA 3ETLA 1RG6A 4ECYA 4O3MA 2R8GA 1KEJA 2JH1A 1ZQOA 2W11A 3KFUF 9ICJA 4BDPA 3IHQB 4O3PA 1XU4A 3H8JA 3QU2A 3V6HA 1ZQHA 3V7JA 2ZIVA 4EX7A 2ISOA 4US9A 1BGXT 3GIKA 3N97B 3ZDAA 4OJ6A 1RZTA 3SV3A 8ICUA 4OCZA 1S8OA 4JK1A 4I2HA 4Q8EA 3BS5A 1PVPA 4J9QA 5CRXA 4DQRA 4YMMA 3A0HU 3SAHA 4M0AA 4ELTA 4I29A 1HIWA 2KJ8A 4ICAA 4Y2SA 3QUBA 1QLNA 1X9XA 4Y2JA 5KFDA 4MFAA 1JIHA 1NK4A 3MGIA 3GILA 5J0TA 4QWEA 1L8OA 3GFKB 3DEEA 1U48A 2FPMA 5HNKA 4U7CA 4IRCA 5HR6A 1F0MA 1QSLA 2YMQA 3PX6A 2W7PA 4F5QA 3QXGA 1UT5A 3NASA 2ZUDA 3L5KA 1VJ5A 1Q3UA 4EELA 3PX0A 4R64A 2IMWP 9ICXA 1L3TA 1SWWA 4GLXA 3MR3A 2PFQA 3F5EA 1YZ7A 8ICZA 2OXOA 2KVCA 4ECXA 4J9OA 2XICA 4YR3A 1ZOLA 4RNNA 1N5XA 2RRDA 5L1MA 3D2QA 2KSOB 1DGSA 3RJIA 1ZXIA 3WK8A 2WFAA 2C2RA 3B9JA 1DXSA 9ICQA 1KFTA 1L3UA 3NVZA 8ICNA 3HILA 4TUSA 1NKCA 2H5XA 5ALOA 2H3QA 4PHPA 2W9CA 5KFIA 2G5HB 1NK0A 4ZH4A 3RJHA 5DG9A 4O3SA 1NZBA 2OCEA 3LDAA 1S9FA 2ZXIA 2JEGA 5AKKA 5D46A 5B5EU 2XGQA 4J9NA 4YXMA 3MGHA 1TKDA 4RPYA 4R63A 2KVSA 9ICSA 2IOHA 3TFSA 2IA6A 4UAYA 5EE1A 1ZYQA 2KN7A 2G06A 3UQ2A 2WF8A 5AIBA 3ISBA 2N1RA 1NK5A 1IXRA 3SAGA 5KNIA 4UASA 2R8JA 3IG8A 5F9NA 4NLBA 5ALEA 1L7MA 1TK0A 3TARA 2UVRA 2QB0A 5HP4A 1X9SA 1NKBA 8ICWA 5E79U 2ZIXB 3F2BA 3AL0B 4PGQA 2XCAA 3FAHA 1ZQVA 3KZIU 4Z6DA 1ZD4A 3ZI4A 3Q8RB 4PGXA 5JTIA 4MFFA 4Y2PA 5ALUA 5ALKA 4K4HA 4R8UB 2JEIA 1IM4A 3OJSA 1N63A 4QNLA 4AYBC 5DDMA 2RHFA 1NI3A 4ECTA 3F5AA 1SV0A 3PMNA 4DL5A 5JU5A 1UCVA 2DUYA 1XSNA 3ZDBA 4Y2RA 1LB2B 3NUQA 1PK1B 4JV1A 3UMBA 5KFTA 1CUKA 5IINA 1NOMA 3GU3A 4QIWF 1XSLA 2ESEA 4E0DA 3K75D 2DBYA 4UATA 4C4SA 2HBKA 3KHHA 4P4MA 3PV8A 1MSWD 3PR4A 8ICBA 2EZXA 3Q8QB 3QU7A 1T4GA 4GC7A 4AP9A 3RTVA 1Z19A 2HW3A 4R65A 1KDHA 2HHTA 4JV0A 1SKSA 1FIQA 4KLHA 2BPGA 4FZNA 3OHAA 1S5LU 1N62A 3HX0A 4ELUA 3MFIA 2HVHA 4MF2A 1KW4A 2KZMA 3ALRA 4I2BA 1BPYA 3OSPA 1IV8A 1XC9A 4O3NA 1HUZA 4CF3A 3HRDD 5J0RA 2PMZC 2D6FC 5AM0A 1HUOA 4HYKA 4YMNA 4C8OA 1X6JA 2FDRA 5ALJA 9ICEA 5KFPA 3KD3A 3H0MB 1NKEA 4KLUA 4RQ1A 4QWDA 5J8YC 3T5LA 1JXEA 8ICIA 2A1AA 1N5WA 3QU4A 2VA8A 1Q3VA 4DFDA 1J97A 4RPZA 4NLCA 2OM6A 1Z1BA 1LKYB 1HJPA 2ZG6A 1QSSA 3PW4A 1SL2A 3ONNA 1L3SA 4U6PA 5ALDA 4RQ7A 2YY6A 2HBMA 5EOZA 1S0NA 1ZQZA 1DK3A 1SB3C 3UM9A 1U4BA 4IL6U 5KFFA 2E1EA 5AKLA 3QE9Y 2E1FA 5KAFU 4JWNA 2HHQA 4ZOHC 1FO4A 4MEXA 4K4GA 1Z4OA 4QZEA 4Q44A 2F44A 9ICKA 4QJFB 1ZQUA 2ES6A 5DQIA 1RXVA 3QZ7A 2MSNA 4C4RA 1L7NA 2DKXA 3WK6A 1BNOA 2FMSA 3M9OB 5CR0A 1TK8A 2P6UA 1LV5A 5KFXA 9ICWA 4FBUA 1QQ7A 1A76A 4F4WA 4CNQA 2Y9UA 3C5FA 2HVIA 4PJ0U 1A77A 4B6JA 2E8NA 4TUPA 3C1ZA 2HCFA 4F4XA 2H3VA 2OHFA 5GTIU 5CA7A 4IRKA 1XNSA 4PL2A 2ODGA 4Y2XA 3JPNA 4BX9C
chains in the Genus database with same CATH topology
3MFHA 8ICLA 2F1JA 2V9WA 3RBEA 1RYSA 1ZQNA 5DDYA 4NM2A 5KFUA 4YR0A 1ZQBA 7ICPA 3T5KA 3UPQA 1D8YA 2HHVA 4DO9A 4KLFA 3B0YA 1WCNA 3PX4A 4IQVA 4EYIB 1KRPA 2ZTEA 7ICMA 4XUSA 5KG4A 2MAXA 1XO1A 1NJYA 4KLEA 9ICOA 2ZUBA 3ZD9A 4LVSA 4BXOB 3GIIA 3RRHA 4QZBA 3UXPA 4UBBA 4NLNA 1AROP 3MDCA 4F91B 7ICKA 4DFJA 3H40A 5F9LA 5D49A 4YP3A 3V6KA 3N4MB 1ZJNA 1MQ2A 4ECVA 4PGYA 2BR0A 8ICYA 4MFCA 5KFWA 5KFJA 2NRTA 3ETLA 4ECYA 4IR1A 2VA2A 1B22A 4IQUA 1KEJA 3T5JA 1NJZA 1KFSA 2R8GA 5TZVA 2AGPA 2BGWA 2KZ3A 2C2DA 1ZQOA 5EWGA 3G6YA 3C2MA 2JEFA 4KLJA 9ICJA 4BDPA 2J6TA 1T3NA 7ICUA 3IHQB 4O3PA 5KT6A 3OSNA 5J2DA 1XU4A 3H8JA 3TI0A 3KHRA 3SV4A 4M6WB 3V6HA 1ZQHA 3V7JA 8ICFA 3B0XA 1BPDA 3OHBA 4P4OA 2ISOA 2DPIA 1BGXT 2FLPA 4UQGA 3GIKA 4GXKA 3C21A 1ZQSA 5CWRA 5DGBA 3N97B 1RZTA 3ZDAA 5KG3A 5CJ7A 5KFOA 2ASDA 1NJWA 2W8LA 3SV3A 1T8EA 4DQSA 8ICUA 9ICVA 4J9PA 5DBBA 4JK1A 9ICRA 3M9NB 3M8RA 5HHHA 4I2HA 4I2DA 4DS5A 4F4KA 3TFRA 4Q8EA 2FLNA 5BOMA 4J9QA 4UB3A 4DQRA 4YMMA 2RDJA 2FLLA 4M0AA 3LWMA 5KG5A 2XC9A 3Q8PB 4ELTA 3EWAA 4I29A 4B9MA 1DOQA 9ICTA 4GC6A 4DWIA 4UAZA 4QWBA 5DGAA 2MUTB 4NM1A 1QLNA 2V4RA 5KFDA 5KG0A 5L1KA 1RXWA 4EBEA 2BKEA 2FPKA 5KFQA 3PW0A 3RAXA 4MFAA 1JIHA 1NK4A 3MGIA 9ICMA 3GILA 1RYRA 5J0TA 4QWEA 2W9BB 3Q8LA 1ZETA 4F5OA 4RNOA 4QZCA 3ISDA 3GFKB 2VA3A 2IHNA 4DL7A 4O5CA 4BXOA 1U48A 2FPMA 5HNKA 1U47A 1MQ3A 4DLEA 1N48A 4IRCA 2AU0A 2XCPA 3C2LA 1QSLA 2MUTA 5KT7A 7ICRA 5DB7A 2VANA 4QZGA 3PX6A 1UT8A 1ZQAA 4F5QA 4O3RA 5KFLA 2PFNA 4DLGA 1UT5A 5DB8A 5KFCA 2ZUDA 1WCLA 5HMMA 2R8KA 3RR8A 4QW9A 3BDPA 3PX0A 3G6XA 1D8LA 7ICJA 4R64A 2IMWP 9ICXA 1L3TA 3TAPA 4B9TA 7ICGA 3JPSA 4DSJA 2HHUA 4B9VA 4GLXA 2BQUA 8ICQA 1ZQPA 9ICPA 3MR3A 2PFQA 2XY6A 4C8LA 1ZQDA 3MR5A 4O0IA 3M8SA 2R8HA 4QZIA 4IR9A 3AU2A 8ICZA 1KFDA 9ICBA 5J0SA 1ZQCA 2BQ3A 5J2EA 4DFMA 4ECXA 1RPLA 4QZHA 4J9OA 4GXIA 5CHGA 4ED2A 4FO6A 4YR3A 2NRVA 3PR5B 3PY8A 2KTQA 2KFNA 4RNNA 1COOA 4I2CA 1ZQMA 4DFKA 4Q8FA 1BPBA 1ZQYA 2ZTCA 5DKWA 4YD2A 5DBCA 3PW2A 3EZ5A 4RUAA 4ED8A 3THVA 3PO5A 4M9HA 3TANA 3GIMA 4F8RA 1DGSA 2AQ0A 4UB5A 3RJIA 4I2JA 4DL4A 4YCXA 3ISCA 3MDAA 2C2RA 4O3OA 3H8WA 5KT5A 9ICQA 3JPRA 2ISPA 3QZ8A 4J9RA 1KFTA 5KG6A 2R8IA 4QW8A 8ICCA 5J0UA 9ICFA 4KLQA 4DSLA 1L3UA 4KLGA 4RQ0A 3AU6A 8ICSA 2W9AA 8ICNA 4TUSA 1NKCA 2H5XA 4PHPA 3PW5A 3H4DA 9ICAA 2W9MA 5J2FA 2W9CA 4NLKA 3ZDEA 7ICTA 4XRHA 5KFIA 3MR6A 1NK0A 1MC8A 1BPXA 4RT2A 4DSEA 5DLFA 3PVXA 3RJGA 4TUQA 2C22A 5DQHA 4DF8A 4M04A 3PW7A 4ZH4A 3RJHA 5DG9A 4M9LA 5J0PA 3Q8SB 1TAQA 4KLDA 4O3SA 3GQCA 3ORYA 3LDAA 4KN7A 3RH6A 4ED6A 1S9FA 4DL3A 3JPTA 3HWTA 4J9LA 4RQ8A 1KSPA 3BJYA 1ZJMA 4EEYA 2JEGA 1TVAA 8ICRA 5D46A 3JPQA 3K4GA 8ICEA 2XGQA 1B43A 4YXMA 1BVSA 4RQ5A 2W8KA 4J9NA 2NRWA 3MGHA 1H38A 4NY8A 4RU9A 4ECQA 4QZ8A 4PHAA 3V7LA 4DEZA 4RT3A 1TKDA 2GWSA 4M9JA 4RPYA 3EPIA 4YN4A 5J0OA 4R63A 2FMPA 2JZBB 9ICSA 3T3FA 9ICGA 2FPLA 3AUOA 4O5EA 1TFRA 2NRXA 3TFSA 3EW9A 4DQIA 2BCRA 4EBDA 4UAYA 2IA6A 3MBYA 8ICTA 1ZYQA 4EBCA 4KLOA 7ICHA 2KN7A 1CEZA 1Z3EB 3GV8B 4ECZA 3T5HA 2XO7A 4MEYA 3UQ2A 4DOBA 3RJKA 4KLMA 2AJQA 5EWFA 4RQ6A 1K1SA 4M9GA 3ISBA 5L1JA 1NK8A 2DPJA 4TQSA 1JX4A 9ICUA 1BPEA 2B21A 5IIIA 3RJEA 4J9MA 4DF4A 1NK5A 3H4BA 5D4BA 1IXRA 1ZQIA 3C5GA 4KN4A 4DOCA 5IILA 1JN3A 4FBTA 3KHGA 5IIMA 1QSYA 3IM1A 3JPOA 5KFMA 5KFKA 2ALZA 5F9NA 2JZBA 5DLGA 3BQ2A 4F4YA 4F5PA 3MR2A 1TK0A 4ECSA 3RJJA 3TARA 1C7YA 4QZAA 3RRGA 4YR2A 1S77D 2UVRA 5IIOA 5HP4A 7ICSA 4F92B 1X9SA 5L9XA 4NLZA 9ICIA 5DB9A 4R66A 3Q8MA 2A1JB 1NKBA 8ICWA 8ICXA 4I27A 2Y1JA 4PGQA 4XA5A 2XCAA 4O3QA 5J2JA 3PO4A 3LK9A 1ZQVA 4Z6DA 5L1IA 2BCUA 3Q8RB 8ICHA 3MABA 4PGXA 3GV7B 5J29A 3BQTA 2AGQA 4MFFA 3TQ1A 8ICOA 4DL6A 3GV5B 2DFLA 3V72A 3E2EA 4K4HA 4R8UB 1U49A 2JEIA 2C28A 1IM4A 4YFKA 4RQ2A 7ICOA 3OJSA 1ZQRA 4DSIA 4QZDA 1EXNA 3LWLA 4QZ9A 4ED3A 5DDMA 2A1JA 1ZQJA 3SZ2A 4DS4A 4PHEA 4LZDA 4DQPA 1ZQQA 4IQWA 4ECTA 4F50A 5J2CA 3PMNA 2F1IA 3V6JA 4DL5A 1SKRA 4F2SA 4O5KA 4TQRA 1XSNA 5DBAA 3ZDBA 1LB2B 4NLGA 4JV2A 4DOAA 5EWEA 4KITB 4RNMA 2BQRA 2BCVA 1NK7A 5KT3A 9ICLA 2P6RA 4JV1A 2AQ4A 4UB2A 4UB1A 4B9SA 5KFTA 9ICHA 1CUKA 4BWMA 1D9FA 5HHIA 4Q45A 2PXIA 4R8UA 1NOMA 5KFHA 2W9CB 4ECWA 5KG1A 5IINA 1XSLA 1ZQLA 1JMSA 2UVVA 4ELVA 5KFRA 5J2BA 5J2HA 4J9KA 3RH5A 4E0DA 8ICKA 3H7IA 5KFSA 3K75D 4Z6EA 1SZPA 4C8KA 3FYHA 2HHXA 3C2KA 7ICVA 3KHHA 4QWAA 4P4MA 2LYHA 3PV8A 4FS1A 4I28A 1MSWD 3PR4A 3RJFA 4KLSA 1KTQA 4YG2A 3Q8QB 3HW8A 2PFOA 2PFPA 8ICBA 3OGUA 3PMLA 1NK6A 1JXLA 2FMQA 3KTQA 4QWCA 1T4GA 4GC7A 4PH5A 1SKWA 5J2IA 5KT4A 3NGDA 4I2EA 3RTVA 2HW3A 4R65A 1KDHA 5J0YA 2HHTA 9ICNA 4JV0A 1SKSA 3KHLA 4KLHA 2HHSA 2BPGA 2HHWA 3RB3A 2Q0ZX 4GXJA 8ICAA 2R8JA 5KFZA 3OHAA 1S97A 1U45A 3HX0A 4I2FA 4LZGA 1UA0A 3TAQA 4ELUA 1V9PA 3PNCA 3MFIA 3GIJA 1X9WA 2HVHA 7ICIA 1X2IA 4MF2A 1ZQEA 2F1HA 4O9MA 5BPCA 2IBKA 4YD1A 2KZMA 5KFBA 1ZQWA 4I2BA 1BPYA 4P2HA 3OSPA 2ZJ5A 4RPXA 3V7KA 2J6UA 1S76D 1XC9A 4O3NA 5J2KA 1HUZA 1TK5A 2I1QA 4Q43A 2BDPA 5J0RA 1ZQTA 1HUOA 4HYKA 1S10A 4YMNA 4C8OA 3SYZA 2Y1IA 4K4IA 4C8MA 4KLIA 3BQ0A 4F5RA 2C2EA 4M47A 9ICEA 5KFPA 3HT3A 4I2IA 2UVWA 4YQWA 5DQGA 1NKEA 1QTMA 4KLUA 4RQ1A 5CB1A 4QWDA 1NK9A 3RB4A 2I9GA 3EPGA 3T5LA 8ICMA 1JXEA 8ICIA 3C23A 2NRZA 4P4PA 1BPZA 4BWJA 2ZTDA 3M9MB 5KFNA 4EYHB 4ED0A 4ED1A 5DG7A 1XSPA 1T7PA 4B9LA 3UXOA 4I2GA 2VA8A 1SL1A 5IIJA 2ASJA 2PI5A 5HMLA 9ICCA 3HP6A 2P66A 4IRDA 4RPZA 4DFPA 2IHMA 1TV9A 1S0VA 2J6SA 1UA1A 3EYZA 5JUMA 1ZQFA 4ECRA 2WTFA 3GDXA 1HJPA 4RZRA 1QSSA 3PW4A 1SL2A 2BCSA 4UBCA 4Z6CA 4C8NA 1D9DA 4EZ9A 2BHNA 5KFYA 1ZQGA 1L5UA 4G3IA 2XY5A 1L3SA 1TAUA 4RQ7A 3HPOA 3RH4A 4M6WA 5EOZA 4YMOA 4RUCA 1S0NA 2OWOA 8ICGA 5KG7A 3Q8KA 4UB4A 4F4ZA 1ZQZA 1K1QA 4MF8A 5KFAA 3QEBZ 2BPFA 1X9MA 2KFZA 7ICLA 1U4BA 4DSFA 7ICFA 5KFFA 5C5JA 4F2RA 4B9NA 4F3OA 5CP2A 3BQ1A 4J9SA 4KTQA 5KG2A 3QE9Y 4JUZA 5KFGA 3QEAZ 5J0WA 4JWNA 2HHQA 4UAWA 3ZD8A 3NTUA 5BOLA 4IQTA 2ZUCA 3C1YA 3RB0A 3RAQA 4CCHA 4MEXA 1ZQKA 8ICVA 7ICQA 4RQ3A 1Z00B 1ZQXA 4K4GA 4KLLA 4EZ6A 4QZEA 4NXZA 3FDSA 5J2GA 4KLTA 4Q44A 4FS2A 1NJXA 9ICKA 1ZQUA 4Z6FA 1Y88A 5KFVA 5KTQA 5KT2A 4PHDA 4M2YA 5DQIA 1L3VA 4YVZA 2BPCA 4TURA 3QZ7A 4DQQA 1RXVA 3RB6A 3JPPA 4X5VA 5KFEA 3UXNA 3OJUA 2ASLA 5J0XA 4F5NA 1XS9D 4JWMA 2V4QA 4BGDA 1N56A 2BCQA 2AGOA 2KZZA 4DSKA 2M9NA 2ZJAA 7ICEA 1PZNA 3H8SA 2FMSA 4ECUA 5J2AA 5CR0A 3M9OB 1TK8A 4QZFA 5IIKA 3G6VA 4KMUA 4ED7A 3RBDA 2P6UA 1S0OA 1LV5A 5DB6A 3RR7A 3ZDDA 2UVUA 1Z00A 5KFXA 4YXJA 5L1LA 9ICWA 4FBUA 2W9BA 4I2AA 1A76A 4F93B 4F4WA 1SL0A 2ZJ8A 3C5FA 4B9UA 1U9LA 3SI8A 2HVIA 4RQ4A 1S0MA 2JEJA 1A77A 1XWLA 4TUPA 2XY7A 3C1ZA 4XQ8A 3ZDCA 4F4XA 5J0QA 4M9NA 4DL2A 2RDIA 5CA7A 2PI4A 4IRKA 4PPXA 2XGPA 2ATLA 1KLNA 3UQ0A 8ICJA 3JPNA 7ICNA 8ICPA 5DG8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MFH A;  8ICL A;  2F1J A;  2V9W A;  3RBE A;  1RYS A;  1ZQN A;  5DDY A;  4NM2 A;  5KFU A;  4YR0 A;  1ZQB A;  7ICP A;  3T5K A;  3UPQ A;  1D8Y A;  2HHV A;  4DO9 A;  4KLF A;  3B0Y A;  1WCN A;  3PX4 A;  4IQV A;  4EYI B;  1KRP A;  2ZTE A;  7ICM A;  4XUS A;  5KG4 A;  2MAX A;  1XO1 A;  1NJY A;  4KLE A;  9ICO A;  2ZUB A;  3ZD9 A;  4LVS A;  4BXO B;  3GII A;  3RRH A;  4QZB A;  3UXP A;  4UBB A;  4NLN A;  1ARO P;  3MDC A;  4F91 B;  7ICK A;  4DFJ A;  3H40 A;  5F9L A;  5D49 A;  4YP3 A;  3V6K A;  3N4M B;  1ZJN A;  1MQ2 A;  4ECV A;  4PGY A;  2BR0 A;  8ICY A;  4MFC A;  5KFW A;  5KFJ A;  2NRT A;  3ETL A;  4ECY A;  4IR1 A;  2VA2 A;  1B22 A;  4IQU A;  1KEJ A;  3T5J A;  1NJZ A;  1KFS A;  2R8G A;  5TZV A;  2AGP A;  2BGW A;  2KZ3 A;  2C2D A;  1ZQO A;  5EWG A;  3G6Y A;  3C2M A;  2JEF A;  4KLJ A;  9ICJ A;  4BDP A;  2J6T A;  1T3N A;  7ICU A;  3IHQ B;  4O3P A;  5KT6 A;  3OSN A;  5J2D A;  1XU4 A;  3H8J A;  3TI0 A;  3KHR A;  3SV4 A;  4M6W B;  3V6H A;  1ZQH A;  3V7J A;  8ICF A;  3B0X A;  1BPD A;  3OHB A;  4P4O A;  2ISO A;  2DPI A;  1BGX T;  2FLP A;  4UQG A;  3GIK A;  4GXK A;  3C21 A;  1ZQS A;  5CWR A;  5DGB A;  3N97 B;  1RZT A;  3ZDA A;  5KG3 A;  5CJ7 A;  5KFO A;  2ASD A;  1NJW A;  2W8L A;  3SV3 A;  1T8E A;  4DQS A;  8ICU A;  9ICV A;  4J9P A;  5DBB A;  4JK1 A;  9ICR A;  3M9N B;  3M8R A;  5HHH A;  4I2H A;  4I2D A;  4DS5 A;  4F4K A;  3TFR A;  4Q8E A;  2FLN A;  5BOM A;  4J9Q A;  4UB3 A;  4DQR A;  4YMM A;  2RDJ A;  2FLL A;  4M0A A;  3LWM A;  5KG5 A;  2XC9 A;  3Q8P B;  4ELT A;  3EWA A;  4I29 A;  4B9M A;  1DOQ A;  9ICT A;  4GC6 A;  4DWI A;  4UAZ A;  4QWB A;  5DGA A;  2MUT B;  4NM1 A;  1QLN A;  2V4R A;  5KFD A;  5KG0 A;  5L1K A;  1RXW A;  4EBE A;  2BKE A;  2FPK A;  5KFQ A;  3PW0 A;  3RAX A;  4MFA A;  1JIH A;  1NK4 A;  3MGI A;  9ICM A;  3GIL A;  1RYR A;  5J0T A;  4QWE A;  2W9B B;  3Q8L A;  1ZET A;  4F5O A;  4RNO A;  4QZC A;  3ISD A;  3GFK B;  2VA3 A;  2IHN A;  4DL7 A;  4O5C A;  4BXO A;  1U48 A;  2FPM A;  5HNK A;  1U47 A;  1MQ3 A;  4DLE A;  1N48 A;  4IRC A;  2AU0 A;  2XCP A;  3C2L A;  1QSL A;  2MUT A;  5KT7 A;  7ICR A;  5DB7 A;  2VAN A;  4QZG A;  3PX6 A;  1UT8 A;  1ZQA A;  4F5Q A;  4O3R A;  5KFL A;  2PFN A;  4DLG A;  1UT5 A;  5DB8 A;  5KFC A;  2ZUD A;  1WCL A;  5HMM A;  2R8K A;  3RR8 A;  4QW9 A;  3BDP A;  3PX0 A;  3G6X A;  1D8L A;  7ICJ A;  4R64 A;  2IMW P;  9ICX A;  1L3T A;  3TAP A;  4B9T A;  7ICG A;  3JPS A;  4DSJ A;  2HHU A;  4B9V A;  4GLX A;  2BQU A;  8ICQ A;  1ZQP A;  9ICP A;  3MR3 A;  2PFQ A;  2XY6 A;  4C8L A;  1ZQD A;  3MR5 A;  4O0I A;  3M8S A;  2R8H A;  4QZI A;  4IR9 A;  3AU2 A;  8ICZ A;  1KFD A;  9ICB A;  5J0S A;  1ZQC A;  2BQ3 A;  5J2E A;  4DFM A;  4ECX A;  1RPL A;  4QZH A;  4J9O A;  4GXI A;  5CHG A;  4ED2 A;  4FO6 A;  4YR3 A;  2NRV A;  3PR5 B;  3PY8 A;  2KTQ A;  2KFN A;  4RNN A;  1COO A;  4I2C A;  1ZQM A;  4DFK A;  4Q8F A;  1BPB A;  1ZQY A;  2ZTC A;  5DKW A;  4YD2 A;  5DBC A;  3PW2 A;  3EZ5 A;  4RUA A;  4ED8 A;  3THV A;  3PO5 A;  4M9H A;  3TAN A;  3GIM A;  4F8R A;  1DGS A;  2AQ0 A;  4UB5 A;  3RJI A;  4I2J A;  4DL4 A;  4YCX A;  3ISC A;  3MDA A;  2C2R A;  4O3O A;  3H8W A;  5KT5 A;  9ICQ A;  3JPR A;  2ISP A;  3QZ8 A;  4J9R A;  1KFT A;  5KG6 A;  2R8I A;  4QW8 A;  8ICC A;  5J0U A;  9ICF A;  4KLQ A;  4DSL A;  1L3U A;  4KLG A;  4RQ0 A;  3AU6 A;  8ICS A;  2W9A A;  8ICN A;  4TUS A;  1NKC A;  2H5X A;  4PHP A;  3PW5 A;  3H4D A;  9ICA A;  2W9M A;  5J2F A;  2W9C A;  4NLK A;  3ZDE A;  7ICT A;  4XRH A;  5KFI A;  3MR6 A;  1NK0 A;  1MC8 A;  1BPX A;  4RT2 A;  4DSE A;  5DLF A;  3PVX A;  3RJG A;  4TUQ A;  2C22 A;  5DQH A;  4DF8 A;  4M04 A;  3PW7 A;  4ZH4 A;  3RJH A;  5DG9 A;  4M9L A;  5J0P A;  3Q8S B;  1TAQ A;  4KLD A;  4O3S A;  3GQC A;  3ORY A;  3LDA A;  4KN7 A;  3RH6 A;  4ED6 A;  1S9F A;  4DL3 A;  3JPT A;  3HWT A;  4J9L A;  4RQ8 A;  1KSP A;  3BJY A;  1ZJM A;  4EEY A;  2JEG A;  1TVA A;  8ICR A;  5D46 A;  3JPQ A;  3K4G A;  8ICE A;  2XGQ A;  1B43 A;  4YXM A;  1BVS A;  4RQ5 A;  2W8K A;  4J9N A;  2NRW A;  3MGH A;  1H38 A;  4NY8 A;  4RU9 A;  4ECQ A;  4QZ8 A;  4PHA A;  3V7L A;  4DEZ A;  4RT3 A;  1TKD A;  2GWS A;  4M9J A;  4RPY A;  3EPI A;  4YN4 A;  5J0O A;  4R63 A;  2FMP A;  2JZB B;  9ICS A;  3T3F A;  9ICG A;  2FPL A;  3AUO A;  4O5E A;  1TFR A;  2NRX A;  3TFS A;  3EW9 A;  4DQI A;  2BCR A;  4EBD A;  4UAY A;  2IA6 A;  3MBY A;  8ICT A;  1ZYQ A;  4EBC A;  4KLO A;  7ICH A;  2KN7 A;  1CEZ A;  1Z3E B;  3GV8 B;  4ECZ A;  3T5H A;  2XO7 A;  4MEY A;  3UQ2 A;  4DOB A;  3RJK A;  4KLM A;  2AJQ A;  5EWF A;  4RQ6 A;  1K1S A;  4M9G A;  3ISB A;  5L1J A;  1NK8 A;  2DPJ A;  4TQS A;  1JX4 A;  9ICU A;  1BPE A;  2B21 A;  5III A;  3RJE A;  4J9M A;  4DF4 A;  1NK5 A;  3H4B A;  5D4B A;  1IXR A;  1ZQI A;  3C5G A;  4KN4 A;  4DOC A;  5IIL A;  1JN3 A;  4FBT A;  3KHG A;  5IIM A;  1QSY A;  3IM1 A;  3JPO A;  5KFM A;  5KFK A;  2ALZ A;  5F9N A;  2JZB A;  5DLG A;  3BQ2 A;  4F4Y A;  4F5P A;  3MR2 A;  1TK0 A;  4ECS A;  3RJJ A;  3TAR A;  1C7Y A;  4QZA A;  3RRG A;  4YR2 A;  1S77 D;  2UVR A;  5IIO A;  5HP4 A;  7ICS A;  4F92 B;  1X9S A;  5L9X A;  4NLZ A;  9ICI A;  5DB9 A;  4R66 A;  3Q8M A;  2A1J B;  1NKB A;  8ICW A;  8ICX A;  4I27 A;  2Y1J A;  4PGQ A;  4XA5 A;  2XCA A;  4O3Q A;  5J2J A;  3PO4 A;  3LK9 A;  1ZQV A;  4Z6D A;  5L1I A;  2BCU A;  3Q8R B;  8ICH A;  3MAB A;  4PGX A;  3GV7 B;  5J29 A;  3BQT A;  2AGQ A;  4MFF A;  3TQ1 A;  8ICO A;  4DL6 A;  3GV5 B;  2DFL A;  3V72 A;  3E2E A;  4K4H A;  4R8U B;  1U49 A;  2JEI A;  2C28 A;  1IM4 A;  4YFK A;  4RQ2 A;  7ICO A;  3OJS A;  1ZQR A;  4DSI A;  4QZD A;  1EXN A;  3LWL A;  4QZ9 A;  4ED3 A;  5DDM A;  2A1J A;  1ZQJ A;  3SZ2 A;  4DS4 A;  4PHE A;  4LZD A;  4DQP A;  1ZQQ A;  4IQW A;  4ECT A;  4F50 A;  5J2C A;  3PMN A;  2F1I A;  3V6J A;  4DL5 A;  1SKR A;  4F2S A;  4O5K A;  4TQR A;  1XSN A;  5DBA A;  3ZDB A;  1LB2 B;  4NLG A;  4JV2 A;  4DOA A;  5EWE A;  4KIT B;  4RNM A;  2BQR A;  2BCV A;  1NK7 A;  5KT3 A;  9ICL A;  2P6R A;  4JV1 A;  2AQ4 A;  4UB2 A;  4UB1 A;  4B9S A;  5KFT A;  9ICH A;  1CUK A;  4BWM A;  1D9F A;  5HHI A;  4Q45 A;  2PXI A;  4R8U A;  1NOM A;  5KFH A;  2W9C B;  4ECW A;  5KG1 A;  5IIN A;  1XSL A;  1ZQL A;  1JMS A;  2UVV A;  4ELV A;  5KFR A;  5J2B A;  5J2H A;  4J9K A;  3RH5 A;  4E0D A;  8ICK A;  3H7I A;  5KFS A;  3K75 D;  4Z6E A;  1SZP A;  4C8K A;  3FYH A;  2HHX A;  3C2K A;  7ICV A;  3KHH A;  4QWA A;  4P4M A;  2LYH A;  3PV8 A;  4FS1 A;  4I28 A;  1MSW D;  3PR4 A;  3RJF A;  4KLS A;  1KTQ A;  4YG2 A;  3Q8Q B;  3HW8 A;  2PFO A;  2PFP A;  8ICB A;  3OGU A;  3PML A;  1NK6 A;  1JXL A;  2FMQ A;  3KTQ A;  4QWC A;  1T4G A;  4GC7 A;  4PH5 A;  1SKW A;  5J2I A;  5KT4 A;  3NGD A;  4I2E A;  3RTV A;  2HW3 A;  4R65 A;  1KDH A;  5J0Y A;  2HHT A;  9ICN A;  4JV0 A;  1SKS A;  3KHL A;  4KLH A;  2HHS A;  2BPG A;  2HHW A;  3RB3 A;  2Q0Z X;  4GXJ A;  8ICA A;  2R8J A;  5KFZ A;  3OHA A;  1S97 A;  1U45 A;  3HX0 A;  4I2F A;  4LZG A;  1UA0 A;  3TAQ A;  4ELU A;  1V9P A;  3PNC A;  3MFI A;  3GIJ A;  1X9W A;  2HVH A;  7ICI A;  1X2I A;  4MF2 A;  1ZQE A;  2F1H A;  4O9M A;  5BPC A;  2IBK A;  4YD1 A;  2KZM A;  5KFB A;  1ZQW A;  4I2B A;  1BPY A;  4P2H A;  3OSP A;  2ZJ5 A;  4RPX A;  3V7K A;  2J6U A;  1S76 D;  1XC9 A;  4O3N A;  5J2K A;  1HUZ A;  1TK5 A;  2I1Q A;  4Q43 A;  2BDP A;  5J0R A;  1ZQT A;  1HUO A;  4HYK A;  1S10 A;  4YMN A;  4C8O A;  3SYZ A;  2Y1I A;  4K4I A;  4C8M A;  4KLI A;  3BQ0 A;  4F5R A;  2C2E A;  4M47 A;  9ICE A;  5KFP A;  3HT3 A;  4I2I A;  2UVW A;  4YQW A;  5DQG A;  1NKE A;  1QTM A;  4KLU A;  4RQ1 A;  5CB1 A;  4QWD A;  1NK9 A;  3RB4 A;  2I9G A;  3EPG A;  3T5L A;  8ICM A;  1JXE A;  8ICI A;  3C23 A;  2NRZ A;  4P4P A;  1BPZ A;  4BWJ A;  2ZTD A;  3M9M B;  5KFN A;  4EYH B;  4ED0 A;  4ED1 A;  5DG7 A;  1XSP A;  1T7P A;  4B9L A;  3UXO A;  4I2G A;  2VA8 A;  1SL1 A;  5IIJ A;  2ASJ A;  2PI5 A;  5HML A;  9ICC A;  3HP6 A;  2P66 A;  4IRD A;  4RPZ A;  4DFP A;  2IHM A;  1TV9 A;  1S0V A;  2J6S A;  1UA1 A;  3EYZ A;  5JUM A;  1ZQF A;  4ECR A;  2WTF A;  3GDX A;  1HJP A;  4RZR A;  1QSS A;  3PW4 A;  1SL2 A;  2BCS A;  4UBC A;  4Z6C A;  4C8N A;  1D9D A;  4EZ9 A;  2BHN A;  5KFY A;  1ZQG A;  1L5U A;  4G3I A;  2XY5 A;  1L3S A;  1TAU A;  4RQ7 A;  3HPO A;  3RH4 A;  4M6W A;  5EOZ A;  4YMO A;  4RUC A;  1S0N A;  2OWO A;  8ICG A;  5KG7 A;  3Q8K A;  4UB4 A;  4F4Z A;  1ZQZ A;  1K1Q A;  4MF8 A;  5KFA A;  3QEB Z;  2BPF A;  1X9M A;  2KFZ A;  7ICL A;  1U4B A;  4DSF A;  7ICF A;  5KFF A;  5C5J A;  4F2R A;  4B9N A;  4F3O A;  5CP2 A;  3BQ1 A;  4J9S A;  4KTQ A;  5KG2 A;  3QE9 Y;  4JUZ A;  5KFG A;  3QEA Z;  5J0W A;  4JWN A;  2HHQ A;  4UAW A;  3ZD8 A;  3NTU A;  5BOL A;  4IQT A;  2ZUC A;  3C1Y A;  3RB0 A;  3RAQ A;  4CCH A;  4MEX A;  1ZQK A;  8ICV A;  7ICQ A;  4RQ3 A;  1Z00 B;  1ZQX A;  4K4G A;  4KLL A;  4EZ6 A;  4QZE A;  4NXZ A;  3FDS A;  5J2G A;  4KLT A;  4Q44 A;  4FS2 A;  1NJX A;  9ICK A;  1ZQU A;  4Z6F A;  1Y88 A;  5KFV A;  5KTQ A;  5KT2 A;  4PHD A;  4M2Y A;  5DQI A;  1L3V A;  4YVZ A;  2BPC A;  4TUR A;  3QZ7 A;  4DQQ A;  1RXV A;  3RB6 A;  3JPP A;  4X5V A;  5KFE A;  3UXN A;  3OJU A;  2ASL A;  5J0X A;  4F5N A;  1XS9 D;  4JWM A;  2V4Q A;  4BGD A;  1N56 A;  2BCQ A;  2AGO A;  2KZZ A;  4DSK A;  2M9N A;  2ZJA A;  7ICE A;  1PZN A;  3H8S A;  2FMS A;  4ECU A;  5J2A A;  5CR0 A;  3M9O B;  1TK8 A;  4QZF A;  5IIK A;  3G6V A;  4KMU A;  4ED7 A;  3RBD A;  2P6U A;  1S0O A;  1LV5 A;  5DB6 A;  3RR7 A;  3ZDD A;  2UVU A;  1Z00 A;  5KFX A;  4YXJ A;  5L1L A;  9ICW A;  4FBU A;  2W9B A;  4I2A A;  1A76 A;  4F93 B;  4F4W A;  1SL0 A;  2ZJ8 A;  3C5F A;  4B9U A;  1U9L A;  3SI8 A;  2HVI A;  4RQ4 A;  1S0M A;  2JEJ A;  1A77 A;  1XWL A;  4TUP A;  2XY7 A;  3C1Z A;  4XQ8 A;  3ZDC A;  4F4X A;  5J0Q A;  4M9N A;  4DL2 A;  2RDI A;  5CA7 A;  2PI4 A;  4IRK A;  4PPX A;  2XGP A;  2ATL A;  1KLN A;  3UQ0 A;  8ICJ A;  3JPN A;  7ICN A;  8ICP A;  5DG8 A; 
#chains in the Genus database with same CATH topology
 4C80 A;  3MFH A;  2V9W A;  5DDY A;  5KFU A;  1ZQB A;  5ALS A;  4DO9 A;  3PX4 A;  4EYI B;  2ZTE A;  2MAX A;  1NJY A;  4KLE A;  2KHV A;  1ARO P;  2JR5 A;  4RQN A;  5F9L A;  4YP3 A;  1ZJN A;  3N4M B;  5HR7 A;  1MQ2 A;  1X40 A;  4PGY A;  4RQM A;  5KFJ A;  4ACO A;  2KSO A;  5TZV A;  2C2D A;  1RQL A;  7ICU A;  3MGV A;  5KT6 A;  5J2D A;  3KHR A;  3IRU A;  4P4O A;  2W04 A;  2DPI A;  2FLP A;  4OJ5 A;  4UQG A;  4GXK A;  1ZQS A;  5CWR A;  4Y2U A;  5KFO A;  2ASD A;  2W8L A;  1T8E A;  2W55 A;  2NO4 A;  2MRL A;  9ICR A;  4DS5 A;  4F4K A;  5BOM A;  1SV0 C;  3DDH A;  3LWM A;  1QCK A;  4Y2Q A;  2HBJ A;  1DOQ A;  1F44 A;  2CRX A;  3QU5 A;  2MUT B;  3K1Z A;  5L1K A;  2LHT A;  1TAM A;  2FPK A;  3RAX A;  2LBO A;  3Q8L A;  4RNO A;  3ISD A;  2VA3 A;  4NJ8 A;  2AU0 A;  2XCP A;  4O3R A;  2VAN A;  4QZG A;  1UT8 A;  2PFN A;  4DLG A;  5KFC A;  3RR8 A;  4QW9 A;  3T79 A;  3BDP A;  1X42 A;  2YB4 A;  2LMR A;  4B9T A;  3JPS A;  4DSJ A;  1QQ6 A;  1WWU A;  2F3N A;  4C0Z A;  4QZI A;  1KFD A;  9ICB A;  1ZQC A;  2BQ3 A;  4QZH A;  2DQN B;  3PY8 A;  2KTQ A;  4I2C A;  4DFK A;  4Q8F A;  5DBC A;  3AQE A;  3EZ5 A;  1X6I A;  3F2D A;  4ED8 A;  3TAN A;  4F8R A;  2AQ0 A;  4I2J A;  2K8C B;  4O3O A;  4EX6 A;  3QZ8 A;  2PKE A;  8ICC A;  4KLQ A;  4KLG A;  2KK0 A;  8ICS A;  5KL8 B;  3AU6 A;  2FJ6 A;  2H3F A;  3ZDE A;  1XO0 A;  3MR6 A;  2JH7 A;  4PZO A;  3PVX A;  4TUQ A;  2C22 A;  4DF8 A;  2EAO A;  1ZD3 A;  4OJO A;  1RYU A;  3I28 A;  3HWT A;  3BJY A;  3QX7 A;  4EEY A;  1CI4 A;  4RQ5 A;  4RU9 A;  4ECQ A;  4QZ8 A;  4PHA A;  3V7L A;  2GWS A;  3PST A;  2JZB B;  5CEH A;  1TFR A;  3EW9 A;  2EAP A;  3MBY A;  3SAF A;  8ICT A;  4EBC A;  7ICH A;  2KG5 A;  4G9B A;  2XO7 A;  2AJQ A;  3HKZ C;  1K1S A;  3M7D A;  5ALV A;  5L1J A;  3KKA C;  4TQS A;  1BPE A;  4J9M A;  5D4B A;  1ZQI A;  4KN4 A;  5IIL A;  1JN3 A;  1YZ6 A;  4FBT A;  1QSY A;  3JPO A;  5KFK A;  2K89 A;  5DLG A;  4F4Y A;  2H3I A;  4F5P A;  4ECS A;  1O08 A;  1C7Y A;  1S77 D;  4KX3 A;  5IIO A;  7ICS A;  5AKY A;  3PSF A;  3D2S A;  2QAR A;  2A1J B;  5J8Y A;  2Y1J A;  4XA5 A;  3LK9 A;  2JRZ A;  3NS1 A;  5J29 A;  3N7P D;  5ALT A;  1LKY A;  2E8P A;  4P0Q B;  2Y0S F;  2C28 A;  1ZQR A;  4DSI A;  4QZD A;  3LWL A;  3IG5 A;  2YQE A;  4PHE A;  4LZD A;  4DQP A;  1Q46 A;  1HEK A;  4TQR A;  1V85 A;  4UW9 A;  4NLG A;  3CNH A;  5KT3 A;  2DKZ A;  2P6R A;  4UB2 A;  1N61 A;  5HHI A;  5KFH A;  1ZQL A;  5KG1 A;  1JMS A;  4ELV A;  3RH5 A;  1SZP A;  3FYH A;  4NL9 A;  2ZIU A;  4FS1 A;  3QYP A;  2PFP A;  2FMQ A;  2KIW A;  4QWC A;  4PH5 A;  4I2E A;  3MC1 A;  3KHL A;  4CRX A;  4BJQ A;  8ICA A;  1T94 A;  5KFZ A;  1U45 A;  2LYA A;  3TAQ A;  3PNC A;  2YMM A;  1X9W A;  7ICI A;  2HSZ A;  1ZQE A;  2K8B B;  5BPC A;  2IBK A;  4YD1 A;  5KFB A;  1ZQW A;  4UB6 U;  2J6U A;  2ZJ5 A;  2VIX A;  2CPR A;  5J2K A;  2BDP A;  1ZQT A;  2Y1I A;  4K4I A;  4KLI A;  3BQ0 A;  4F5R A;  2C2E A;  3K1R B;  5DQG A;  1QTM A;  1KQQ A;  1NK9 A;  5AK6 A;  2I9G A;  3EPG A;  8ICM A;  2LM4 A;  5KFN A;  4ED0 A;  5IIJ A;  2ASJ A;  2Y9T A;  4MHV A;  2PI5 A;  5ALN A;  3HP6 A;  4IRD A;  2AHO B;  4CE6 A;  1ZQF A;  3GDX A;  4RZR A;  3CP8 A;  4UBC A;  2XY5 A;  2O6K A;  1TAU A;  3TKA A;  1SXE A;  3HPO A;  5ALF A;  1OXJ A;  4YMO A;  5KG7 A;  2KIC A;  1K1Q A;  2BPF A;  5AI5 A;  1JAL A;  2EH9 A;  3U26 A;  4J9S A;  5ALZ A;  1L8L A;  5AHX A;  3WU2 U;  4EEN A;  4UAW A;  3CRX A;  4IQT A;  3CYM A;  4RQ3 A;  1Z00 B;  2K4H A;  4KLL A;  4EZ6 A;  2WF6 A;  5J2G A;  1NNL A;  1PVR A;  4KLT A;  3SEN A;  4PHD A;  2BPC A;  4X5V A;  3UXN A;  3OJU A;  5ALY A;  2V4Q A;  4BGD A;  2M9N A;  2ZJA A;  1PZN A;  3H8S A;  3TAD C;  1VDV A;  5AM1 A;  5J2A A;  4QZF A;  5DB6 A;  2UVU A;  4YXJ A;  1N2X A;  2OH2 A;  4B9U A;  3SI8 A;  5C0Y A;  1S0M A;  5GTH U;  4XQ8 A;  3ZDC A;  3ETR A;  1TE2 A;  2RDI A;  4PPX A;  2XGP A;  1KLN A;  1ED1 A;  3KBB A;  7ICN A;  8ICP A;  3RBE A;  2R18 A;  1DGJ A;  4NM2 A;  4CDG A;  7ICP A;  4C7Z A;  3H0L B;  1D8Y A;  4KLF A;  5ALM A;  2FI1 A;  4CF4 A;  3GII A;  3UXP A;  4UBB A;  4F91 B;  7ICK A;  3H40 A;  5D49 A;  3I1Y A;  4OD0 A;  4ECV A;  2XID A;  3GZF A;  8ICY A;  4MFC A;  1WYG A;  2NRT A;  1NJZ A;  1GO3 F;  2AGP A;  2KZ3 A;  1UQV A;  5EWG A;  3G6Y A;  2JEF A;  4KLJ A;  2J6T A;  1T3N A;  1ZD5 A;  3BS5 B;  5AK3 A;  3OSN A;  3PSI A;  3QNM A;  2EDU A;  3B0X A;  2B0C A;  3C21 A;  3L4P A;  5DGB A;  2KE7 A;  1ZD2 P;  5CJ7 A;  4DQS A;  3CW2 C;  4J9P A;  5DBB A;  2E8M A;  3M9N B;  3M8R A;  2G07 A;  4I2D A;  5ALQ A;  3TFR A;  3SR6 A;  2RDJ A;  2AH5 A;  2KP7 A;  5KG5 A;  1CRX A;  3QUC A;  4B9M A;  4GC6 A;  2A3V A;  4DWI A;  4QWB A;  5DGA A;  4A8E A;  3PSP A;  1RXW A;  4CF5 A;  3IV6 A;  2BKE A;  2QB1 A;  2W3R A;  5T14 A;  5KFQ A;  2GH1 A;  3PW0 A;  4NL9 C;  9ICM A;  3SMV A;  1RYR A;  2YML A;  3NVY A;  2NV3 A;  2G5I B;  1ZET A;  2WB1 F;  4QZC A;  2IHN A;  4O5C A;  1MQ3 A;  3KKA A;  4DLE A;  4FE3 A;  3NRZ A;  2D8C A;  7ICR A;  5KT7 A;  2YN4 A;  4PZN A;  2WAQ C;  5KFL A;  5HMM A;  4UAR A;  1N60 A;  1QQ5 A;  2HI0 A;  2PMZ F;  5AK5 A;  7ICG A;  2HHU A;  1Z1V A;  3MR5 A;  4O0I A;  2R8H A;  4IR9 A;  3AM9 A;  5J0S A;  5J2E A;  3PR5 B;  2NRV A;  4P0Q A;  2KFN A;  3N7R C;  1ECW A;  3QUT A;  1ZQM A;  1BPB A;  1PK3 A;  1ZQY A;  2KOB A;  2ZTC A;  5DKW A;  4YD2 A;  5AIA A;  2I5H A;  3PW2 A;  1D8B A;  4RUA A;  3THV A;  4M9H A;  3GIM A;  4UB5 A;  3MDA A;  2HBL A;  3JPR A;  2OYY A;  4J9R A;  2VJ5 A;  4FFD A;  2R8I A;  5J0U A;  4RQ0 A;  3PW5 A;  2W9M A;  5J2F A;  3IP4 B;  1MN8 A;  4NLK A;  7ICT A;  2AXT U;  1MC8 A;  1BPX A;  3AMZ A;  4DSE A;  4NWI A;  1RM6 C;  5DQH A;  2MU2 A;  2Q4T A;  2KKV A;  5J0P A;  3Q8S B;  4KLD A;  3GQC A;  4DL3 A;  2EZY A;  3JPT A;  1KSP A;  2YB1 A;  2IOF A;  2KEY A;  1TVA A;  3JPQ A;  2W8K A;  1BVS A;  2ZIW B;  4UAU A;  3EPI A;  5J0O A;  9ICG A;  2FPL A;  2DL0 A;  2NRX A;  3SEI A;  4EBD A;  5AKX A;  1L7P A;  3AN1 A;  1CEZ A;  3WKC A;  3GV8 B;  4DOB A;  4MEY A;  4KLM A;  3RJK A;  5EWF A;  4RQ6 A;  4M9G A;  1NK8 A;  1JX4 A;  9ICU A;  2B21 A;  1X66 A;  3RF9 A;  1YT3 A;  2W7O A;  3IM1 A;  2ALZ A;  5KFM A;  3MR2 A;  1KBU A;  3RJJ A;  4YR2 A;  5L9X A;  4NLZ A;  3Q8M A;  3E58 A;  4I27 A;  4USA A;  4O3Q A;  5J2J A;  3PO4 A;  2KKP A;  2BCU A;  5L1I A;  8ICH A;  3MAB A;  2GLE A;  1JUD A;  3GV7 B;  2AGQ A;  5AM5 A;  5EE3 A;  4DL6 A;  4IC9 A;  2DFL A;  3V72 A;  1U49 A;  1K5O A;  7ICO A;  4YFK A;  1RQN A;  4RQ2 A;  1EXN A;  2YX8 A;  3SZ2 A;  2ZIX A;  4F50 A;  2H3Z A;  5J2C A;  3V6J A;  1PUZ A;  4F2S A;  4KIT B;  4RNM A;  2G0A A;  2AQ4 A;  4UB1 A;  2QKQ A;  4LJX A;  3I76 A;  2PXI A;  4Q45 A;  4ECW A;  4R8U A;  2UVV A;  4OJL A;  5KFR A;  5J2B A;  5J2H A;  4J9K A;  3KZX A;  8ICK A;  3H7I A;  5KFS A;  4C8K A;  2HHX A;  4QWA A;  3F53 A;  3NVW A;  1NZP A;  4I28 A;  3RJF A;  3DV9 A;  1KTQ A;  4YG2 A;  2BDU A;  3HW8 A;  2PFO A;  3OGU A;  3PML A;  1NK6 A;  1JXL A;  1SKW A;  1PK1 A;  5J0Y A;  5ALP A;  3LVV A;  2HHW A;  3R9K A;  4I2F A;  4LZG A;  3TAD A;  1UA0 A;  2DWQ A;  1V9P A;  3GIJ A;  1X2I A;  4EEK A;  3ICX A;  3V7K A;  1SZH A;  1S10 A;  3BZK A;  5JRT A;  1KKX A;  3SYZ A;  4P0P B;  3E0F A;  4M47 A;  4I2I A;  3SD7 A;  1BNP A;  5KAI U;  1QH9 A;  5CB1 A;  3ED5 A;  1O03 A;  3C23 A;  2NRZ A;  1BPZ A;  4HAI A;  4BWJ A;  2ZTD A;  4EYH B;  4B9L A;  5DG7 A;  4ED1 A;  3UXO A;  5F3X B;  2NYV A;  2E8O A;  9ICC A;  2P66 A;  3M6Z A;  4DFP A;  2J6S A;  3IDW A;  1UA1 A;  2KIV A;  4Y2T A;  4Y2Y A;  2EAN A;  4Z6C A;  4G3I A;  1LVH A;  2BHN A;  5KFY A;  3OPX A;  3RH4 A;  5AKZ A;  1OUQ A;  4RUC A;  2I6X A;  8ICG A;  3Q8K A;  4UB4 A;  4F72 A;  3TAC B;  3QEB Z;  1X9M A;  4DSF A;  4DCC A;  4JB3 A;  5EE0 A;  7ICF A;  5C5J A;  4PL1 A;  4B9N A;  5CP2 A;  5ALL A;  2LYB A;  3QEA Z;  5J0W A;  3ZD8 A;  5AKE A;  3NTU A;  3RAQ A;  5AM2 A;  4CCH A;  3C1Y A;  3RB0 A;  8ICV A;  1ZQK A;  1FFU A;  2EAM A;  4NXZ A;  3FDS A;  3LYS A;  4FS2 A;  1NJX A;  2CXY A;  5AI4 A;  5KT2 A;  4M2Y A;  1L3V A;  2GO7 A;  4CGZ A;  4F5N A;  4NV0 A;  3O0F A;  4JWM A;  2BCQ A;  2AGO A;  2KZZ A;  1RDF A;  2LI6 A;  9ICO A;  3RBD A;  5IIK A;  4ED7 A;  3RR7 A;  3ZDD A;  2A19 A;  4I2A A;  2K4E A;  4F93 B;  2VJ4 A;  1SL0 A;  4F71 A;  2G08 A;  1XWL A;  2XY7 A;  5J0Q A;  4M9N A;  3WKE A;  4DL2 A;  2ATL A;  3UQ0 A;  3HKZ F;  8ICJ A;  5AIC A;  1L6N A;  5DG8 A;  1RYS A;  1ZQN A;  4YR0 A;  4OJP A;  2P35 A;  3QU9 A;  3T5K A;  3UPQ A;  2HHV A;  3B0Y A;  1KRP A;  2M0N A;  7ICM A;  4XUS A;  2W54 A;  2WF5 A;  1XO1 A;  3ZD9 A;  4LVS A;  4BXO B;  1WWV A;  3RRH A;  4QZB A;  4NLN A;  5B66 U;  4DFJ A;  5ALH A;  4IR1 A;  2VA2 A;  1B22 A;  4IQU A;  3T5J A;  1KFS A;  3UMC A;  2BGW A;  5ALG A;  3C2M A;  2Z7J A;  4GFJ A;  3C29 A;  3BQ7 A;  3TI0 A;  4QIW C;  3SV4 A;  4M6W B;  3H8M A;  1SWV A;  3WK4 A;  8ICF A;  1BPD A;  1J2N A;  3OHB A;  1PVQ A;  5KG3 A;  3C28 A;  5G5H A;  1UPH A;  1NJW A;  9ICV A;  2RQ5 A;  3WKD A;  5HHH A;  3WK5 A;  3WKB A;  2FLN A;  4UB3 A;  4IS7 A;  2FLL A;  2XVT A;  2W03 A;  1T3Q A;  2ZIW A;  2XC9 A;  3Q8P B;  3EWA A;  9ICT A;  3VCB A;  4UAZ A;  2WHE A;  4NM1 A;  3M1Y A;  2OEH A;  2V4R A;  5KG0 A;  2WF9 A;  3AEV A;  4C4T A;  4EBE A;  2HOI A;  5A0L A;  1SXD A;  1P7D A;  2W9B B;  1C20 A;  4F5O A;  5FP0 A;  2L5Y A;  5AM4 A;  4DL7 A;  1SGG A;  1U47 A;  1N48 A;  3C2L A;  2W43 A;  2MUT A;  5DB7 A;  1ZQA A;  3NRW A;  5DB8 A;  1WCL A;  2R8K A;  3H0R B;  3G6X A;  1D8L A;  7ICJ A;  3TAP A;  2HOQ A;  4B9V A;  2BQU A;  8ICQ A;  1ZQP A;  9ICP A;  2XY6 A;  4C8L A;  3N28 A;  1ZQD A;  3M8S A;  3AU2 A;  4DFM A;  1L7O A;  4GXI A;  1RPL A;  5CHG A;  5KL1 B;  4ED2 A;  4FO6 A;  2W3S A;  1COO A;  5ALX A;  2DF4 B;  3WK9 A;  3PO5 A;  4DL4 A;  3ISC A;  4YCX A;  1IG6 A;  3H8W A;  5KT5 A;  2JGA A;  2ISP A;  5KG6 A;  4QW8 A;  9ICF A;  4DSL A;  2W9A A;  2ZIV B;  2LKY A;  3H4D A;  9ICA A;  2MA1 A;  4XRH A;  2WB1 C;  1M6Y A;  4RT2 A;  5DLF A;  3RJG A;  3AQF A;  4M04 A;  3D6J A;  3PW7 A;  4M9L A;  1TAQ A;  2KV2 A;  5G5G A;  1B0X A;  3ORY A;  4KN7 A;  3RH6 A;  4ED6 A;  3HJE A;  4Y2V A;  4J9L A;  3RFA A;  4RQ8 A;  1ZJM A;  2CN1 A;  5TIS U;  8ICR A;  3K4G A;  3J81 j;  8ICE A;  1B43 A;  1H38 A;  2F8L A;  2NRW A;  2JV3 A;  4NY8 A;  4AYB F;  4RT3 A;  4DEZ A;  4M9J A;  1ZQ1 C;  4YN4 A;  4KMO B;  3QUQ A;  2E5S A;  2FMP A;  1COK A;  5AKH A;  3T3F A;  3AUO A;  4O5E A;  4DQI A;  2K4P A;  2BCR A;  4KLO A;  5AKJ A;  1Z3E B;  4ECZ A;  1Z4N A;  3T5H A;  2QAR B;  2F77 X;  2DPJ A;  5III A;  3RJE A;  2F76 X;  4DF4 A;  3H4B A;  2HMX A;  4GIB A;  3C5G A;  4DOC A;  4P0P A;  3KHG A;  5IIM A;  4C7Y A;  1V38 A;  3BQ2 A;  2JZB A;  5AK4 A;  1KN5 A;  4WJ3 B;  1V97 A;  1OW5 A;  3RRG A;  4QZA A;  2KNJ A;  4F92 B;  1IIP A;  1UHU A;  9ICI A;  5DB9 A;  4R66 A;  5AI6 A;  2HOF A;  8ICX A;  3BQT A;  5AI9 A;  3TQ1 A;  8ICO A;  3GV5 B;  2HDO A;  1A0P A;  2WF7 A;  3E2E A;  3BZC A;  2JHD A;  4QZ9 A;  2K60 A;  4ED3 A;  2A1J A;  1ZQJ A;  4DS4 A;  2ZIU B;  4FZM A;  1ZQQ A;  4IQW A;  4O5K A;  2EQY A;  2F1I A;  1SKR A;  2YMP A;  5DBA A;  4JV2 A;  4DOA A;  5EWE A;  2BQR A;  2BCV A;  1NK7 A;  1JI7 A;  9ICL A;  4B9S A;  9ICH A;  4BWM A;  1D9F A;  5AM3 A;  2W9C B;  2JXJ A;  2KHQ A;  3OTQ A;  4Z6E A;  3EUB 2;  3KOO A;  3C2K A;  7ICV A;  2LYH A;  2IOF K;  2KD1 A;  3F2C A;  4KLS A;  3KTQ A;  4UAV A;  5K4L A;  5J2I A;  5KT4 A;  3NGD A;  3IN5 A;  3SQI A;  1VLB A;  9ICN A;  1B4F A;  2HHS A;  3RB3 A;  2Q0Z X;  4GXJ A;  1FEZ A;  1S97 A;  2G09 A;  5ALW A;  4OO1 J;  4J03 A;  1FFV A;  1AQ6 A;  1WG8 A;  2F1H A;  5AKG A;  4O9M A;  5ALR A;  4US8 A;  3M6K A;  4P2H A;  1S76 D;  4RPX A;  1A6S A;  1TK5 A;  2I1Q A;  4Q43 A;  3BS7 A;  2ZXH A;  1DK2 A;  2KJ9 A;  4C8M A;  5EE9 A;  2D3D A;  3L3F X;  3HT3 A;  2UVW A;  4YQW A;  3PZP A;  2FE9 A;  3FC4 A;  3RB4 A;  3NVV A;  1J2M A;  2QB0 B;  2WAQ F;  4P4P A;  4BXO A;  3M9M B;  1XSP A;  1T7P A;  4I2G A;  2DGZ A;  2YTU A;  1JRO A;  1SL1 A;  1SV4 A;  5HML A;  4BUG A;  4KX5 A;  2IHM A;  1TV9 A;  1S0V A;  3EYZ A;  5JUM A;  2B6G A;  2JMG A;  2LPE A;  2WTF A;  4ECR A;  3VC8 A;  1MA7 A;  3WK7 A;  2BCS A;  4C8N A;  1D9D A;  4EZ9 A;  1ZQG A;  1L5U A;  2GOL A;  4M6W A;  2OWO A;  4F4Z A;  1KL9 A;  2NO5 A;  4MF8 A;  5KFA A;  2KFZ A;  7ICL A;  2BZF A;  4F2R A;  4F3O A;  3BQ1 A;  4KTQ A;  5KG2 A;  4JUZ A;  2XI9 A;  5KFG A;  3S6J A;  5BOL A;  2ZUC A;  7ICQ A;  4FZL A;  1ZQX A;  1WUD A;  3LVW A;  1DRG A;  5AI8 A;  2F8K A;  2K4I A;  5KTQ A;  4Z6F A;  1Y88 A;  1Q8K A;  5KFV A;  4YVZ A;  4TUR A;  3UMG A;  4DQQ A;  3RB6 A;  3JPP A;  2RP5 A;  5KFE A;  2ASL A;  5J0X A;  1ZRN A;  1XS9 D;  2LM1 A;  1N56 A;  4DSK A;  2KJ5 A;  7ICE A;  2E3T A;  1ZRM A;  1URJ A;  4ECU A;  1S0O A;  3G6V A;  4KMU A;  1JRP A;  5AKI A;  1Z00 A;  5L1L A;  2W9B A;  5ALI A;  2ZJ8 A;  1U9L A;  4RQ4 A;  2JEJ A;  1SIJ A;  4UB8 U;  2KMD A;  2K8A A;  2PI4 A;  8ICL A;  2F1J A;  2VKQ A;  5H2F U;  5AI0 A;  3N7S C;  2F2A B;  1WCN A;  4IQV A;  2EZZ A;  5KG4 A;  3FM9 A;  2ZUB A;  3WKA A;  3A0B U;  1F5S A;  2Y0S C;  2RLT A;  3MDC A;  4JMU A;  3V6K A;  3D2N A;  2BR0 A;  5KFW A;  2QLT A;  3ETL A;  1RG6 A;  4ECY A;  4O3M A;  2R8G A;  1KEJ A;  2JH1 A;  1ZQO A;  2W11 A;  3KFU F;  9ICJ A;  4BDP A;  3IHQ B;  4O3P A;  1XU4 A;  3H8J A;  3QU2 A;  3V6H A;  1ZQH A;  3V7J A;  2ZIV A;  4EX7 A;  2ISO A;  4US9 A;  1BGX T;  3GIK A;  3N97 B;  3ZDA A;  4OJ6 A;  1RZT A;  3SV3 A;  8ICU A;  4OCZ A;  1S8O A;  4JK1 A;  4I2H A;  4Q8E A;  3BS5 A;  1PVP A;  4J9Q A;  5CRX A;  4DQR A;  4YMM A;  3A0H U;  3SAH A;  4M0A A;  4ELT A;  4I29 A;  1HIW A;  2KJ8 A;  4ICA A;  4Y2S A;  3QUB A;  1QLN A;  1X9X A;  4Y2J A;  5KFD A;  4MFA A;  1JIH A;  1NK4 A;  3MGI A;  3GIL A;  5J0T A;  4QWE A;  1L8O A;  3GFK B;  3DEE A;  1U48 A;  2FPM A;  5HNK A;  4U7C A;  4IRC A;  5HR6 A;  1F0M A;  1QSL A;  2YMQ A;  3PX6 A;  2W7P A;  4F5Q A;  3QXG A;  1UT5 A;  3NAS A;  2ZUD A;  3L5K A;  1VJ5 A;  1Q3U A;  4EEL A;  3PX0 A;  4R64 A;  2IMW P;  9ICX A;  1L3T A;  1SWW A;  4GLX A;  3MR3 A;  2PFQ A;  3F5E A;  1YZ7 A;  8ICZ A;  2OXO A;  2KVC A;  4ECX A;  4J9O A;  2XIC A;  4YR3 A;  1ZOL A;  4RNN A;  1N5X A;  2RRD A;  5L1M A;  3D2Q A;  2KSO B;  1DGS A;  3RJI A;  1ZXI A;  3WK8 A;  2WFA A;  2C2R A;  3B9J A;  1DXS A;  9ICQ A;  1KFT A;  1L3U A;  3NVZ A;  8ICN A;  3HIL A;  4TUS A;  1NKC A;  2H5X A;  5ALO A;  2H3Q A;  4PHP A;  2W9C A;  5KFI A;  2G5H B;  1NK0 A;  4ZH4 A;  3RJH A;  5DG9 A;  4O3S A;  1NZB A;  2OCE A;  3LDA A;  1S9F A;  2ZXI A;  2JEG A;  5AKK A;  5D46 A;  5B5E U;  2XGQ A;  4J9N A;  4YXM A;  3MGH A;  1TKD A;  4RPY A;  4R63 A;  2KVS A;  9ICS A;  2IOH A;  3TFS A;  2IA6 A;  4UAY A;  5EE1 A;  1ZYQ A;  2KN7 A;  2G06 A;  3UQ2 A;  2WF8 A;  5AIB A;  3ISB A;  2N1R A;  1NK5 A;  1IXR A;  3SAG A;  5KNI A;  4UAS A;  2R8J A;  3IG8 A;  5F9N A;  4NLB A;  5ALE A;  1L7M A;  1TK0 A;  3TAR A;  2UVR A;  2QB0 A;  5HP4 A;  1X9S A;  1NKB A;  8ICW A;  5E79 U;  2ZIX B;  3F2B A;  3AL0 B;  4PGQ A;  2XCA A;  3FAH A;  1ZQV A;  3KZI U;  4Z6D A;  1ZD4 A;  3ZI4 A;  3Q8R B;  4PGX A;  5JTI A;  4MFF A;  4Y2P A;  5ALU A;  5ALK A;  4K4H A;  4R8U B;  2JEI A;  1IM4 A;  3OJS A;  1N63 A;  4QNL A;  4AYB C;  5DDM A;  2RHF A;  1NI3 A;  4ECT A;  3F5A A;  1SV0 A;  3PMN A;  4DL5 A;  5JU5 A;  1UCV A;  2DUY A;  1XSN A;  3ZDB A;  4Y2R A;  1LB2 B;  3NUQ A;  1PK1 B;  4JV1 A;  3UMB A;  5KFT A;  1CUK A;  5IIN A;  1NOM A;  3GU3 A;  4QIW F;  1XSL A;  2ESE A;  4E0D A;  3K75 D;  2DBY A;  4UAT A;  4C4S A;  2HBK A;  3KHH A;  4P4M A;  3PV8 A;  1MSW D;  3PR4 A;  8ICB A;  2EZX A;  3Q8Q B;  3QU7 A;  1T4G A;  4GC7 A;  4AP9 A;  3RTV A;  1Z19 A;  2HW3 A;  4R65 A;  1KDH A;  2HHT A;  4JV0 A;  1SKS A;  1FIQ A;  4KLH A;  2BPG A;  4FZN A;  3OHA A;  1S5L U;  1N62 A;  3HX0 A;  4ELU A;  3MFI A;  2HVH A;  4MF2 A;  1KW4 A;  2KZM A;  3ALR A;  4I2B A;  1BPY A;  3OSP A;  1IV8 A;  1XC9 A;  4O3N A;  1HUZ A;  4CF3 A;  3HRD D;  5J0R A;  2PMZ C;  2D6F C;  5AM0 A;  1HUO A;  4HYK A;  4YMN A;  4C8O A;  1X6J A;  2FDR A;  5ALJ A;  9ICE A;  5KFP A;  3KD3 A;  3H0M B;  1NKE A;  4KLU A;  4RQ1 A;  4QWD A;  5J8Y C;  3T5L A;  1JXE A;  8ICI A;  2A1A A;  1N5W A;  3QU4 A;  2VA8 A;  1Q3V A;  4DFD A;  1J97 A;  4RPZ A;  4NLC A;  2OM6 A;  1Z1B A;  1LKY B;  1HJP A;  2ZG6 A;  1QSS A;  3PW4 A;  1SL2 A;  3ONN A;  1L3S A;  4U6P A;  5ALD A;  4RQ7 A;  2YY6 A;  2HBM A;  5EOZ A;  1S0N A;  1ZQZ A;  1DK3 A;  1SB3 C;  3UM9 A;  1U4B A;  4IL6 U;  5KFF A;  2E1E A;  5AKL A;  3QE9 Y;  2E1F A;  5KAF U;  4JWN A;  2HHQ A;  4ZOH C;  1FO4 A;  4MEX A;  4K4G A;  1Z4O A;  4QZE A;  4Q44 A;  2F44 A;  9ICK A;  4QJF B;  1ZQU A;  2ES6 A;  5DQI A;  1RXV A;  3QZ7 A;  2MSN A;  4C4R A;  1L7N A;  2DKX A;  3WK6 A;  1BNO A;  2FMS A;  3M9O B;  5CR0 A;  1TK8 A;  2P6U A;  1LV5 A;  5KFX A;  9ICW A;  4FBU A;  1QQ7 A;  1A76 A;  4F4W A;  4CNQ A;  2Y9U A;  3C5F A;  2HVI A;  4PJ0 U;  1A77 A;  4B6J A;  2E8N A;  4TUP A;  3C1Z A;  2HCF A;  4F4X A;  2H3V A;  2OHF A;  5GTI U;  5CA7 A;  4IRK A;  1XNS A;  4PL2 A;  2ODG A;  4Y2X A;  3JPN A;  4BX9 C; 
#chains in the Genus database with same CATH homology
 3MFH A;  8ICL A;  2F1J A;  2V9W A;  3RBE A;  1RYS A;  1ZQN A;  5DDY A;  4NM2 A;  5KFU A;  4YR0 A;  1ZQB A;  7ICP A;  3T5K A;  3UPQ A;  1D8Y A;  2HHV A;  4DO9 A;  4KLF A;  3B0Y A;  1WCN A;  3PX4 A;  4IQV A;  4EYI B;  1KRP A;  2ZTE A;  7ICM A;  4XUS A;  5KG4 A;  2MAX A;  1XO1 A;  1NJY A;  4KLE A;  9ICO A;  2ZUB A;  3ZD9 A;  4LVS A;  4BXO B;  3GII A;  3RRH A;  4QZB A;  3UXP A;  4UBB A;  4NLN A;  1ARO P;  3MDC A;  4F91 B;  7ICK A;  4DFJ A;  3H40 A;  5F9L A;  5D49 A;  4YP3 A;  3V6K A;  3N4M B;  1ZJN A;  1MQ2 A;  4ECV A;  4PGY A;  2BR0 A;  8ICY A;  4MFC A;  5KFW A;  5KFJ A;  2NRT A;  3ETL A;  4ECY A;  4IR1 A;  2VA2 A;  1B22 A;  4IQU A;  1KEJ A;  3T5J A;  1NJZ A;  1KFS A;  2R8G A;  5TZV A;  2AGP A;  2BGW A;  2KZ3 A;  2C2D A;  1ZQO A;  5EWG A;  3G6Y A;  3C2M A;  2JEF A;  4KLJ A;  9ICJ A;  4BDP A;  2J6T A;  1T3N A;  7ICU A;  3IHQ B;  4O3P A;  5KT6 A;  3OSN A;  5J2D A;  1XU4 A;  3H8J A;  3TI0 A;  3KHR A;  3SV4 A;  4M6W B;  3V6H A;  1ZQH A;  3V7J A;  8ICF A;  3B0X A;  1BPD A;  3OHB A;  4P4O A;  2ISO A;  2DPI A;  1BGX T;  2FLP A;  4UQG A;  3GIK A;  4GXK A;  3C21 A;  1ZQS A;  5CWR A;  5DGB A;  3N97 B;  1RZT A;  3ZDA A;  5KG3 A;  5CJ7 A;  5KFO A;  2ASD A;  1NJW A;  2W8L A;  3SV3 A;  1T8E A;  4DQS A;  8ICU A;  9ICV A;  4J9P A;  5DBB A;  4JK1 A;  9ICR A;  3M9N B;  3M8R A;  5HHH A;  4I2H A;  4I2D A;  4DS5 A;  4F4K A;  3TFR A;  4Q8E A;  2FLN A;  5BOM A;  4J9Q A;  4UB3 A;  4DQR A;  4YMM A;  2RDJ A;  2FLL A;  4M0A A;  3LWM A;  5KG5 A;  2XC9 A;  3Q8P B;  4ELT A;  3EWA A;  4I29 A;  4B9M A;  1DOQ A;  9ICT A;  4GC6 A;  4DWI A;  4UAZ A;  4QWB A;  5DGA A;  2MUT B;  4NM1 A;  1QLN A;  2V4R A;  5KFD A;  5KG0 A;  5L1K A;  1RXW A;  4EBE A;  2BKE A;  2FPK A;  5KFQ A;  3PW0 A;  3RAX A;  4MFA A;  1JIH A;  1NK4 A;  3MGI A;  9ICM A;  3GIL A;  1RYR A;  5J0T A;  4QWE A;  2W9B B;  3Q8L A;  1ZET A;  4F5O A;  4RNO A;  4QZC A;  3ISD A;  3GFK B;  2VA3 A;  2IHN A;  4DL7 A;  4O5C A;  4BXO A;  1U48 A;  2FPM A;  5HNK A;  1U47 A;  1MQ3 A;  4DLE A;  1N48 A;  4IRC A;  2AU0 A;  2XCP A;  3C2L A;  1QSL A;  2MUT A;  5KT7 A;  7ICR A;  5DB7 A;  2VAN A;  4QZG A;  3PX6 A;  1UT8 A;  1ZQA A;  4F5Q A;  4O3R A;  5KFL A;  2PFN A;  4DLG A;  1UT5 A;  5DB8 A;  5KFC A;  2ZUD A;  1WCL A;  5HMM A;  2R8K A;  3RR8 A;  4QW9 A;  3BDP A;  3PX0 A;  3G6X A;  1D8L A;  7ICJ A;  4R64 A;  2IMW P;  9ICX A;  1L3T A;  3TAP A;  4B9T A;  7ICG A;  3JPS A;  4DSJ A;  2HHU A;  4B9V A;  4GLX A;  2BQU A;  8ICQ A;  1ZQP A;  9ICP A;  3MR3 A;  2PFQ A;  2XY6 A;  4C8L A;  1ZQD A;  3MR5 A;  4O0I A;  3M8S A;  2R8H A;  4QZI A;  4IR9 A;  3AU2 A;  8ICZ A;  1KFD A;  9ICB A;  5J0S A;  1ZQC A;  2BQ3 A;  5J2E A;  4DFM A;  4ECX A;  1RPL A;  4QZH A;  4J9O A;  4GXI A;  5CHG A;  4ED2 A;  4FO6 A;  4YR3 A;  2NRV A;  3PR5 B;  3PY8 A;  2KTQ A;  2KFN A;  4RNN A;  1COO A;  4I2C A;  1ZQM A;  4DFK A;  4Q8F A;  1BPB A;  1ZQY A;  2ZTC A;  5DKW A;  4YD2 A;  5DBC A;  3PW2 A;  3EZ5 A;  4RUA A;  4ED8 A;  3THV A;  3PO5 A;  4M9H A;  3TAN A;  3GIM A;  4F8R A;  1DGS A;  2AQ0 A;  4UB5 A;  3RJI A;  4I2J A;  4DL4 A;  4YCX A;  3ISC A;  3MDA A;  2C2R A;  4O3O A;  3H8W A;  5KT5 A;  9ICQ A;  3JPR A;  2ISP A;  3QZ8 A;  4J9R A;  1KFT A;  5KG6 A;  2R8I A;  4QW8 A;  8ICC A;  5J0U A;  9ICF A;  4KLQ A;  4DSL A;  1L3U A;  4KLG A;  4RQ0 A;  3AU6 A;  8ICS A;  2W9A A;  8ICN A;  4TUS A;  1NKC A;  2H5X A;  4PHP A;  3PW5 A;  3H4D A;  9ICA A;  2W9M A;  5J2F A;  2W9C A;  4NLK A;  3ZDE A;  7ICT A;  4XRH A;  5KFI A;  3MR6 A;  1NK0 A;  1MC8 A;  1BPX A;  4RT2 A;  4DSE A;  5DLF A;  3PVX A;  3RJG A;  4TUQ A;  2C22 A;  5DQH A;  4DF8 A;  4M04 A;  3PW7 A;  4ZH4 A;  3RJH A;  5DG9 A;  4M9L A;  5J0P A;  3Q8S B;  1TAQ A;  4KLD A;  4O3S A;  3GQC A;  3ORY A;  3LDA A;  4KN7 A;  3RH6 A;  4ED6 A;  1S9F A;  4DL3 A;  3JPT A;  3HWT A;  4J9L A;  4RQ8 A;  1KSP A;  3BJY A;  1ZJM A;  4EEY A;  2JEG A;  1TVA A;  8ICR A;  5D46 A;  3JPQ A;  3K4G A;  8ICE A;  2XGQ A;  1B43 A;  4YXM A;  1BVS A;  4RQ5 A;  2W8K A;  4J9N A;  2NRW A;  3MGH A;  1H38 A;  4NY8 A;  4RU9 A;  4ECQ A;  4QZ8 A;  4PHA A;  3V7L A;  4DEZ A;  4RT3 A;  1TKD A;  2GWS A;  4M9J A;  4RPY A;  3EPI A;  4YN4 A;  5J0O A;  4R63 A;  2FMP A;  2JZB B;  9ICS A;  3T3F A;  9ICG A;  2FPL A;  3AUO A;  4O5E A;  1TFR A;  2NRX A;  3TFS A;  3EW9 A;  4DQI A;  2BCR A;  4EBD A;  4UAY A;  2IA6 A;  3MBY A;  8ICT A;  1ZYQ A;  4EBC A;  4KLO A;  7ICH A;  2KN7 A;  1CEZ A;  1Z3E B;  3GV8 B;  4ECZ A;  3T5H A;  2XO7 A;  4MEY A;  3UQ2 A;  4DOB A;  3RJK A;  4KLM A;  2AJQ A;  5EWF A;  4RQ6 A;  1K1S A;  4M9G A;  3ISB A;  5L1J A;  1NK8 A;  2DPJ A;  4TQS A;  1JX4 A;  9ICU A;  1BPE A;  2B21 A;  5III A;  3RJE A;  4J9M A;  4DF4 A;  1NK5 A;  3H4B A;  5D4B A;  1IXR A;  1ZQI A;  3C5G A;  4KN4 A;  4DOC A;  5IIL A;  1JN3 A;  4FBT A;  3KHG A;  5IIM A;  1QSY A;  3IM1 A;  3JPO A;  5KFM A;  5KFK A;  2ALZ A;  5F9N A;  2JZB A;  5DLG A;  3BQ2 A;  4F4Y A;  4F5P A;  3MR2 A;  1TK0 A;  4ECS A;  3RJJ A;  3TAR A;  1C7Y A;  4QZA A;  3RRG A;  4YR2 A;  1S77 D;  2UVR A;  5IIO A;  5HP4 A;  7ICS A;  4F92 B;  1X9S A;  5L9X A;  4NLZ A;  9ICI A;  5DB9 A;  4R66 A;  3Q8M A;  2A1J B;  1NKB A;  8ICW A;  8ICX A;  4I27 A;  2Y1J A;  4PGQ A;  4XA5 A;  2XCA A;  4O3Q A;  5J2J A;  3PO4 A;  3LK9 A;  1ZQV A;  4Z6D A;  5L1I A;  2BCU A;  3Q8R B;  8ICH A;  3MAB A;  4PGX A;  3GV7 B;  5J29 A;  3BQT A;  2AGQ A;  4MFF A;  3TQ1 A;  8ICO A;  4DL6 A;  3GV5 B;  2DFL A;  3V72 A;  3E2E A;  4K4H A;  4R8U B;  1U49 A;  2JEI A;  2C28 A;  1IM4 A;  4YFK A;  4RQ2 A;  7ICO A;  3OJS A;  1ZQR A;  4DSI A;  4QZD A;  1EXN A;  3LWL A;  4QZ9 A;  4ED3 A;  5DDM A;  2A1J A;  1ZQJ A;  3SZ2 A;  4DS4 A;  4PHE A;  4LZD A;  4DQP A;  1ZQQ A;  4IQW A;  4ECT A;  4F50 A;  5J2C A;  3PMN A;  2F1I A;  3V6J A;  4DL5 A;  1SKR A;  4F2S A;  4O5K A;  4TQR A;  1XSN A;  5DBA A;  3ZDB A;  1LB2 B;  4NLG A;  4JV2 A;  4DOA A;  5EWE A;  4KIT B;  4RNM A;  2BQR A;  2BCV A;  1NK7 A;  5KT3 A;  9ICL A;  2P6R A;  4JV1 A;  2AQ4 A;  4UB2 A;  4UB1 A;  4B9S A;  5KFT A;  9ICH A;  1CUK A;  4BWM A;  1D9F A;  5HHI A;  4Q45 A;  2PXI A;  4R8U A;  1NOM A;  5KFH A;  2W9C B;  4ECW A;  5KG1 A;  5IIN A;  1XSL A;  1ZQL A;  1JMS A;  2UVV A;  4ELV A;  5KFR A;  5J2B A;  5J2H A;  4J9K A;  3RH5 A;  4E0D A;  8ICK A;  3H7I A;  5KFS A;  3K75 D;  4Z6E A;  1SZP A;  4C8K A;  3FYH A;  2HHX A;  3C2K A;  7ICV A;  3KHH A;  4QWA A;  4P4M A;  2LYH A;  3PV8 A;  4FS1 A;  4I28 A;  1MSW D;  3PR4 A;  3RJF A;  4KLS A;  1KTQ A;  4YG2 A;  3Q8Q B;  3HW8 A;  2PFO A;  2PFP A;  8ICB A;  3OGU A;  3PML A;  1NK6 A;  1JXL A;  2FMQ A;  3KTQ A;  4QWC A;  1T4G A;  4GC7 A;  4PH5 A;  1SKW A;  5J2I A;  5KT4 A;  3NGD A;  4I2E A;  3RTV A;  2HW3 A;  4R65 A;  1KDH A;  5J0Y A;  2HHT A;  9ICN A;  4JV0 A;  1SKS A;  3KHL A;  4KLH A;  2HHS A;  2BPG A;  2HHW A;  3RB3 A;  2Q0Z X;  4GXJ A;  8ICA A;  2R8J A;  5KFZ A;  3OHA A;  1S97 A;  1U45 A;  3HX0 A;  4I2F A;  4LZG A;  1UA0 A;  3TAQ A;  4ELU A;  1V9P A;  3PNC A;  3MFI A;  3GIJ A;  1X9W A;  2HVH A;  7ICI A;  1X2I A;  4MF2 A;  1ZQE A;  2F1H A;  4O9M A;  5BPC A;  2IBK A;  4YD1 A;  2KZM A;  5KFB A;  1ZQW A;  4I2B A;  1BPY A;  4P2H A;  3OSP A;  2ZJ5 A;  4RPX A;  3V7K A;  2J6U A;  1S76 D;  1XC9 A;  4O3N A;  5J2K A;  1HUZ A;  1TK5 A;  2I1Q A;  4Q43 A;  2BDP A;  5J0R A;  1ZQT A;  1HUO A;  4HYK A;  1S10 A;  4YMN A;  4C8O A;  3SYZ A;  2Y1I A;  4K4I A;  4C8M A;  4KLI A;  3BQ0 A;  4F5R A;  2C2E A;  4M47 A;  9ICE A;  5KFP A;  3HT3 A;  4I2I A;  2UVW A;  4YQW A;  5DQG A;  1NKE A;  1QTM A;  4KLU A;  4RQ1 A;  5CB1 A;  4QWD A;  1NK9 A;  3RB4 A;  2I9G A;  3EPG A;  3T5L A;  8ICM A;  1JXE A;  8ICI A;  3C23 A;  2NRZ A;  4P4P A;  1BPZ A;  4BWJ A;  2ZTD A;  3M9M B;  5KFN A;  4EYH B;  4ED0 A;  4ED1 A;  5DG7 A;  1XSP A;  1T7P A;  4B9L A;  3UXO A;  4I2G A;  2VA8 A;  1SL1 A;  5IIJ A;  2ASJ A;  2PI5 A;  5HML A;  9ICC A;  3HP6 A;  2P66 A;  4IRD A;  4RPZ A;  4DFP A;  2IHM A;  1TV9 A;  1S0V A;  2J6S A;  1UA1 A;  3EYZ A;  5JUM A;  1ZQF A;  4ECR A;  2WTF A;  3GDX A;  1HJP A;  4RZR A;  1QSS A;  3PW4 A;  1SL2 A;  2BCS A;  4UBC A;  4Z6C A;  4C8N A;  1D9D A;  4EZ9 A;  2BHN A;  5KFY A;  1ZQG A;  1L5U A;  4G3I A;  2XY5 A;  1L3S A;  1TAU A;  4RQ7 A;  3HPO A;  3RH4 A;  4M6W A;  5EOZ A;  4YMO A;  4RUC A;  1S0N A;  2OWO A;  8ICG A;  5KG7 A;  3Q8K A;  4UB4 A;  4F4Z A;  1ZQZ A;  1K1Q A;  4MF8 A;  5KFA A;  3QEB Z;  2BPF A;  1X9M A;  2KFZ A;  7ICL A;  1U4B A;  4DSF A;  7ICF A;  5KFF A;  5C5J A;  4F2R A;  4B9N A;  4F3O A;  5CP2 A;  3BQ1 A;  4J9S A;  4KTQ A;  5KG2 A;  3QE9 Y;  4JUZ A;  5KFG A;  3QEA Z;  5J0W A;  4JWN A;  2HHQ A;  4UAW A;  3ZD8 A;  3NTU A;  5BOL A;  4IQT A;  2ZUC A;  3C1Y A;  3RB0 A;  3RAQ A;  4CCH A;  4MEX A;  1ZQK A;  8ICV A;  7ICQ A;  4RQ3 A;  1Z00 B;  1ZQX A;  4K4G A;  4KLL A;  4EZ6 A;  4QZE A;  4NXZ A;  3FDS A;  5J2G A;  4KLT A;  4Q44 A;  4FS2 A;  1NJX A;  9ICK A;  1ZQU A;  4Z6F A;  1Y88 A;  5KFV A;  5KTQ A;  5KT2 A;  4PHD A;  4M2Y A;  5DQI A;  1L3V A;  4YVZ A;  2BPC A;  4TUR A;  3QZ7 A;  4DQQ A;  1RXV A;  3RB6 A;  3JPP A;  4X5V A;  5KFE A;  3UXN A;  3OJU A;  2ASL A;  5J0X A;  4F5N A;  1XS9 D;  4JWM A;  2V4Q A;  4BGD A;  1N56 A;  2BCQ A;  2AGO A;  2KZZ A;  4DSK A;  2M9N A;  2ZJA A;  7ICE A;  1PZN A;  3H8S A;  2FMS A;  4ECU A;  5J2A A;  5CR0 A;  3M9O B;  1TK8 A;  4QZF A;  5IIK A;  3G6V A;  4KMU A;  4ED7 A;  3RBD A;  2P6U A;  1S0O A;  1LV5 A;  5DB6 A;  3RR7 A;  3ZDD A;  2UVU A;  1Z00 A;  5KFX A;  4YXJ A;  5L1L A;  9ICW A;  4FBU A;  2W9B A;  4I2A A;  1A76 A;  4F93 B;  4F4W A;  1SL0 A;  2ZJ8 A;  3C5F A;  4B9U A;  1U9L A;  3SI8 A;  2HVI A;  4RQ4 A;  1S0M A;  2JEJ A;  1A77 A;  1XWL A;  4TUP A;  2XY7 A;  3C1Z A;  4XQ8 A;  3ZDC A;  4F4X A;  5J0Q A;  4M9N A;  4DL2 A;  2RDI A;  5CA7 A;  2PI4 A;  4IRK A;  4PPX A;  2XGP A;  2ATL A;  1KLN A;  3UQ0 A;  8ICJ A;  3JPN A;  7ICN A;  8ICP A;  5DG8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...