2AQ5A

Crystal structure of murine coronin-1
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
395
structure length
390
Chain Sequence
SSKFRHVFGQPAKADQCYEDVRVSQTTWDSGFCAVNPKFMALIEASGGGAFLVLPLGKTGRVDKNVPLVGHTAPVLDIAWPHNDNVIASGSEDCTVMVWEIPDGGLVLPLREPVITLEGHTKRVGIVAWHPTAQNVLLSAGDNVILVWDVGTGAAVLTLGPDVHPDTIYSVDWSRDGALICTSCRDKRVRVIEPRKGTVVAEKDRPHEGTRPVHAVFVSEGKILTTGFSRMSERQVALWDTKHLEEPLSLQELDTSSGVLLPFFDPDTNIVYLCGKGDSSIRYFEITSEAPFLHYLSMFSSKESQRGMGYMPKRGLEVNKEIARFYKLHERKCEPIAMTVPRKSDLFQEDLYPPTAGPDPALTAEEWLGGRDAGPLLISLKDGYVPPKSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Coronin-1A
publication title The crystal structure of murine coronin-1: a regulator of actin cytoskeletal dynamics in lymphocytes.
pubmed doi rcsb
source organism Mus musculus
molecule tags Structural protein
total genus 96
structure length 390
sequence length 395
ec nomenclature
pdb deposition date 2005-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
A PF08953 DUF1899 Domain of unknown function (DUF1899)
A PF16300 WD40_4 Type of WD40 repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2aq5A01
4J77A 3JRPA 2YB8B 2AH0A 1GP2B 3DWLC 3P4FA 1S4UX 2QXVA 2H47A 2W18A 4GGCA 3I7HA 1B9YA 2HXCA 3SFZA 3PXTD 3AL8A 3EMHA 4A0BA 3OL2A 5FKRA 2GC4A 1NR0A 3EWEA 2H9LA 4QT8A 2Z2NA 1PI6A 1JMZB 3E0CA 4J0XA 3UVKA 1QNIA 2HJ4A 4CZVA 4A7JA 2P9SC 4FB1D 2OK6A 2EBSA 4XYIA 4FHLA 4PBYA 2Z2OA 4ZOVA 4FA9D 5THAA 5EM2B 4O1QD 3RSEC 2G99A 3UVLA 4CY2A 3PVUB 4O45A 5TEEA 2IUPA 2HKMA 5C2VB 4I79A 2OVQB 4PXWA 3I7OA 4X63B 4FA4D 3VH0A 4U1EI 4O3TB 5HE1B 5JWZA 4XYHA 3EG6A 1K8KC 5HE0B 2XYIA 4CY5A 1VYHC 5FXYA 4ESGA 3UKUC 4EWRA 3SHFA 1GG2B 3W15A 3U4YA 4K3JB 3K27A 4L9OA 4ERZA 4E5ZA 3BG0A 3V9FA 5EMKB 5CXBB 4CZYA 4D6VA 1NEXB 3J81g 4PBZA 4JSXC 3MXXA 4K3ID 2B4EA 4J79A 4UI9R 4Y5RD 1XHMA 5H17A 4FAVD 3KRXB 2YBAA 5EM2A 4PC0A 2H6NA 4ZOXA 5IGOA 3RMZD 3EI1A 3SLED 3C75H 2OIZA 1Q47A 4J82A 4OZUA 2GNQA 5I5IA 4J81A 2AH1A 5EARA 5IT9g 2PM9B 2AGWA 2I0SA 3RN1D 4J0WA 1R5MA 3IJ0A 2IUVA 2XL3A 4JXMA 2P9KC 4OWRA 4J8GA 3I8CA 4CZXA 4CY1A 3F3FA 2G9AA 3OKWA 5TEFA 4L3HD 3RLMD 4A11A 4FA5D 4GQ1A 2QC5A 3OKYB 1JOFA 3UR4A 3B7FA 4CI8A 3UKRC 3BWSA 5HE2B 4A09B 2TRCB 5FKTA 4BH6A 5EAMA 5IGQA 4YVDA 3PE7A 5CXBA 3OTTA 1N6EA 4GGDA 4A2LA 4G56B 2H6KA 5CYKB 2PM6B 4PSWB 3GREA 2H9PA 3SBRA 5C2WB 4NSXA 2I3SA 3AFCA 3RRMC 1YFQA 2PBIB 3V7DB 4HDJA 3IJCA 4J86A 2YNNA 2H9NA 4U7AA 3JROA 5AFU3 2P9UC 3C5MA 3HFQA 3RN0D 4N14A 3L4OD 2I0TA 2P9PC 2PM9A 4FWWA 5IJ8E 4JD2C 1P22A 2BCJB 1SQJA 2J56H 2J57G 3OW8A 5K1CC 2H3XA 4ZOYA 4X61B 1K32A 4A0AB 4QL1A 2YNPA 2HKRA 1PBYB 3F3GA 3MMYA 3DM0A 3AL9A 2I0RA 3VA6A 2AGZA 2P9NC 3GFCA 4GQBB 4L3GD 2AGXA 2XL2A 4Z8LA 4QRJA 3EI4B 5K19A 3I7KA 3EI3B 4O3UB 4A09A 4Y7RA 4GM9A 2P9LC 3MKSB 3UVOA 1XKSA 4A08B 3IIYA 3SCYA 2GC7A 3ORVD 4J84A 2Z2PA 2PM7B 2IURA 3I89A 5C9ZB 5GMKn 2CNXA 5IC7A 5CYKA 4R7AB 4ZN4A 3UVNA 2H6QA 5FKSA 3DXKC 5B4WA 2H68A 1MG2A 4TZ4A 5FQDA 3C9CA 5SXMA 5CXCB 4CC9A 3EU7A 5AJAA 2UZYB 2HESX 3KRWB 3V5WB 3ULEC 4ES0A 4H5JA 2MTAH 3DXMC 1SQ9A 3FGBA 3MKQA 4KFMB 4CY3A 4O9DA 5TDHB 2IWFA 3RFHA 3BG1A 2IUQA 5HYNB 4LGNA 1GXRA 5GSAA 3NVQA 3CIKB 1XIPA 1PEVA 3L4MD 5EMMB 1FWXA 3I2NA 3FM0A 4AOWA 4JT6C 4J73A 5H14A 1U2VC 3EI4A 2H14A 4GM3A 3EI3A 3SXTD 4FAND 1A0RB 2H13A 5EAPA 4A08A 1U4CA 4IMMA 2HJBA 4LG9A 3FRXA 4L1QD 3IJ1A 2H9MA 3SJLD 2B5MA 4GGAA 1B9XA 5HQGA 1OLZA 3PXWD 3F3PA 2OVRB 1N6DA 4BL0A 5A2Qg 2UZXB 3A0FA 1L0QA 3AH8B 3IKOA 4E5ZB 5GXHA 4H5IA 3JZNA 5FA5B 4JSVC 3I7PA 1TBGA 2AGYA 5CXCA 1OMWB 3SN6B 4E54B 3MZKA 2P9IC 4D0KA 3VGZA 4MK0B 4GMBA 2BBKH 2AQ5A 2J55H 5IJ7E 3SBPA 3IIWA 3PVWB 2OVPB 3JPXA 4X60B 3DSMA 2XU7A 3ZWLB 3EI1B 4PSXB 1PGUA 1SHYB 3NVNA 1N6FA 1RI6A 4J78A 1JMXB 3OKYA 3SMRA 3J80g 4J87A 2B5LA 2CO0A 2YNOA 4PNKB 4JSNC 3EI2B 2B5NA 2CN3A 3OKTA 3CFSB 2CE9A 2IWKA 4QQEA 4BUJC 3JB9L 5AMSA 3N0EA 4A11B 2AGLA 2YMUA 5H1MA 4CI2A 5EMLB 3JZHA 3AL8B 4GM8A 5FKQA 4GQ2P 3OL2B 4A0BB 3ODTA 4JT5C 5EALA 3SVWD 3SBQA 2CE8A 4GZ8A 2CN2A 1ERJA 1MDAH 5EMJB 2HYEA 1JJUB 3SWSD 4A2MA 4E54A 4JSPC 4LG8A 4AEZA 4CI3A 2O9KA 2CO0C 3RFGA 3MZLA 4IA9A 3K26A 3PSLA 3CFVA 4CI1A 5GXIA 3C99A 3I8EA 3JZGA 5KDOB 3PXSD 4A0AA 3UVMA 1TYQC 2OK4A 2Q7QA 2I3TA 3JAMg 4X3EA 3I7NA 5HE3B 1GOTB 5FLXg 3N0DA 3I7LA 5I5MA 4XEIC 5TF2A 5I5JA 3PSCB 2IAAA 1MG3A 2OJYA 4J8BA 4FA1D 4ERYA 4ZOZA 3EI2A 3NVXA 4ERQA
chains in the Genus database with same CATH superfamily
4J77A 3JRPA 2YB8B 2AH0A 1GP2B 3DWLC 2EICA 3P4FA 1S4UX 2QXVA 3QHYB 2VDMA 2H47A 2W18A 4GGCA 3I7HA 1B9YA 5E6UA 2HXCA 3SFZA 5M5RA 3PXTD 4NENA 3AL8A 3EMHA 4A0BA 3OL2A 5FKRA 2GC4A 1NR0A 3EWEA 2H9LA 4QT8A 2Z2NA 1PI6A 1JMZB 3E0CA 4J0XA 3UVKA 1QNIA 4MMXA 2HJ4A 4CZVA 4A7JA 2P9SC 4FB1D 2OK6A 2EBSA 3NIDA 4XYIA 4DNVA 4FHLA 4JHNA 4PBYA 2Z2OA 4ZOVA 4FA9D 1E8NA 5THAA 5EM2B 2VDLA 3MUNA 5M5VA 4O1QD 3RSEC 2G99A 3UVLA 4CY2A 3PVUB 4O45A 5TEEA 2IUPA 2HKMA 1UOQA 5C2VB 4I79A 2OVQB 4PXWA 3I7OA 4BCDA 4X63B 4FA4D 1K3IA 3VH0A 4U1EI 4O3TB 3O4GA 5HE1B 5JWZA 4XYHA 3EG6A 1K8KC 1M1XA 2EIDA 5HE0B 2XYIA 3T3MA 2VDPA 4CY5A 1VYHC 5FXYA 4ESGA 3UKUC 4EWRA 3SHFA 1O6FA 4BCCA 1GG2B 3EQ9A 2QZPA 4JHPC 3W15A 4IRZA 3U4YA 3MUOA 3ZDYA 4K3JB 3K27A 4L9OA 3K6SA 4ERZA 1VZ2A 4E5ZA 3BG0A 3V9FA 5EMKB 5CXBB 4CZYA 4D6VA 1NEXB 3J81g 4PBZA 4JSXC 3MXXA 4K3ID 4AMYA 2B4EA 3FCSA 4J79A 4UI9R 4Y5RD 1XHMA 5H17A 3MVDK 4FAVD 3KRXB 4D9SA 2XE4A 2YBAA 1E5TA 5EM2A 4PC0A 2H6NA 4ZOXA 5IGOA 3RMZD 3EI1A 3SLED 3C75H 4L1MA 4O02A 2OIZA 1Q47A 4J82A 4OZUA 2GNQA 5I5IA 4J81A 2WQ8A 5M61A 2AH1A 5EARA 5IT9g 2PM9B 1JTDB 2AGWA 2I0SA 3RN1D 4J0WA 1R5MA 3IJ0A 3IUMA 2IUVA 3V4PA 4UM9A 1UOPA 4G1MA 1VZ3A 2XL3A 2VZ1A 4JXMA 2P9KC 4OWRA 4J8GA 3I8CA 4CZXA 4CY1A 3F3FA 2G9AA 3OKWA 5TEFA 4L3HD 3RLMD 4WK0A 4A11A 4FA5D 3OF7A 4GQ1A 2QC5A 3OKYB 1JOFA 3UR4A 3B7FA 4CI8A 3UKRC 3BWSA 5FFOA 5HE2B 3EQ7A 4A09B 2HU8A 2TRCB 5FKTA 3IUNA 4BH6A 5EAMA 5IGQA 4YVDA 1UTCA 3PE7A 5CXBA 3OTTA 1N6EA 4GGDA 4O2WA 4A2LA 4G56B 2H6KA 2EIBA 5CYKB 2PM6B 4PSWB 3GREA 2H9PA 3SBRA 5C2WB 4NSXA 2I3SA 1UOOA 4UM8A 3AFCA 3RRMC 1YFQA 2PBIB 3V7DB 3O4JA 4HDJA 3IJCA 1GOHA 4J86A 2YNNA 2H9NA 3O4HA 4U7AA 3JROA 5AFU3 2HU5A 2VZ3A 4AMZA 1U8CA 2P9UC 3C5MA 3HFQA 3RN0D 4N14A 3L4OD 2I0TA 2P9PC 2PM9A 4FWWA 5IJ8E 4JD2C 3IUQA 1P22A 2BCJB 1A12A 5E6RA 1SQJA 2J56H 2J57G 3OW8A 5K1CC 2H3XA 3ZDXA 4ZOYA 4X61B 1K32A 1L5GA 4A0AB 4QL1A 2YNPA 2HKRA 3MMYA 1PBYB 3F3GA 3DM0A 4Z7OA 3AL9A 2I0RA 3VA6A 2AGZA 2P9NC 3GFCA 4GQBB 4L3GD 2AGXA 2XL2A 3VI3A 4Z8LA 4QRJA 5C86A 3EI4B 5K19A 3I7KA 3EI3B 4O3UB 4A09A 4Y7RA 4GM9A 5E6SA 2P9LC 3MKSB 3UVOA 1XKSA 4A08B 3IIYA 3SCYA 2GC7A 3ORVD 2XDWA 4WJKA 4Z7QA 4BP9A 4J84A 2JKXA 2Z2PA 2PM7B 4AN0A 2IURA 3I89A 5C9ZB 5GMKn 2CNXA 5IC7A 5CYKA 4R7AB 3T3PA 4ZN4A 1TYEA 3UVNA 3GD1I 1YR2A 2H6QA 5FKSA 3DXKC 5M5UA 4QAMA 2H68A 1MG2A 4TZ4A 5FQDA 5B4WA 1T2XA 3C9CA 5SXMA 5CXCB 4CC9A 3EU7A 5AJAA 2UZYB 2HESX 3KRWB 2XZGA 3K71A 3V5WB 3ULEC 4ES0A 4H5JA 2MTAH 3DXMC 1SQ9A 3FGBA 3MKQA 4MMZA 4KFMB 4CY3A 3EQ8A 4O9DA 1C9LA 2QR5A 3VI4A 4Z7NA 5TDHB 2IWFA 3RFHA 4G1EA 1O6GA 3BG1A 2IUQA 5HYNB 4LGNA 1GXRA 1BPOA 3ZE1A 5GSAA 1QFSA 3NVQA 3CIKB 4BP8A 1XIPA 1PEVA 3L4MD 5EMMB 1FWXA 3I2NA 3FM0A 4NAAA 4AOWA 4JT6C 3QI0A 4J73A 5H14A 2BKLA 1U2VC 3EI4A 2H14A 1I2MB 4GM3A 3EI3A 3SXTD 4FAND 4WK4A 1A0RB 2H13A 5EAPA 4A08A 1H2XA 1U4CA 4IMMA 2HJBA 3GC3B 4G55A 3FRXA 4L1QD 4LG9A 2VDRA 3IJ1A 2H9MA 3SJLD 2B5MA 4GGAA 1B9XA 5HQGA 1OLZA 3PXWD 3F3PA 4MMYA 2OVRB 1N6DA 1QFMA 3IURA 4BL0A 5A2Qg 4AN1A 2UZXB 3A0FA 1L0QA 4NBMA 1H2ZA 3AH8B 3IKOA 3ZE2A 4E5ZB 5GXHA 4H5IA 3JZNA 1VE6A 5FA5B 4JSVC 3I7PA 4WK2A 1TBGA 2AGYA 5CXCA 5C92A 1OMWB 3SN6B 4E54B 3MZKA 2P9IC 1JV2A 4D0KA 3VGZA 4MK0B 2VDKA 4GMBA 2BBKH 2AQ5A 2J55H 5IJ7E 3IVMA 4NC4A 3SBPA 3IIWA 3PVWB 2OVPB 2VC2A 3JPXA 3DSMA 2XU7A 4X60B 1GOFA 3ZWLB 3EI1B 4PSXB 1PGUA 1SHYB 5FFGA 3NVNA 4DNWA 1N6FA 1RI6A 4BCBA 4J78A 1JMXB 3OKYA 3SMRA 3V4VA 3J80g 4J87A 2B5LA 2CO0A 2YNOA 4PNKB 4DNUA 4JSNC 3EI2B 2B5NA 2CN3A 3OKTA 3CFSB 3IJEA 1H2WA 2CE9A 2IWKA 4QQEA 4BUJC 3JB9L 5AMSA 3N0EA 4A11B 2AGLA 2YMUA 5H1MA 3DDUA 4CI2A 3FCUA 5EMLB 3K72A 3ZDZA 3JZHA 3AL8B 4GM8A 5FKQA 4GQ2P 3OL2B 4A0BB 3ODTA 4JT5C 4RE6A 5EALA 3NIGA 5M5TA 3O4IA 3SBQA 2CE8A 2EIEA 3SVWD 4GZ8A 2CN2A 1ERJA 1MDAH 1E8MA 5EMJB 1JJUB 5M5SA 2HYEA 4RE5A 3SWSD 4A2MA 4E54A 4JSPC 4LG8A 4AEZA 4CI3A 2O9KA 2CO0C 3RFGA 3KCIA 3MZLA 4IA9A 3K26A 3PSLA 3CFVA 2VDQA 4CI1A 5HDBA 5GXIA 3C99A 3I8EA 3JZGA 5KDOB 2VDNA 3PXSD 4A0AA 2VDOA 3UVMA 3IULA 1TYQC 3ZE0A 2OK4A 2Q7QA 3NIFA 2I3TA 4AX4A 3IUJA 3JAMg 4X3EA 1GOGA 3I7NA 5HE3B 1GOTB 1VE7A 5FLXg 3N0DA 3I7LA 5I5MA 1H2YA 4XEIC 5TF2A 5I5JA 3PSCB 1C9IA 2IAAA 2HU7A 1MG3A 2OJYA 4J8BA 4FA1D 4ERYA 4ZOZA 3EI2A 3NVXA 4ERQA
chains in the Genus database with same CATH topology
4J77A 3JRPA 2YB8B 2AH0A 1GP2B 3DWLC 3P4FA 1S4UX 2QXVA 2H47A 2W18A 4GGCA 3I7HA 1B9YA 2HXCA 3SFZA 3PXTD 3AL8A 3EMHA 4A0BA 3OL2A 5FKRA 2GC4A 1NR0A 3EWEA 2H9LA 4QT8A 2Z2NA 1PI6A 1JMZB 3E0CA 4J0XA 3UVKA 1QNIA 2HJ4A 4CZVA 4A7JA 2P9SC 4FB1D 2OK6A 2EBSA 4XYIA 4FHLA 4PBYA 2Z2OA 4ZOVA 4FA9D 5THAA 5EM2B 4O1QD 3RSEC 2G99A 3UVLA 4CY2A 3PVUB 4O45A 5TEEA 2IUPA 2HKMA 5C2VB 4I79A 2OVQB 4PXWA 3I7OA 4X63B 4FA4D 3VH0A 4U1EI 4O3TB 5HE1B 5JWZA 4XYHA 3EG6A 1K8KC 5HE0B 2XYIA 4CY5A 1VYHC 5FXYA 4ESGA 3UKUC 4EWRA 3SHFA 1GG2B 3W15A 3U4YA 4K3JB 3K27A 4L9OA 4ERZA 4E5ZA 3BG0A 3V9FA 5EMKB 5CXBB 4CZYA 4D6VA 1NEXB 3J81g 4PBZA 4JSXC 3MXXA 4K3ID 2B4EA 4J79A 4UI9R 4Y5RD 1XHMA 5H17A 4FAVD 3KRXB 2YBAA 5EM2A 4PC0A 2H6NA 4ZOXA 5IGOA 3RMZD 3EI1A 3SLED 3C75H 2OIZA 1Q47A 4J82A 4OZUA 2GNQA 5I5IA 4J81A 2AH1A 5EARA 5IT9g 2PM9B 2AGWA 2I0SA 3RN1D 4J0WA 1R5MA 3IJ0A 2IUVA 2XL3A 4JXMA 2P9KC 4OWRA 4J8GA 3I8CA 4CZXA 4CY1A 3F3FA 2G9AA 3OKWA 5TEFA 4L3HD 3RLMD 4A11A 4FA5D 4GQ1A 2QC5A 3OKYB 1JOFA 3UR4A 3B7FA 4CI8A 3UKRC 3BWSA 5HE2B 4A09B 2TRCB 5FKTA 4BH6A 5EAMA 5IGQA 4YVDA 3PE7A 5CXBA 3OTTA 1N6EA 4GGDA 4A2LA 4G56B 2H6KA 5CYKB 2PM6B 4PSWB 3GREA 2H9PA 3SBRA 5C2WB 4NSXA 2I3SA 3AFCA 3RRMC 1YFQA 2PBIB 3V7DB 4HDJA 3IJCA 4J86A 2YNNA 2H9NA 4U7AA 3JROA 5AFU3 2P9UC 3C5MA 3HFQA 3RN0D 4N14A 3L4OD 2I0TA 2P9PC 2PM9A 4FWWA 5IJ8E 4JD2C 1P22A 2BCJB 1SQJA 2J56H 2J57G 3OW8A 5K1CC 2H3XA 4ZOYA 4X61B 1K32A 4A0AB 4QL1A 2YNPA 2HKRA 1PBYB 3F3GA 3MMYA 3DM0A 3AL9A 2I0RA 3VA6A 2AGZA 2P9NC 3GFCA 4GQBB 4L3GD 2AGXA 2XL2A 4Z8LA 4QRJA 3EI4B 5K19A 3I7KA 3EI3B 4O3UB 4A09A 4Y7RA 4GM9A 2P9LC 3MKSB 3UVOA 1XKSA 4A08B 3IIYA 3SCYA 2GC7A 3ORVD 4J84A 2Z2PA 2PM7B 2IURA 3I89A 5C9ZB 5GMKn 2CNXA 5IC7A 5CYKA 4R7AB 4ZN4A 3UVNA 2H6QA 5FKSA 3DXKC 5B4WA 2H68A 1MG2A 4TZ4A 5FQDA 3C9CA 5SXMA 5CXCB 4CC9A 3EU7A 5AJAA 2UZYB 2HESX 3KRWB 3V5WB 3ULEC 4ES0A 4H5JA 2MTAH 3DXMC 1SQ9A 3FGBA 3MKQA 4KFMB 4CY3A 4O9DA 5TDHB 2IWFA 3RFHA 3BG1A 2IUQA 5HYNB 4LGNA 1GXRA 5GSAA 3NVQA 3CIKB 1XIPA 1PEVA 3L4MD 5EMMB 1FWXA 3I2NA 3FM0A 4AOWA 4JT6C 4J73A 5H14A 1U2VC 3EI4A 2H14A 4GM3A 3EI3A 3SXTD 4FAND 1A0RB 2H13A 5EAPA 4A08A 1U4CA 4IMMA 2HJBA 4LG9A 3FRXA 4L1QD 3IJ1A 2H9MA 3SJLD 2B5MA 4GGAA 1B9XA 5HQGA 1OLZA 3PXWD 3F3PA 2OVRB 1N6DA 4BL0A 5A2Qg 2UZXB 3A0FA 1L0QA 3AH8B 3IKOA 4E5ZB 5GXHA 4H5IA 3JZNA 5FA5B 4JSVC 3I7PA 1TBGA 2AGYA 5CXCA 1OMWB 3SN6B 4E54B 3MZKA 2P9IC 4D0KA 3VGZA 4MK0B 4GMBA 2BBKH 2AQ5A 2J55H 5IJ7E 3SBPA 3IIWA 3PVWB 2OVPB 3JPXA 4X60B 3DSMA 2XU7A 3ZWLB 3EI1B 4PSXB 1PGUA 1SHYB 3NVNA 1N6FA 1RI6A 4J78A 1JMXB 3OKYA 3SMRA 3J80g 4J87A 2B5LA 2CO0A 2YNOA 4PNKB 4JSNC 3EI2B 2B5NA 2CN3A 3OKTA 3CFSB 2CE9A 2IWKA 4QQEA 4BUJC 3JB9L 5AMSA 3N0EA 4A11B 2AGLA 2YMUA 5H1MA 4CI2A 5EMLB 3JZHA 3AL8B 4GM8A 5FKQA 4GQ2P 3OL2B 4A0BB 3ODTA 4JT5C 5EALA 3SVWD 3SBQA 2CE8A 4GZ8A 2CN2A 1ERJA 1MDAH 5EMJB 2HYEA 1JJUB 3SWSD 4A2MA 4E54A 4JSPC 4LG8A 4AEZA 4CI3A 2O9KA 2CO0C 3RFGA 3MZLA 4IA9A 3K26A 3PSLA 3CFVA 4CI1A 5GXIA 3C99A 3I8EA 3JZGA 5KDOB 3PXSD 4A0AA 3UVMA 1TYQC 2OK4A 2Q7QA 2I3TA 3JAMg 4X3EA 3I7NA 5HE3B 1GOTB 5FLXg 3N0DA 3I7LA 5I5MA 4XEIC 5TF2A 5I5JA 3PSCB 2IAAA 1MG3A 2OJYA 4J8BA 4FA1D 4ERYA 4ZOZA 3EI2A 3NVXA 4ERQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J77 A;  3JRP A;  2YB8 B;  2AH0 A;  1GP2 B;  3DWL C;  3P4F A;  1S4U X;  2QXV A;  2H47 A;  2W18 A;  4GGC A;  3I7H A;  1B9Y A;  2HXC A;  3SFZ A;  3PXT D;  3AL8 A;  3EMH A;  4A0B A;  3OL2 A;  5FKR A;  2GC4 A;  1NR0 A;  3EWE A;  2H9L A;  4QT8 A;  2Z2N A;  1PI6 A;  1JMZ B;  3E0C A;  4J0X A;  3UVK A;  1QNI A;  2HJ4 A;  4CZV A;  4A7J A;  2P9S C;  4FB1 D;  2OK6 A;  2EBS A;  4XYI A;  4FHL A;  4PBY A;  2Z2O A;  4ZOV A;  4FA9 D;  5THA A;  5EM2 B;  4O1Q D;  3RSE C;  2G99 A;  3UVL A;  4CY2 A;  3PVU B;  4O45 A;  5TEE A;  2IUP A;  2HKM A;  5C2V B;  4I79 A;  2OVQ B;  4PXW A;  3I7O A;  4X63 B;  4FA4 D;  3VH0 A;  4U1E I;  4O3T B;  5HE1 B;  5JWZ A;  4XYH A;  3EG6 A;  1K8K C;  5HE0 B;  2XYI A;  4CY5 A;  1VYH C;  5FXY A;  4ESG A;  3UKU C;  4EWR A;  3SHF A;  1GG2 B;  3W15 A;  3U4Y A;  4K3J B;  3K27 A;  4L9O A;  4ERZ A;  4E5Z A;  3BG0 A;  3V9F A;  5EMK B;  5CXB B;  4CZY A;  4D6V A;  1NEX B;  3J81 g;  4PBZ A;  4JSX C;  3MXX A;  4K3I D;  2B4E A;  4J79 A;  4UI9 R;  4Y5R D;  1XHM A;  5H17 A;  4FAV D;  3KRX B;  2YBA A;  5EM2 A;  4PC0 A;  2H6N A;  4ZOX A;  5IGO A;  3RMZ D;  3EI1 A;  3SLE D;  3C75 H;  2OIZ A;  1Q47 A;  4J82 A;  4OZU A;  2GNQ A;  5I5I A;  4J81 A;  2AH1 A;  5EAR A;  5IT9 g;  2PM9 B;  2AGW A;  2I0S A;  3RN1 D;  4J0W A;  1R5M A;  3IJ0 A;  2IUV A;  2XL3 A;  4JXM A;  2P9K C;  4OWR A;  4J8G A;  3I8C A;  4CZX A;  4CY1 A;  3F3F A;  2G9A A;  3OKW A;  5TEF A;  4L3H D;  3RLM D;  4A11 A;  4FA5 D;  4GQ1 A;  2QC5 A;  3OKY B;  1JOF A;  3UR4 A;  3B7F A;  4CI8 A;  3UKR C;  3BWS A;  5HE2 B;  4A09 B;  2TRC B;  5FKT A;  4BH6 A;  5EAM A;  5IGQ A;  4YVD A;  3PE7 A;  5CXB A;  3OTT A;  1N6E A;  4GGD A;  4A2L A;  4G56 B;  2H6K A;  5CYK B;  2PM6 B;  4PSW B;  3GRE A;  2H9P A;  3SBR A;  5C2W B;  4NSX A;  2I3S A;  3AFC A;  3RRM C;  1YFQ A;  2PBI B;  3V7D B;  4HDJ A;  3IJC A;  4J86 A;  2YNN A;  2H9N A;  4U7A A;  3JRO A;  5AFU 3;  2P9U C;  3C5M A;  3HFQ A;  3RN0 D;  4N14 A;  3L4O D;  2I0T A;  2P9P C;  2PM9 A;  4FWW A;  5IJ8 E;  4JD2 C;  1P22 A;  2BCJ B;  1SQJ A;  2J56 H;  2J57 G;  3OW8 A;  5K1C C;  2H3X A;  4ZOY A;  4X61 B;  1K32 A;  4A0A B;  4QL1 A;  2YNP A;  2HKR A;  1PBY B;  3F3G A;  3MMY A;  3DM0 A;  3AL9 A;  2I0R A;  3VA6 A;  2AGZ A;  2P9N C;  3GFC A;  4GQB B;  4L3G D;  2AGX A;  2XL2 A;  4Z8L A;  4QRJ A;  3EI4 B;  5K19 A;  3I7K A;  3EI3 B;  4O3U B;  4A09 A;  4Y7R A;  4GM9 A;  2P9L C;  3MKS B;  3UVO A;  1XKS A;  4A08 B;  3IIY A;  3SCY A;  2GC7 A;  3ORV D;  4J84 A;  2Z2P A;  2PM7 B;  2IUR A;  3I89 A;  5C9Z B;  5GMK n;  2CNX A;  5IC7 A;  5CYK A;  4R7A B;  4ZN4 A;  3UVN A;  2H6Q A;  5FKS A;  3DXK C;  5B4W A;  2H68 A;  1MG2 A;  4TZ4 A;  5FQD A;  3C9C A;  5SXM A;  5CXC B;  4CC9 A;  3EU7 A;  5AJA A;  2UZY B;  2HES X;  3KRW B;  3V5W B;  3ULE C;  4ES0 A;  4H5J A;  2MTA H;  3DXM C;  1SQ9 A;  3FGB A;  3MKQ A;  4KFM B;  4CY3 A;  4O9D A;  5TDH B;  2IWF A;  3RFH A;  3BG1 A;  2IUQ A;  5HYN B;  4LGN A;  1GXR A;  5GSA A;  3NVQ A;  3CIK B;  1XIP A;  1PEV A;  3L4M D;  5EMM B;  1FWX A;  3I2N A;  3FM0 A;  4AOW A;  4JT6 C;  4J73 A;  5H14 A;  1U2V C;  3EI4 A;  2H14 A;  4GM3 A;  3EI3 A;  3SXT D;  4FAN D;  1A0R B;  2H13 A;  5EAP A;  4A08 A;  1U4C A;  4IMM A;  2HJB A;  4LG9 A;  3FRX A;  4L1Q D;  3IJ1 A;  2H9M A;  3SJL D;  2B5M A;  4GGA A;  1B9X A;  5HQG A;  1OLZ A;  3PXW D;  3F3P A;  2OVR B;  1N6D A;  4BL0 A;  5A2Q g;  2UZX B;  3A0F A;  1L0Q A;  3AH8 B;  3IKO A;  4E5Z B;  5GXH A;  4H5I A;  3JZN A;  5FA5 B;  4JSV C;  3I7P A;  1TBG A;  2AGY A;  5CXC A;  1OMW B;  3SN6 B;  4E54 B;  3MZK A;  2P9I C;  4D0K A;  3VGZ A;  4MK0 B;  4GMB A;  2BBK H;  2AQ5 A;  2J55 H;  5IJ7 E;  3SBP A;  3IIW A;  3PVW B;  2OVP B;  3JPX A;  4X60 B;  3DSM A;  2XU7 A;  3ZWL B;  3EI1 B;  4PSX B;  1PGU A;  1SHY B;  3NVN A;  1N6F A;  1RI6 A;  4J78 A;  1JMX B;  3OKY A;  3SMR A;  3J80 g;  4J87 A;  2B5L A;  2CO0 A;  2YNO A;  4PNK B;  4JSN C;  3EI2 B;  2B5N A;  2CN3 A;  3OKT A;  3CFS B;  2CE9 A;  2IWK A;  4QQE A;  4BUJ C;  3JB9 L;  5AMS A;  3N0E A;  4A11 B;  2AGL A;  2YMU A;  5H1M A;  4CI2 A;  5EML B;  3JZH A;  3AL8 B;  4GM8 A;  5FKQ A;  4GQ2 P;  3OL2 B;  4A0B B;  3ODT A;  4JT5 C;  5EAL A;  3SVW D;  3SBQ A;  2CE8 A;  4GZ8 A;  2CN2 A;  1ERJ A;  1MDA H;  5EMJ B;  2HYE A;  1JJU B;  3SWS D;  4A2M A;  4E54 A;  4JSP C;  4LG8 A;  4AEZ A;  4CI3 A;  2O9K A;  2CO0 C;  3RFG A;  3MZL A;  4IA9 A;  3K26 A;  3PSL A;  3CFV A;  4CI1 A;  5GXI A;  3C99 A;  3I8E A;  3JZG A;  5KDO B;  3PXS D;  4A0A A;  3UVM A;  1TYQ C;  2OK4 A;  2Q7Q A;  2I3T A;  3JAM g;  4X3E A;  3I7N A;  5HE3 B;  1GOT B;  5FLX g;  3N0D A;  3I7L A;  5I5M A;  4XEI C;  5TF2 A;  5I5J A;  3PSC B;  2IAA A;  1MG3 A;  2OJY A;  4J8B A;  4FA1 D;  4ERY A;  4ZOZ A;  3EI2 A;  3NVX A;  4ERQ A; 
#chains in the Genus database with same CATH topology
 4J77 A;  3JRP A;  2YB8 B;  2AH0 A;  1GP2 B;  3DWL C;  2EIC A;  3P4F A;  1S4U X;  2QXV A;  3QHY B;  2VDM A;  2H47 A;  2W18 A;  4GGC A;  3I7H A;  1B9Y A;  5E6U A;  2HXC A;  3SFZ A;  5M5R A;  3PXT D;  4NEN A;  3AL8 A;  3EMH A;  4A0B A;  3OL2 A;  5FKR A;  2GC4 A;  1NR0 A;  3EWE A;  2H9L A;  4QT8 A;  2Z2N A;  1PI6 A;  1JMZ B;  3E0C A;  4J0X A;  3UVK A;  1QNI A;  4MMX A;  2HJ4 A;  4CZV A;  4A7J A;  2P9S C;  4FB1 D;  2OK6 A;  2EBS A;  3NID A;  4XYI A;  4DNV A;  4FHL A;  4JHN A;  4PBY A;  2Z2O A;  4ZOV A;  4FA9 D;  1E8N A;  5THA A;  5EM2 B;  2VDL A;  3MUN A;  5M5V A;  4O1Q D;  3RSE C;  2G99 A;  3UVL A;  4CY2 A;  3PVU B;  4O45 A;  5TEE A;  2IUP A;  2HKM A;  1UOQ A;  5C2V B;  4I79 A;  2OVQ B;  4PXW A;  3I7O A;  4BCD A;  4X63 B;  4FA4 D;  1K3I A;  3VH0 A;  4U1E I;  4O3T B;  3O4G A;  5HE1 B;  5JWZ A;  4XYH A;  3EG6 A;  1K8K C;  1M1X A;  2EID A;  5HE0 B;  2XYI A;  3T3M A;  2VDP A;  4CY5 A;  1VYH C;  5FXY A;  4ESG A;  3UKU C;  4EWR A;  3SHF A;  1O6F A;  4BCC A;  1GG2 B;  3EQ9 A;  2QZP A;  4JHP C;  3W15 A;  4IRZ A;  3U4Y A;  3MUO A;  3ZDY A;  4K3J B;  3K27 A;  4L9O A;  3K6S A;  4ERZ A;  1VZ2 A;  4E5Z A;  3BG0 A;  3V9F A;  5EMK B;  5CXB B;  4CZY A;  4D6V A;  1NEX B;  3J81 g;  4PBZ A;  4JSX C;  3MXX A;  4K3I D;  4AMY A;  2B4E A;  3FCS A;  4J79 A;  4UI9 R;  4Y5R D;  1XHM A;  5H17 A;  3MVD K;  4FAV D;  3KRX B;  4D9S A;  2XE4 A;  2YBA A;  1E5T A;  5EM2 A;  4PC0 A;  2H6N A;  4ZOX A;  5IGO A;  3RMZ D;  3EI1 A;  3SLE D;  3C75 H;  4L1M A;  4O02 A;  2OIZ A;  1Q47 A;  4J82 A;  4OZU A;  2GNQ A;  5I5I A;  4J81 A;  2WQ8 A;  5M61 A;  2AH1 A;  5EAR A;  5IT9 g;  2PM9 B;  1JTD B;  2AGW A;  2I0S A;  3RN1 D;  4J0W A;  1R5M A;  3IJ0 A;  3IUM A;  2IUV A;  3V4P A;  4UM9 A;  1UOP A;  4G1M A;  1VZ3 A;  2XL3 A;  2VZ1 A;  4JXM A;  2P9K C;  4OWR A;  4J8G A;  3I8C A;  4CZX A;  4CY1 A;  3F3F A;  2G9A A;  3OKW A;  5TEF A;  4L3H D;  3RLM D;  4WK0 A;  4A11 A;  4FA5 D;  3OF7 A;  4GQ1 A;  2QC5 A;  3OKY B;  1JOF A;  3UR4 A;  3B7F A;  4CI8 A;  3UKR C;  3BWS A;  5FFO A;  5HE2 B;  3EQ7 A;  4A09 B;  2HU8 A;  2TRC B;  5FKT A;  3IUN A;  4BH6 A;  5EAM A;  5IGQ A;  4YVD A;  1UTC A;  3PE7 A;  5CXB A;  3OTT A;  1N6E A;  4GGD A;  4O2W A;  4A2L A;  4G56 B;  2H6K A;  2EIB A;  5CYK B;  2PM6 B;  4PSW B;  3GRE A;  2H9P A;  3SBR A;  5C2W B;  4NSX A;  2I3S A;  1UOO A;  4UM8 A;  3AFC A;  3RRM C;  1YFQ A;  2PBI B;  3V7D B;  3O4J A;  4HDJ A;  3IJC A;  1GOH A;  4J86 A;  2YNN A;  2H9N A;  3O4H A;  4U7A A;  3JRO A;  5AFU 3;  2HU5 A;  2VZ3 A;  4AMZ A;  1U8C A;  2P9U C;  3C5M A;  3HFQ A;  3RN0 D;  4N14 A;  3L4O D;  2I0T A;  2P9P C;  2PM9 A;  4FWW A;  5IJ8 E;  4JD2 C;  3IUQ A;  1P22 A;  2BCJ B;  1A12 A;  5E6R A;  1SQJ A;  2J56 H;  2J57 G;  3OW8 A;  5K1C C;  2H3X A;  3ZDX A;  4ZOY A;  4X61 B;  1K32 A;  1L5G A;  4A0A B;  4QL1 A;  2YNP A;  2HKR A;  3MMY A;  1PBY B;  3F3G A;  3DM0 A;  4Z7O A;  3AL9 A;  2I0R A;  3VA6 A;  2AGZ A;  2P9N C;  3GFC A;  4GQB B;  4L3G D;  2AGX A;  2XL2 A;  3VI3 A;  4Z8L A;  4QRJ A;  5C86 A;  3EI4 B;  5K19 A;  3I7K A;  3EI3 B;  4O3U B;  4A09 A;  4Y7R A;  4GM9 A;  5E6S A;  2P9L C;  3MKS B;  3UVO A;  1XKS A;  4A08 B;  3IIY A;  3SCY A;  2GC7 A;  3ORV D;  2XDW A;  4WJK A;  4Z7Q A;  4BP9 A;  4J84 A;  2JKX A;  2Z2P A;  2PM7 B;  4AN0 A;  2IUR A;  3I89 A;  5C9Z B;  5GMK n;  2CNX A;  5IC7 A;  5CYK A;  4R7A B;  3T3P A;  4ZN4 A;  1TYE A;  3UVN A;  3GD1 I;  1YR2 A;  2H6Q A;  5FKS A;  3DXK C;  5M5U A;  4QAM A;  2H68 A;  1MG2 A;  4TZ4 A;  5FQD A;  5B4W A;  1T2X A;  3C9C A;  5SXM A;  5CXC B;  4CC9 A;  3EU7 A;  5AJA A;  2UZY B;  2HES X;  3KRW B;  2XZG A;  3K71 A;  3V5W B;  3ULE C;  4ES0 A;  4H5J A;  2MTA H;  3DXM C;  1SQ9 A;  3FGB A;  3MKQ A;  4MMZ A;  4KFM B;  4CY3 A;  3EQ8 A;  4O9D A;  1C9L A;  2QR5 A;  3VI4 A;  4Z7N A;  5TDH B;  2IWF A;  3RFH A;  4G1E A;  1O6G A;  3BG1 A;  2IUQ A;  5HYN B;  4LGN A;  1GXR A;  1BPO A;  3ZE1 A;  5GSA A;  1QFS A;  3NVQ A;  3CIK B;  4BP8 A;  1XIP A;  1PEV A;  3L4M D;  5EMM B;  1FWX A;  3I2N A;  3FM0 A;  4NAA A;  4AOW A;  4JT6 C;  3QI0 A;  4J73 A;  5H14 A;  2BKL A;  1U2V C;  3EI4 A;  2H14 A;  1I2M B;  4GM3 A;  3EI3 A;  3SXT D;  4FAN D;  4WK4 A;  1A0R B;  2H13 A;  5EAP A;  4A08 A;  1H2X A;  1U4C A;  4IMM A;  2HJB A;  3GC3 B;  4G55 A;  3FRX A;  4L1Q D;  4LG9 A;  2VDR A;  3IJ1 A;  2H9M A;  3SJL D;  2B5M A;  4GGA A;  1B9X A;  5HQG A;  1OLZ A;  3PXW D;  3F3P A;  4MMY A;  2OVR B;  1N6D A;  1QFM A;  3IUR A;  4BL0 A;  5A2Q g;  4AN1 A;  2UZX B;  3A0F A;  1L0Q A;  4NBM A;  1H2Z A;  3AH8 B;  3IKO A;  3ZE2 A;  4E5Z B;  5GXH A;  4H5I A;  3JZN A;  1VE6 A;  5FA5 B;  4JSV C;  3I7P A;  4WK2 A;  1TBG A;  2AGY A;  5CXC A;  5C92 A;  1OMW B;  3SN6 B;  4E54 B;  3MZK A;  2P9I C;  1JV2 A;  4D0K A;  3VGZ A;  4MK0 B;  2VDK A;  4GMB A;  2BBK H;  2AQ5 A;  2J55 H;  5IJ7 E;  3IVM A;  4NC4 A;  3SBP A;  3IIW A;  3PVW B;  2OVP B;  2VC2 A;  3JPX A;  3DSM A;  2XU7 A;  4X60 B;  1GOF A;  3ZWL B;  3EI1 B;  4PSX B;  1PGU A;  1SHY B;  5FFG A;  3NVN A;  4DNW A;  1N6F A;  1RI6 A;  4BCB A;  4J78 A;  1JMX B;  3OKY A;  3SMR A;  3V4V A;  3J80 g;  4J87 A;  2B5L A;  2CO0 A;  2YNO A;  4PNK B;  4DNU A;  4JSN C;  3EI2 B;  2B5N A;  2CN3 A;  3OKT A;  3CFS B;  3IJE A;  1H2W A;  2CE9 A;  2IWK A;  4QQE A;  4BUJ C;  3JB9 L;  5AMS A;  3N0E A;  4A11 B;  2AGL A;  2YMU A;  5H1M A;  3DDU A;  4CI2 A;  3FCU A;  5EML B;  3K72 A;  3ZDZ A;  3JZH A;  3AL8 B;  4GM8 A;  5FKQ A;  4GQ2 P;  3OL2 B;  4A0B B;  3ODT A;  4JT5 C;  4RE6 A;  5EAL A;  3NIG A;  5M5T A;  3O4I A;  3SBQ A;  2CE8 A;  2EIE A;  3SVW D;  4GZ8 A;  2CN2 A;  1ERJ A;  1MDA H;  1E8M A;  5EMJ B;  1JJU B;  5M5S A;  2HYE A;  4RE5 A;  3SWS D;  4A2M A;  4E54 A;  4JSP C;  4LG8 A;  4AEZ A;  4CI3 A;  2O9K A;  2CO0 C;  3RFG A;  3KCI A;  3MZL A;  4IA9 A;  3K26 A;  3PSL A;  3CFV A;  2VDQ A;  4CI1 A;  5HDB A;  5GXI A;  3C99 A;  3I8E A;  3JZG A;  5KDO B;  2VDN A;  3PXS D;  4A0A A;  2VDO A;  3UVM A;  3IUL A;  1TYQ C;  3ZE0 A;  2OK4 A;  2Q7Q A;  3NIF A;  2I3T A;  4AX4 A;  3IUJ A;  3JAM g;  4X3E A;  1GOG A;  3I7N A;  5HE3 B;  1GOT B;  1VE7 A;  5FLX g;  3N0D A;  3I7L A;  5I5M A;  1H2Y A;  4XEI C;  5TF2 A;  5I5J A;  3PSC B;  1C9I A;  2IAA A;  2HU7 A;  1MG3 A;  2OJY A;  4J8B A;  4FA1 D;  4ERY A;  4ZOZ A;  3EI2 A;  3NVX A;  4ERQ A; 
#chains in the Genus database with same CATH homology
 4J77 A;  3JRP A;  2YB8 B;  2AH0 A;  1GP2 B;  3DWL C;  3P4F A;  1S4U X;  2QXV A;  2H47 A;  2W18 A;  4GGC A;  3I7H A;  1B9Y A;  2HXC A;  3SFZ A;  3PXT D;  3AL8 A;  3EMH A;  4A0B A;  3OL2 A;  5FKR A;  2GC4 A;  1NR0 A;  3EWE A;  2H9L A;  4QT8 A;  2Z2N A;  1PI6 A;  1JMZ B;  3E0C A;  4J0X A;  3UVK A;  1QNI A;  2HJ4 A;  4CZV A;  4A7J A;  2P9S C;  4FB1 D;  2OK6 A;  2EBS A;  4XYI A;  4FHL A;  4PBY A;  2Z2O A;  4ZOV A;  4FA9 D;  5THA A;  5EM2 B;  4O1Q D;  3RSE C;  2G99 A;  3UVL A;  4CY2 A;  3PVU B;  4O45 A;  5TEE A;  2IUP A;  2HKM A;  5C2V B;  4I79 A;  2OVQ B;  4PXW A;  3I7O A;  4X63 B;  4FA4 D;  3VH0 A;  4U1E I;  4O3T B;  5HE1 B;  5JWZ A;  4XYH A;  3EG6 A;  1K8K C;  5HE0 B;  2XYI A;  4CY5 A;  1VYH C;  5FXY A;  4ESG A;  3UKU C;  4EWR A;  3SHF A;  1GG2 B;  3W15 A;  3U4Y A;  4K3J B;  3K27 A;  4L9O A;  4ERZ A;  4E5Z A;  3BG0 A;  3V9F A;  5EMK B;  5CXB B;  4CZY A;  4D6V A;  1NEX B;  3J81 g;  4PBZ A;  4JSX C;  3MXX A;  4K3I D;  2B4E A;  4J79 A;  4UI9 R;  4Y5R D;  1XHM A;  5H17 A;  4FAV D;  3KRX B;  2YBA A;  5EM2 A;  4PC0 A;  2H6N A;  4ZOX A;  5IGO A;  3RMZ D;  3EI1 A;  3SLE D;  3C75 H;  2OIZ A;  1Q47 A;  4J82 A;  4OZU A;  2GNQ A;  5I5I A;  4J81 A;  2AH1 A;  5EAR A;  5IT9 g;  2PM9 B;  2AGW A;  2I0S A;  3RN1 D;  4J0W A;  1R5M A;  3IJ0 A;  2IUV A;  2XL3 A;  4JXM A;  2P9K C;  4OWR A;  4J8G A;  3I8C A;  4CZX A;  4CY1 A;  3F3F A;  2G9A A;  3OKW A;  5TEF A;  4L3H D;  3RLM D;  4A11 A;  4FA5 D;  4GQ1 A;  2QC5 A;  3OKY B;  1JOF A;  3UR4 A;  3B7F A;  4CI8 A;  3UKR C;  3BWS A;  5HE2 B;  4A09 B;  2TRC B;  5FKT A;  4BH6 A;  5EAM A;  5IGQ A;  4YVD A;  3PE7 A;  5CXB A;  3OTT A;  1N6E A;  4GGD A;  4A2L A;  4G56 B;  2H6K A;  5CYK B;  2PM6 B;  4PSW B;  3GRE A;  2H9P A;  3SBR A;  5C2W B;  4NSX A;  2I3S A;  3AFC A;  3RRM C;  1YFQ A;  2PBI B;  3V7D B;  4HDJ A;  3IJC A;  4J86 A;  2YNN A;  2H9N A;  4U7A A;  3JRO A;  5AFU 3;  2P9U C;  3C5M A;  3HFQ A;  3RN0 D;  4N14 A;  3L4O D;  2I0T A;  2P9P C;  2PM9 A;  4FWW A;  5IJ8 E;  4JD2 C;  1P22 A;  2BCJ B;  1SQJ A;  2J56 H;  2J57 G;  3OW8 A;  5K1C C;  2H3X A;  4ZOY A;  4X61 B;  1K32 A;  4A0A B;  4QL1 A;  2YNP A;  2HKR A;  1PBY B;  3F3G A;  3MMY A;  3DM0 A;  3AL9 A;  2I0R A;  3VA6 A;  2AGZ A;  2P9N C;  3GFC A;  4GQB B;  4L3G D;  2AGX A;  2XL2 A;  4Z8L A;  4QRJ A;  3EI4 B;  5K19 A;  3I7K A;  3EI3 B;  4O3U B;  4A09 A;  4Y7R A;  4GM9 A;  2P9L C;  3MKS B;  3UVO A;  1XKS A;  4A08 B;  3IIY A;  3SCY A;  2GC7 A;  3ORV D;  4J84 A;  2Z2P A;  2PM7 B;  2IUR A;  3I89 A;  5C9Z B;  5GMK n;  2CNX A;  5IC7 A;  5CYK A;  4R7A B;  4ZN4 A;  3UVN A;  2H6Q A;  5FKS A;  3DXK C;  5B4W A;  2H68 A;  1MG2 A;  4TZ4 A;  5FQD A;  3C9C A;  5SXM A;  5CXC B;  4CC9 A;  3EU7 A;  5AJA A;  2UZY B;  2HES X;  3KRW B;  3V5W B;  3ULE C;  4ES0 A;  4H5J A;  2MTA H;  3DXM C;  1SQ9 A;  3FGB A;  3MKQ A;  4KFM B;  4CY3 A;  4O9D A;  5TDH B;  2IWF A;  3RFH A;  3BG1 A;  2IUQ A;  5HYN B;  4LGN A;  1GXR A;  5GSA A;  3NVQ A;  3CIK B;  1XIP A;  1PEV A;  3L4M D;  5EMM B;  1FWX A;  3I2N A;  3FM0 A;  4AOW A;  4JT6 C;  4J73 A;  5H14 A;  1U2V C;  3EI4 A;  2H14 A;  4GM3 A;  3EI3 A;  3SXT D;  4FAN D;  1A0R B;  2H13 A;  5EAP A;  4A08 A;  1U4C A;  4IMM A;  2HJB A;  4LG9 A;  3FRX A;  4L1Q D;  3IJ1 A;  2H9M A;  3SJL D;  2B5M A;  4GGA A;  1B9X A;  5HQG A;  1OLZ A;  3PXW D;  3F3P A;  2OVR B;  1N6D A;  4BL0 A;  5A2Q g;  2UZX B;  3A0F A;  1L0Q A;  3AH8 B;  3IKO A;  4E5Z B;  5GXH A;  4H5I A;  3JZN A;  5FA5 B;  4JSV C;  3I7P A;  1TBG A;  2AGY A;  5CXC A;  1OMW B;  3SN6 B;  4E54 B;  3MZK A;  2P9I C;  4D0K A;  3VGZ A;  4MK0 B;  4GMB A;  2BBK H;  2AQ5 A;  2J55 H;  5IJ7 E;  3SBP A;  3IIW A;  3PVW B;  2OVP B;  3JPX A;  4X60 B;  3DSM A;  2XU7 A;  3ZWL B;  3EI1 B;  4PSX B;  1PGU A;  1SHY B;  3NVN A;  1N6F A;  1RI6 A;  4J78 A;  1JMX B;  3OKY A;  3SMR A;  3J80 g;  4J87 A;  2B5L A;  2CO0 A;  2YNO A;  4PNK B;  4JSN C;  3EI2 B;  2B5N A;  2CN3 A;  3OKT A;  3CFS B;  2CE9 A;  2IWK A;  4QQE A;  4BUJ C;  3JB9 L;  5AMS A;  3N0E A;  4A11 B;  2AGL A;  2YMU A;  5H1M A;  4CI2 A;  5EML B;  3JZH A;  3AL8 B;  4GM8 A;  5FKQ A;  4GQ2 P;  3OL2 B;  4A0B B;  3ODT A;  4JT5 C;  5EAL A;  3SVW D;  3SBQ A;  2CE8 A;  4GZ8 A;  2CN2 A;  1ERJ A;  1MDA H;  5EMJ B;  2HYE A;  1JJU B;  3SWS D;  4A2M A;  4E54 A;  4JSP C;  4LG8 A;  4AEZ A;  4CI3 A;  2O9K A;  2CO0 C;  3RFG A;  3MZL A;  4IA9 A;  3K26 A;  3PSL A;  3CFV A;  4CI1 A;  5GXI A;  3C99 A;  3I8E A;  3JZG A;  5KDO B;  3PXS D;  4A0A A;  3UVM A;  1TYQ C;  2OK4 A;  2Q7Q A;  2I3T A;  3JAM g;  4X3E A;  3I7N A;  5HE3 B;  1GOT B;  5FLX g;  3N0D A;  3I7L A;  5I5M A;  4XEI C;  5TF2 A;  5I5J A;  3PSC B;  2IAA A;  1MG3 A;  2OJY A;  4J8B A;  4FA1 D;  4ERY A;  4ZOZ A;  3EI2 A;  3NVX A;  4ERQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...