2AQ5A

Crystal structure of murine coronin-1
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
395
structure length
390
Chain Sequence
b'SSKFRHVFGQPAKADQCYEDVRVSQTTWDSGFCAVNPKFMALIEASGGGAFLVLPLGKTGRVDKNVPLVGHTAPVLDIAWPHNDNVIASGSEDCTVMVWEIPDGGLVLPLREPVITLEGHTKRVGIVAWHPTAQNVLLSAGDNVILVWDVGTGAAVLTLGPDVHPDTIYSVDWSRDGALICTSCRDKRVRVIEPRKGTVVAEKDRPHEGTRPVHAVFVSEGKILTTGFSRMSERQVALWDTKHLEEPLSLQELDTSSGVLLPFFDPDTNIVYLCGKGDSSIRYFEITSEAPFLHYLSMFSSKESQRGMGYMPKRGLEVNKEIARFYKLHERKCEPIAMTVPRKSDLFQEDLYPPTAGPDPALTAEEWLGGRDAGPLLISLKDGYVPPKSR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Coronin-1A
publication title The crystal structure of murine coronin-1: a regulator of actin cytoskeletal dynamics in lymphocytes.
pubmed doi rcsb
source organism Mus musculus
molecule tags Structural protein
total genus 96
structure length 390
sequence length 395
ec nomenclature
pdb deposition date 2005-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
A PF08953 DUF1899 Domain of unknown function (DUF1899)
A PF16300 WD40_4 Type of WD40 repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2aq5A01
4CY5A 4A0AB 3OW8A 3F3GA 2CO0C 3SVWD 4ZOVA 5FKTA 3BG1A 2CN3A 1JMZB 4QL1A 3RFHA 4CY3A 4H5JA 2W18A 4CI2A 1GG2B 4N14A 1SQJA 3IKOA 3OL2B 4X63B 3I7LA 4NSXA 3RMZD 3UVLA 2YNPA 5GXIA 4O1QD 3JZNA 3K26A 2CN2A 2J57G 4A11A 3RLMD 4YVDA 2I3TA 4XYHA 3OTTA 4CY2A 3F3PA 4CI8A 4JSNC 5FKRA 4R7AB 4X61B 4A11B 3W15A 3C9CA 2H13A 5H14A 2IUPA 2PM6B 4ZOXA 5IC7A 4JSVC 3ZWLB 5EARA 3HFQA 5CXBA 1JMXB 5TDHB 3AFCA 5H17A 1U4CA 4XEIC 2IWFA 3SFZA 4CZVA 2H6QA 3E0CA 3MXXA 4IMMA 1XKSA 4E5ZA 4AEZA 4ERQA 5GMKn 5CXBB 2B5LA 5KDOB 3JZHA 2OVPB 4E54A 5C2WB 4PNKB 5FKSA 2I3SA 2H47A 2H9NA 2OVRB 3J80g 1K8KC 5K1CC 3SCYA 2OK4A 2AGYA 1PI6A 2AH0A 2OVQB 4BH6A 5HYNB 3IIWA 4HDJA 3SMRA 3OKTA 4E54B 1MG3A 1K32A 2J55H 3MZLA 1PBYB 3EI4B 1TBGA 2H6NA 4AOWA 1QNIA 4GMBA 5GSAA 1A0RB 2IUQA 2QXVA 4LG9A 3UVMA 4GM3A 3JB9L 5TEEA 4FA4D 4PSWB 3C5MA 5EM2A 2YNOA 3AL8A 3PXSD 5B4WA 4ZOYA 3PSCB 3EU7A 2IWKA 3I8EA 3DWLC 3V7DB 2BCJB 2CE9A 2UZXB 4JD2C 4GM8A 4J86A 4A2MA 5FQDA 3JAMg 5EM2B 2P9KC 5CYKA 3I8CA 1GOTB 2CE8A 3JROA 1XHMA 4ESGA 4ZN4A 3VH0A 3F3FA 2P9SC 3GFCA 4L3HD 3U4YA 5CYKB 4FB1D 3OKYA 4CI3A 3I7KA 2AGLA 4L9OA 4QT8A 4CZYA 4CC9A 3PE7A 4JT5C 2EBSA 3EI1A 4O9DA 2H14A 1ERJA 2YBAA 5FLXg 3OKYB 3UR4A 3A0FA 4G56B 3FRXA 5FA5B 4OZUA 1L0QA 3MKQA 4FHLA 3SLED 3EI1B 1VYHC 3DSMA 4A09A 4A2LA 5EMLB 2I0SA 4Y5RD 3MZKA 2B4EA 4LGNA 3DXMC 3NVNA 2GC7A 1SQ9A 3NVQA 4J73A 2GNQA 2P9LC 4OWRA 4EWRA 4O45A 4FWWA 2XU7A 2QC5A 4JSPC 4A08A 5HE0B 3KRXB 4O3TB 5AFU3 5HQGA 3RSEC 3EMHA 5I5JA 5EMJB 3J81g 1TYQC 2H9MA 4CI1A 3SHFA 3BG0A 3CIKB 3RN1D 5IGQA 3B7FA 4E5ZB 1RI6A 2PM9A 5IT9g 5H1MA 4ES0A 4D0KA 3SBPA 3SXTD 5TF2A 1JOFA 3SWSD 2CNXA 4XYIA 4J84A 3CFVA 3IJCA 4A0BA 5GXHA 1YFQA 5HE3B 4FA9D 3ULEC 3NVXA 2HKMA 4CY1A 3PVWB 1OMWB 4J87A 1N6EA 1PGUA 4GQBB 3MMYA 5I5MA 3IJ1A 4J0WA 4U7AA 5JWZA 3CFSB 3EWEA 3FM0A 3KRWB 1B9XA 1GP2B 5I5IA 4J8BA 1S4UX 2P9NC 3I89A 4GGDA 4J78A 2Z2OA 4MK0B 4IA9A 3EG6A 1OLZA 3PXTD 3AL8B 3EI2A 4ERZA 3SBRA 3V5WB 3ODTA 4TZ4A 3I7HA 3RN0D 3JPXA 5K19A 5HE2B 2I0TA 2AH1A 3EI3A 2MTAH 3C75H 4ERYA 2BBKH 3UVNA 3VA6A 1U2VC 4KFMB 5AMSA 5C9ZB 4PC0A 3EI2B 3UVKA 4J77A 2IAAA 3SBQA 3OKWA 3JZGA 4J81A 4JXMA 3OL2A 2O9KA 2AGWA 3EI3B 1GXRA 2G99A 4QQEA 3UKRC 4BL0A 3PXWD 2HXCA 1FWXA 1JJUB 3AL9A 4PSXB 3FGBA 5A2Qg 3UKUC 3V9FA 1P22A 5EAMA 4GGCA 2TRCB 4LG8A 2Q7QA 5SXMA 2H3XA 4J79A 4O3UB 1B9YA 4CZXA 1MG2A 2Z2PA 2XYIA 3DM0A 2G9AA 2AQ5A 2CO0A 2YNNA 2P9IC 4K3JB 5CXCA 5C2VB 5EALA 2GC4A 4A09B 4X60B 2PBIB 4BUJC 4GM9A 5HE1B 2H68A 2Z2NA 3RRMC 2OK6A 2YB8B 2J56H 3C99A 5CXCB 1N6DA 3P4FA 5TEFA 4PBYA 4FAVD 5AJAA 4FA5D 2P9PC 2OJYA 4FAND 4GQ2P 1NEXB 2HESX 1NR0A 1PEVA 2OIZA 3I7NA 5FXYA 4H5IA 4L1QD 3IIYA 4A08B 2H6KA 5EAPA 2I0RA 3N0EA 4J8GA 2UZYB 2HKRA 2B5MA 5FKQA 3IJ0A 4J82A 3I7PA 4A7JA 2H9PA 5THAA 4X3EA 4J0XA 4UI9R 3AH8B 2AGZA 2XL2A 3I2NA 1R5MA 5IJ8E 4I79A 4QRJA 2PM9B 3EI4A 3L4OD 4GGAA 4ZOZA 3SN6B 3VGZA 4FA1D 3MKSB 2B5NA 1N6FA 5IGOA 2IURA 3N0DA 1MDAH 1Q47A 4A0BB 2IUVA 3DXKC 1XIPA 2H9LA 3UVOA 3I7OA 5EMKB 4Y7RA 2HJ4A 4K3ID 3K27A 4GQ1A 3ORVD 4U1EI 3PSLA 3RFGA 5EMMB 3SJLD 4JT6C 4PBZA 1SHYB 2AGXA 2HJBA 4JSXC 3GREA 4A0AA 4L3GD 5IJ7E 4D6VA 2P9UC 2XL3A 3L4MD 4GZ8A 2YMUA 2HYEA 3JRPA 4Z8LA 3BWSA 4PXWA 2PM7B 3PVUB
chains in the Genus database with same CATH superfamily
1C9IA 1GOGA 4CY5A 4A0AB 3OW8A 3F3GA 2CO0C 2VDOA 3SVWD 4ZOVA 4WK0A 5FKTA 3BG1A 2CN3A 1JMZB 4QL1A 3RFHA 4CY3A 4H5JA 1I2MB 2W18A 4CI2A 4UM8A 1GG2B 4N14A 1SQJA 5M5SA 4IRZA 3IKOA 3OL2B 4X63B 3I7LA 4NSXA 3RMZD 2JKXA 3UVLA 2YNPA 5GXIA 1T2XA 4O1QD 1A12A 3JZNA 3K26A 2CN2A 2J57G 4A11A 3RLMD 4YVDA 2I3TA 4MMZA 4XYHA 3OTTA 4CY2A 3F3PA 4CI8A 3EQ9A 4JSNC 5FKRA 4R7AB 4X61B 2QR5A 3DDUA 4A11B 3EQ7A 3W15A 3VI3A 3C9CA 2H13A 5H14A 2IUPA 4QAMA 2PM6B 4ZOXA 5IC7A 4JSVC 3ZWLB 5EARA 3HFQA 5CXBA 1JMXB 5TDHB 3AFCA 2WQ8A 5H17A 1U4CA 1K3IA 4XEIC 2IWFA 1M1XA 4JHNA 3SFZA 4CZVA 2H6QA 3E0CA 3MXXA 2EICA 4IMMA 1XKSA 4E5ZA 4AEZA 3NIDA 4ERQA 5GMKn 5CXBB 2B5LA 5KDOB 3JZHA 2OVPB 4E54A 1H2YA 5C2WB 4PNKB 5FKSA 2I3SA 2H47A 2H9NA 2OVRB 3J80g 1K8KC 5K1CC 3SCYA 2OK4A 2AGYA 4NBMA 4BCBA 1PI6A 2AH0A 2OVQB 3V4VA 4Z7OA 4BH6A 5HYNB 3IIWA 4HDJA 3SMRA 4NENA 3OKTA 4E54B 1MG3A 1K32A 1TYEA 2J55H 3MZLA 1PBYB 3EI4B 1TBGA 5HDBA 2H6NA 4AOWA 3T3MA 1QNIA 4GMBA 5GSAA 1A0RB 2IUQA 4BP9A 2QXVA 4O02A 4LG9A 3UVMA 4GM3A 3JB9L 1VZ3A 5TEEA 4FA4D 3K72A 5C92A 4PSWB 3C5MA 5EM2A 2YNOA 3AL8A 3PXSD 5B4WA 4ZOYA 4JHPC 3PSCB 3EU7A 1U8CA 2IWKA 3I8EA 3DWLC 3V7DB 2VDLA 2BCJB 3ZE2A 2CE9A 1L5GA 2UZXB 4JD2C 3FCSA 4GM8A 4J86A 4A2MA 5FQDA 3JAMg 5M61A 5EM2B 2P9KC 5CYKA 3I8CA 1GOTB 2CE8A 5C86A 3JROA 1XHMA 4ESGA 4G55A 4ZN4A 3VH0A 3F3FA 2P9SC 3GFCA 4L3HD 3U4YA 5CYKB 4FB1D 3OKYA 4CI3A 3I7KA 4AN0A 2AGLA 4L9OA 4QT8A 1UOOA 4CZYA 3IUJA 4CC9A 3MVDK 3PE7A 4JT5C 2EBSA 3EI1A 4O9DA 1E8NA 2H14A 2HU5A 1ERJA 4NAAA 2YBAA 5FLXg 3OKYB 3UR4A 3A0FA 4G56B 3FRXA 5FA5B 4OZUA 1L0QA 3MKQA 4FHLA 2QZPA 1GOHA 2EIDA 3SLED 2VDMA 4DNUA 3EI1B 1VYHC 3DSMA 4A09A 3VI4A 2VDQA 4A2LA 5EMLB 2I0SA 3GD1I 5FFOA 4Y5RD 3MZKA 2B4EA 3OF7A 4LGNA 4AN1A 3DXMC 3IUMA 3NVNA 2GC7A 1SQ9A 3NVQA 4J73A 2GNQA 2P9LC 1O6GA 3O4HA 3GC3B 4OWRA 4EWRA 4O45A 4FWWA 2XU7A 2QC5A 4JSPC 4A08A 4BP8A 5HE0B 3KRXB 4O3TB 1VZ2A 4DNWA 5AFU3 5HQGA 3RSEC 4WK2A 3V4PA 3EMHA 5I5JA 4MMYA 5EMJB 3J81g 1TYQC 2H9MA 5E6RA 4CI1A 3SHFA 3BG0A 2VC2A 3CIKB 3RN1D 5IGQA 3B7FA 4E5ZB 1RI6A 2PM9A 5IT9g 5H1MA 1QFMA 4ES0A 4D0KA 3SBPA 1H2XA 3SXTD 5TF2A 1H2ZA 1JOFA 3SWSD 2CNXA 3ZDZA 4XYIA 4J84A 3CFVA 3IJCA 4A0BA 1YR2A 5GXHA 1YFQA 5HE3B 5E6SA 4FA9D 3O4JA 4AMZA 3ULEC 3NVXA 4WK4A 2HKMA 4CY1A 2EIBA 3PVWB 1OMWB 3IUNA 4J87A 1N6EA 1PGUA 2VDKA 1VE6A 4GQBB 3MMYA 1VE7A 5I5MA 3NIGA 3IJ1A 4J0WA 3O4IA 4U7AA 5JWZA 1C9LA 3CFSB 3EWEA 3FM0A 2VDNA 3KRWB 1B9XA 4RE6A 4BCDA 3QI0A 3ZE0A 1GP2B 5I5IA 4J8BA 1S4UX 2P9NC 3I89A 4GGDA 4J78A 2Z2OA 3EQ8A 3MUOA 4IA9A 3EG6A 4MK0B 5FFGA 1OLZA 3PXTD 2VDPA 3AL8B 3EI2A 4ERZA 3SBRA 3V5WB 3ODTA 4TZ4A 4DNVA 3I7HA 3RN0D 3JPXA 5K19A 5HE2B 2VDRA 2I0TA 2AH1A 3EI3A 2MTAH 3T3PA 4AX4A 4MMXA 3C75H 3IURA 4ERYA 2BBKH 3UVNA 3VA6A 1U2VC 4KFMB 1E5TA 5AMSA 4PC0A 5C9ZB 3EI2B 3K71A 3UVKA 4J77A 2IAAA 3SBQA 3OKWA 3JZGA 4J81A 4JXMA 5M5VA 3OL2A 2O9KA 2AGWA 1O6FA 3EI3B 1GXRA 2G99A 4QQEA 3UKRC 4BL0A 1E8MA 5M5TA 3PXWD 2HXCA 1FWXA 1JJUB 2VZ3A 3AL9A 4PSXB 3FGBA 5A2Qg 3UKUC 3V9FA 1P22A 5EAMA 4GGCA 2TRCB 4LG8A 2Q7QA 4NC4A 5SXMA 2H3XA 4J79A 4O3UB 1B9YA 4CZXA 1MG2A 2Z2PA 2XYIA 3DM0A 2G9AA 2AQ5A 2CO0A 2YNNA 2P9IC 4K3JB 4G1MA 5CXCA 5C2VB 3MUNA 3ZDXA 1BPOA 3KCIA 5EALA 5M5UA 2GC4A 4A09B 4X60B 2PBIB 4BUJC 4GM9A 1UTCA 5HE1B 1QFSA 2BKLA 1GOFA 2H68A 2Z2NA 3RRMC 2OK6A 2YB8B 1UOPA 3IULA 2J56H 3C99A 5CXCB 3IJEA 2HU7A 1N6DA 3P4FA 1JV2A 3IVMA 5TEFA 4PBYA 4FAVD 2EIEA 5AJAA 4FA5D 2P9PC 2XE4A 2HU8A 2OJYA 4FAND 4GQ2P 1NEXB 2HESX 4WJKA 1NR0A 1PEVA 2OIZA 3I7NA 5FXYA 4H5IA 4L1QD 3IIYA 4BCCA 4A08B 2H6KA 5EAPA 2I0RA 3N0EA 4J8GA 2UZYB 1JTDB 2HKRA 3FCUA 2B5MA 5FKQA 4D9SA 3IUQA 3IJ0A 4J82A 3I7PA 4A7JA 2H9PA 5THAA 4X3EA 4J0XA 4UI9R 3AH8B 2AGZA 2XL2A 3I2NA 1R5MA 5IJ8E 4I79A 4QRJA 2PM9B 3EI4A 3L4OD 4GGAA 4ZOZA 3O4GA 3SN6B 4UM9A 3VGZA 4FA1D 4O2WA 4Z7QA 5M5RA 3MKSB 2B5NA 1N6FA 3QHYB 5IGOA 4Z7NA 2IURA 4AMYA 3N0DA 1MDAH 1Q47A 4A0BB 2IUVA 3DXKC 1XIPA 2H9LA 3UVOA 3K6SA 1UOQA 3I7OA 3ZDYA 4G1EA 5EMKB 4Y7RA 2HJ4A 4K3ID 3K27A 4RE5A 4GQ1A 1H2WA 3ORVD 4U1EI 3PSLA 3RFGA 2XZGA 5EMMB 3SJLD 4JT6C 4PBZA 1SHYB 5E6UA 2AGXA 2HJBA 3NIFA 2VZ1A 4JSXC 3GREA 4A0AA 4L3GD 5IJ7E 4D6VA 2P9UC 2XL3A 3L4MD 2XDWA 4L1MA 4GZ8A 3ZE1A 2YMUA 2HYEA 3JRPA 4Z8LA 3BWSA 4PXWA 2PM7B 3PVUB
chains in the Genus database with same CATH topology
4CY5A 4A0AB 3OW8A 3F3GA 2CO0C 3SVWD 4ZOVA 5FKTA 3BG1A 2CN3A 1JMZB 4QL1A 3RFHA 4CY3A 4H5JA 2W18A 4CI2A 1GG2B 4N14A 1SQJA 3IKOA 3OL2B 4X63B 3I7LA 4NSXA 3RMZD 3UVLA 2YNPA 5GXIA 4O1QD 3JZNA 3K26A 2CN2A 2J57G 4A11A 3RLMD 4YVDA 2I3TA 4XYHA 3OTTA 4CY2A 3F3PA 4CI8A 4JSNC 5FKRA 4R7AB 4X61B 4A11B 3W15A 3C9CA 2H13A 5H14A 2IUPA 2PM6B 4ZOXA 5IC7A 4JSVC 3ZWLB 5EARA 3HFQA 5CXBA 1JMXB 5TDHB 3AFCA 5H17A 1U4CA 4XEIC 2IWFA 3SFZA 4CZVA 2H6QA 3E0CA 3MXXA 4IMMA 1XKSA 4E5ZA 4AEZA 4ERQA 5GMKn 5CXBB 2B5LA 5KDOB 3JZHA 2OVPB 4E54A 5C2WB 4PNKB 5FKSA 2I3SA 2H47A 2H9NA 2OVRB 3J80g 1K8KC 5K1CC 3SCYA 2OK4A 2AGYA 1PI6A 2AH0A 2OVQB 4BH6A 5HYNB 3IIWA 4HDJA 3SMRA 3OKTA 4E54B 1MG3A 1K32A 2J55H 3MZLA 1PBYB 3EI4B 1TBGA 2H6NA 4AOWA 1QNIA 4GMBA 5GSAA 1A0RB 2IUQA 2QXVA 4LG9A 3UVMA 4GM3A 3JB9L 5TEEA 4FA4D 4PSWB 3C5MA 5EM2A 2YNOA 3AL8A 3PXSD 5B4WA 4ZOYA 3PSCB 3EU7A 2IWKA 3I8EA 3DWLC 3V7DB 2BCJB 2CE9A 2UZXB 4JD2C 4GM8A 4J86A 4A2MA 5FQDA 3JAMg 5EM2B 2P9KC 5CYKA 3I8CA 1GOTB 2CE8A 3JROA 1XHMA 4ESGA 4ZN4A 3VH0A 3F3FA 2P9SC 3GFCA 4L3HD 3U4YA 5CYKB 4FB1D 3OKYA 4CI3A 3I7KA 2AGLA 4L9OA 4QT8A 4CZYA 4CC9A 3PE7A 4JT5C 2EBSA 3EI1A 4O9DA 2H14A 1ERJA 2YBAA 5FLXg 3OKYB 3UR4A 3A0FA 4G56B 3FRXA 5FA5B 4OZUA 1L0QA 3MKQA 4FHLA 3SLED 3EI1B 1VYHC 3DSMA 4A09A 4A2LA 5EMLB 2I0SA 4Y5RD 3MZKA 2B4EA 4LGNA 3DXMC 3NVNA 2GC7A 1SQ9A 3NVQA 4J73A 2GNQA 2P9LC 4OWRA 4EWRA 4O45A 4FWWA 2XU7A 2QC5A 4JSPC 4A08A 5HE0B 3KRXB 4O3TB 5AFU3 5HQGA 3RSEC 3EMHA 5I5JA 5EMJB 3J81g 1TYQC 2H9MA 4CI1A 3SHFA 3BG0A 3CIKB 3RN1D 5IGQA 3B7FA 4E5ZB 1RI6A 2PM9A 5IT9g 5H1MA 4ES0A 4D0KA 3SBPA 3SXTD 5TF2A 1JOFA 3SWSD 2CNXA 4XYIA 4J84A 3CFVA 3IJCA 4A0BA 5GXHA 1YFQA 5HE3B 4FA9D 3ULEC 3NVXA 2HKMA 4CY1A 3PVWB 1OMWB 4J87A 1N6EA 1PGUA 4GQBB 3MMYA 5I5MA 3IJ1A 4J0WA 4U7AA 5JWZA 3CFSB 3EWEA 3FM0A 3KRWB 1B9XA 1GP2B 5I5IA 4J8BA 1S4UX 2P9NC 3I89A 4GGDA 4J78A 2Z2OA 4MK0B 4IA9A 3EG6A 1OLZA 3PXTD 3AL8B 3EI2A 4ERZA 3SBRA 3V5WB 3ODTA 4TZ4A 3I7HA 3RN0D 3JPXA 5K19A 5HE2B 2I0TA 2AH1A 3EI3A 2MTAH 3C75H 4ERYA 2BBKH 3UVNA 3VA6A 1U2VC 4KFMB 5AMSA 5C9ZB 4PC0A 3EI2B 3UVKA 4J77A 2IAAA 3SBQA 3OKWA 3JZGA 4J81A 4JXMA 3OL2A 2O9KA 2AGWA 3EI3B 1GXRA 2G99A 4QQEA 3UKRC 4BL0A 3PXWD 2HXCA 1FWXA 1JJUB 3AL9A 4PSXB 3FGBA 5A2Qg 3UKUC 3V9FA 1P22A 5EAMA 4GGCA 2TRCB 4LG8A 2Q7QA 5SXMA 2H3XA 4J79A 4O3UB 1B9YA 4CZXA 1MG2A 2Z2PA 2XYIA 3DM0A 2G9AA 2AQ5A 2CO0A 2YNNA 2P9IC 4K3JB 5CXCA 5C2VB 5EALA 2GC4A 4A09B 4X60B 2PBIB 4BUJC 4GM9A 5HE1B 2H68A 2Z2NA 3RRMC 2OK6A 2YB8B 2J56H 3C99A 5CXCB 1N6DA 3P4FA 5TEFA 4PBYA 4FAVD 5AJAA 4FA5D 2P9PC 2OJYA 4FAND 4GQ2P 1NEXB 2HESX 1NR0A 1PEVA 2OIZA 3I7NA 5FXYA 4H5IA 4L1QD 3IIYA 4A08B 2H6KA 5EAPA 2I0RA 3N0EA 4J8GA 2UZYB 2HKRA 2B5MA 5FKQA 3IJ0A 4J82A 3I7PA 4A7JA 2H9PA 5THAA 4X3EA 4J0XA 4UI9R 3AH8B 2AGZA 2XL2A 3I2NA 1R5MA 5IJ8E 4I79A 4QRJA 2PM9B 3EI4A 3L4OD 4GGAA 4ZOZA 3SN6B 3VGZA 4FA1D 3MKSB 2B5NA 1N6FA 5IGOA 2IURA 3N0DA 1MDAH 1Q47A 4A0BB 2IUVA 3DXKC 1XIPA 2H9LA 3UVOA 3I7OA 5EMKB 4Y7RA 2HJ4A 4K3ID 3K27A 4GQ1A 3ORVD 4U1EI 3PSLA 3RFGA 5EMMB 3SJLD 4JT6C 4PBZA 1SHYB 2AGXA 2HJBA 4JSXC 3GREA 4A0AA 4L3GD 5IJ7E 4D6VA 2P9UC 2XL3A 3L4MD 4GZ8A 2YMUA 2HYEA 3JRPA 4Z8LA 3BWSA 4PXWA 2PM7B 3PVUB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CY5 A;  4A0A B;  3OW8 A;  3F3G A;  2CO0 C;  3SVW D;  4ZOV A;  5FKT A;  3BG1 A;  2CN3 A;  1JMZ B;  4QL1 A;  3RFH A;  4CY3 A;  4H5J A;  2W18 A;  4CI2 A;  1GG2 B;  4N14 A;  1SQJ A;  3IKO A;  3OL2 B;  4X63 B;  3I7L A;  4NSX A;  3RMZ D;  3UVL A;  2YNP A;  5GXI A;  4O1Q D;  3JZN A;  3K26 A;  2CN2 A;  2J57 G;  4A11 A;  3RLM D;  4YVD A;  2I3T A;  4XYH A;  3OTT A;  4CY2 A;  3F3P A;  4CI8 A;  4JSN C;  5FKR A;  4R7A B;  4X61 B;  4A11 B;  3W15 A;  3C9C A;  2H13 A;  5H14 A;  2IUP A;  2PM6 B;  4ZOX A;  5IC7 A;  4JSV C;  3ZWL B;  5EAR A;  3HFQ A;  5CXB A;  1JMX B;  5TDH B;  3AFC A;  5H17 A;  1U4C A;  4XEI C;  2IWF A;  3SFZ A;  4CZV A;  2H6Q A;  3E0C A;  3MXX A;  4IMM A;  1XKS A;  4E5Z A;  4AEZ A;  4ERQ A;  5GMK n;  5CXB B;  2B5L A;  5KDO B;  3JZH A;  2OVP B;  4E54 A;  5C2W B;  4PNK B;  5FKS A;  2I3S A;  2H47 A;  2H9N A;  2OVR B;  3J80 g;  1K8K C;  5K1C C;  3SCY A;  2OK4 A;  2AGY A;  1PI6 A;  2AH0 A;  2OVQ B;  4BH6 A;  5HYN B;  3IIW A;  4HDJ A;  3SMR A;  3OKT A;  4E54 B;  1MG3 A;  1K32 A;  2J55 H;  3MZL A;  1PBY B;  3EI4 B;  1TBG A;  2H6N A;  4AOW A;  1QNI A;  4GMB A;  5GSA A;  1A0R B;  2IUQ A;  2QXV A;  4LG9 A;  3UVM A;  4GM3 A;  3JB9 L;  5TEE A;  4FA4 D;  4PSW B;  3C5M A;  5EM2 A;  2YNO A;  3AL8 A;  3PXS D;  5B4W A;  4ZOY A;  3PSC B;  3EU7 A;  2IWK A;  3I8E A;  3DWL C;  3V7D B;  2BCJ B;  2CE9 A;  2UZX B;  4JD2 C;  4GM8 A;  4J86 A;  4A2M A;  5FQD A;  3JAM g;  5EM2 B;  2P9K C;  5CYK A;  3I8C A;  1GOT B;  2CE8 A;  3JRO A;  1XHM A;  4ESG A;  4ZN4 A;  3VH0 A;  3F3F A;  2P9S C;  3GFC A;  4L3H D;  3U4Y A;  5CYK B;  4FB1 D;  3OKY A;  4CI3 A;  3I7K A;  2AGL A;  4L9O A;  4QT8 A;  4CZY A;  4CC9 A;  3PE7 A;  4JT5 C;  2EBS A;  3EI1 A;  4O9D A;  2H14 A;  1ERJ A;  2YBA A;  5FLX g;  3OKY B;  3UR4 A;  3A0F A;  4G56 B;  3FRX A;  5FA5 B;  4OZU A;  1L0Q A;  3MKQ A;  4FHL A;  3SLE D;  3EI1 B;  1VYH C;  3DSM A;  4A09 A;  4A2L A;  5EML B;  2I0S A;  4Y5R D;  3MZK A;  2B4E A;  4LGN A;  3DXM C;  3NVN A;  2GC7 A;  1SQ9 A;  3NVQ A;  4J73 A;  2GNQ A;  2P9L C;  4OWR A;  4EWR A;  4O45 A;  4FWW A;  2XU7 A;  2QC5 A;  4JSP C;  4A08 A;  5HE0 B;  3KRX B;  4O3T B;  5AFU 3;  5HQG A;  3RSE C;  3EMH A;  5I5J A;  5EMJ B;  3J81 g;  1TYQ C;  2H9M A;  4CI1 A;  3SHF A;  3BG0 A;  3CIK B;  3RN1 D;  5IGQ A;  3B7F A;  4E5Z B;  1RI6 A;  2PM9 A;  5IT9 g;  5H1M A;  4ES0 A;  4D0K A;  3SBP A;  3SXT D;  5TF2 A;  1JOF A;  3SWS D;  2CNX A;  4XYI A;  4J84 A;  3CFV A;  3IJC A;  4A0B A;  5GXH A;  1YFQ A;  5HE3 B;  4FA9 D;  3ULE C;  3NVX A;  2HKM A;  4CY1 A;  3PVW B;  1OMW B;  4J87 A;  1N6E A;  1PGU A;  4GQB B;  3MMY A;  5I5M A;  3IJ1 A;  4J0W A;  4U7A A;  5JWZ A;  3CFS B;  3EWE A;  3FM0 A;  3KRW B;  1B9X A;  1GP2 B;  5I5I A;  4J8B A;  1S4U X;  2P9N C;  3I89 A;  4GGD A;  4J78 A;  2Z2O A;  4MK0 B;  4IA9 A;  3EG6 A;  1OLZ A;  3PXT D;  3AL8 B;  3EI2 A;  4ERZ A;  3SBR A;  3V5W B;  3ODT A;  4TZ4 A;  3I7H A;  3RN0 D;  3JPX A;  5K19 A;  5HE2 B;  2I0T A;  2AH1 A;  3EI3 A;  2MTA H;  3C75 H;  4ERY A;  2BBK H;  3UVN A;  3VA6 A;  1U2V C;  4KFM B;  5AMS A;  5C9Z B;  4PC0 A;  3EI2 B;  3UVK A;  4J77 A;  2IAA A;  3SBQ A;  3OKW A;  3JZG A;  4J81 A;  4JXM A;  3OL2 A;  2O9K A;  2AGW A;  3EI3 B;  1GXR A;  2G99 A;  4QQE A;  3UKR C;  4BL0 A;  3PXW D;  2HXC A;  1FWX A;  1JJU B;  3AL9 A;  4PSX B;  3FGB A;  5A2Q g;  3UKU C;  3V9F A;  1P22 A;  5EAM A;  4GGC A;  2TRC B;  4LG8 A;  2Q7Q A;  5SXM A;  2H3X A;  4J79 A;  4O3U B;  1B9Y A;  4CZX A;  1MG2 A;  2Z2P A;  2XYI A;  3DM0 A;  2G9A A;  2AQ5 A;  2CO0 A;  2YNN A;  2P9I C;  4K3J B;  5CXC A;  5C2V B;  5EAL A;  2GC4 A;  4A09 B;  4X60 B;  2PBI B;  4BUJ C;  4GM9 A;  5HE1 B;  2H68 A;  2Z2N A;  3RRM C;  2OK6 A;  2YB8 B;  2J56 H;  3C99 A;  5CXC B;  1N6D A;  3P4F A;  5TEF A;  4PBY A;  4FAV D;  5AJA A;  4FA5 D;  2P9P C;  2OJY A;  4FAN D;  4GQ2 P;  1NEX B;  2HES X;  1NR0 A;  1PEV A;  2OIZ A;  3I7N A;  5FXY A;  4H5I A;  4L1Q D;  3IIY A;  4A08 B;  2H6K A;  5EAP A;  2I0R A;  3N0E A;  4J8G A;  2UZY B;  2HKR A;  2B5M A;  5FKQ A;  3IJ0 A;  4J82 A;  3I7P A;  4A7J A;  2H9P A;  5THA A;  4X3E A;  4J0X A;  4UI9 R;  3AH8 B;  2AGZ A;  2XL2 A;  3I2N A;  1R5M A;  5IJ8 E;  4I79 A;  4QRJ A;  2PM9 B;  3EI4 A;  3L4O D;  4GGA A;  4ZOZ A;  3SN6 B;  3VGZ A;  4FA1 D;  3MKS B;  2B5N A;  1N6F A;  5IGO A;  2IUR A;  3N0D A;  1MDA H;  1Q47 A;  4A0B B;  2IUV A;  3DXK C;  1XIP A;  2H9L A;  3UVO A;  3I7O A;  5EMK B;  4Y7R A;  2HJ4 A;  4K3I D;  3K27 A;  4GQ1 A;  3ORV D;  4U1E I;  3PSL A;  3RFG A;  5EMM B;  3SJL D;  4JT6 C;  4PBZ A;  1SHY B;  2AGX A;  2HJB A;  4JSX C;  3GRE A;  4A0A A;  4L3G D;  5IJ7 E;  4D6V A;  2P9U C;  2XL3 A;  3L4M D;  4GZ8 A;  2YMU A;  2HYE A;  3JRP A;  4Z8L A;  3BWS A;  4PXW A;  2PM7 B;  3PVU B; 
#chains in the Genus database with same CATH topology
 1C9I A;  1GOG A;  4CY5 A;  4A0A B;  3OW8 A;  3F3G A;  2CO0 C;  2VDO A;  3SVW D;  4ZOV A;  4WK0 A;  5FKT A;  3BG1 A;  2CN3 A;  1JMZ B;  4QL1 A;  3RFH A;  4CY3 A;  4H5J A;  1I2M B;  2W18 A;  4CI2 A;  4UM8 A;  1GG2 B;  4N14 A;  1SQJ A;  5M5S A;  4IRZ A;  3IKO A;  3OL2 B;  4X63 B;  3I7L A;  4NSX A;  3RMZ D;  2JKX A;  3UVL A;  2YNP A;  5GXI A;  1T2X A;  4O1Q D;  1A12 A;  3JZN A;  3K26 A;  2CN2 A;  2J57 G;  4A11 A;  3RLM D;  4YVD A;  2I3T A;  4MMZ A;  4XYH A;  3OTT A;  4CY2 A;  3F3P A;  4CI8 A;  3EQ9 A;  4JSN C;  5FKR A;  4R7A B;  4X61 B;  2QR5 A;  3DDU A;  4A11 B;  3EQ7 A;  3W15 A;  3VI3 A;  3C9C A;  2H13 A;  5H14 A;  2IUP A;  4QAM A;  2PM6 B;  4ZOX A;  5IC7 A;  4JSV C;  3ZWL B;  5EAR A;  3HFQ A;  5CXB A;  1JMX B;  5TDH B;  3AFC A;  2WQ8 A;  5H17 A;  1U4C A;  1K3I A;  4XEI C;  2IWF A;  1M1X A;  4JHN A;  3SFZ A;  4CZV A;  2H6Q A;  3E0C A;  3MXX A;  2EIC A;  4IMM A;  1XKS A;  4E5Z A;  4AEZ A;  3NID A;  4ERQ A;  5GMK n;  5CXB B;  2B5L A;  5KDO B;  3JZH A;  2OVP B;  4E54 A;  1H2Y A;  5C2W B;  4PNK B;  5FKS A;  2I3S A;  2H47 A;  2H9N A;  2OVR B;  3J80 g;  1K8K C;  5K1C C;  3SCY A;  2OK4 A;  2AGY A;  4NBM A;  4BCB A;  1PI6 A;  2AH0 A;  2OVQ B;  3V4V A;  4Z7O A;  4BH6 A;  5HYN B;  3IIW A;  4HDJ A;  3SMR A;  4NEN A;  3OKT A;  4E54 B;  1MG3 A;  1K32 A;  1TYE A;  2J55 H;  3MZL A;  1PBY B;  3EI4 B;  1TBG A;  5HDB A;  2H6N A;  4AOW A;  3T3M A;  1QNI A;  4GMB A;  5GSA A;  1A0R B;  2IUQ A;  4BP9 A;  2QXV A;  4O02 A;  4LG9 A;  3UVM A;  4GM3 A;  3JB9 L;  1VZ3 A;  5TEE A;  4FA4 D;  3K72 A;  5C92 A;  4PSW B;  3C5M A;  5EM2 A;  2YNO A;  3AL8 A;  3PXS D;  5B4W A;  4ZOY A;  4JHP C;  3PSC B;  3EU7 A;  1U8C A;  2IWK A;  3I8E A;  3DWL C;  3V7D B;  2VDL A;  2BCJ B;  3ZE2 A;  2CE9 A;  1L5G A;  2UZX B;  4JD2 C;  3FCS A;  4GM8 A;  4J86 A;  4A2M A;  5FQD A;  3JAM g;  5M61 A;  5EM2 B;  2P9K C;  5CYK A;  3I8C A;  1GOT B;  2CE8 A;  5C86 A;  3JRO A;  1XHM A;  4ESG A;  4G55 A;  4ZN4 A;  3VH0 A;  3F3F A;  2P9S C;  3GFC A;  4L3H D;  3U4Y A;  5CYK B;  4FB1 D;  3OKY A;  4CI3 A;  3I7K A;  4AN0 A;  2AGL A;  4L9O A;  4QT8 A;  1UOO A;  4CZY A;  3IUJ A;  4CC9 A;  3MVD K;  3PE7 A;  4JT5 C;  2EBS A;  3EI1 A;  4O9D A;  1E8N A;  2H14 A;  2HU5 A;  1ERJ A;  4NAA A;  2YBA A;  5FLX g;  3OKY B;  3UR4 A;  3A0F A;  4G56 B;  3FRX A;  5FA5 B;  4OZU A;  1L0Q A;  3MKQ A;  4FHL A;  2QZP A;  1GOH A;  2EID A;  3SLE D;  2VDM A;  4DNU A;  3EI1 B;  1VYH C;  3DSM A;  4A09 A;  3VI4 A;  2VDQ A;  4A2L A;  5EML B;  2I0S A;  3GD1 I;  5FFO A;  4Y5R D;  3MZK A;  2B4E A;  3OF7 A;  4LGN A;  4AN1 A;  3DXM C;  3IUM A;  3NVN A;  2GC7 A;  1SQ9 A;  3NVQ A;  4J73 A;  2GNQ A;  2P9L C;  1O6G A;  3O4H A;  3GC3 B;  4OWR A;  4EWR A;  4O45 A;  4FWW A;  2XU7 A;  2QC5 A;  4JSP C;  4A08 A;  4BP8 A;  5HE0 B;  3KRX B;  4O3T B;  1VZ2 A;  4DNW A;  5AFU 3;  5HQG A;  3RSE C;  4WK2 A;  3V4P A;  3EMH A;  5I5J A;  4MMY A;  5EMJ B;  3J81 g;  1TYQ C;  2H9M A;  5E6R A;  4CI1 A;  3SHF A;  3BG0 A;  2VC2 A;  3CIK B;  3RN1 D;  5IGQ A;  3B7F A;  4E5Z B;  1RI6 A;  2PM9 A;  5IT9 g;  5H1M A;  1QFM A;  4ES0 A;  4D0K A;  3SBP A;  1H2X A;  3SXT D;  5TF2 A;  1H2Z A;  1JOF A;  3SWS D;  2CNX A;  3ZDZ A;  4XYI A;  4J84 A;  3CFV A;  3IJC A;  4A0B A;  1YR2 A;  5GXH A;  1YFQ A;  5HE3 B;  5E6S A;  4FA9 D;  3O4J A;  4AMZ A;  3ULE C;  3NVX A;  4WK4 A;  2HKM A;  4CY1 A;  2EIB A;  3PVW B;  1OMW B;  3IUN A;  4J87 A;  1N6E A;  1PGU A;  2VDK A;  1VE6 A;  4GQB B;  3MMY A;  1VE7 A;  5I5M A;  3NIG A;  3IJ1 A;  4J0W A;  3O4I A;  4U7A A;  5JWZ A;  1C9L A;  3CFS B;  3EWE A;  3FM0 A;  2VDN A;  3KRW B;  1B9X A;  4RE6 A;  4BCD A;  3QI0 A;  3ZE0 A;  1GP2 B;  5I5I A;  4J8B A;  1S4U X;  2P9N C;  3I89 A;  4GGD A;  4J78 A;  2Z2O A;  3EQ8 A;  3MUO A;  4IA9 A;  3EG6 A;  4MK0 B;  5FFG A;  1OLZ A;  3PXT D;  2VDP A;  3AL8 B;  3EI2 A;  4ERZ A;  3SBR A;  3V5W B;  3ODT A;  4TZ4 A;  4DNV A;  3I7H A;  3RN0 D;  3JPX A;  5K19 A;  5HE2 B;  2VDR A;  2I0T A;  2AH1 A;  3EI3 A;  2MTA H;  3T3P A;  4AX4 A;  4MMX A;  3C75 H;  3IUR A;  4ERY A;  2BBK H;  3UVN A;  3VA6 A;  1U2V C;  4KFM B;  1E5T A;  5AMS A;  4PC0 A;  5C9Z B;  3EI2 B;  3K71 A;  3UVK A;  4J77 A;  2IAA A;  3SBQ A;  3OKW A;  3JZG A;  4J81 A;  4JXM A;  5M5V A;  3OL2 A;  2O9K A;  2AGW A;  1O6F A;  3EI3 B;  1GXR A;  2G99 A;  4QQE A;  3UKR C;  4BL0 A;  1E8M A;  5M5T A;  3PXW D;  2HXC A;  1FWX A;  1JJU B;  2VZ3 A;  3AL9 A;  4PSX B;  3FGB A;  5A2Q g;  3UKU C;  3V9F A;  1P22 A;  5EAM A;  4GGC A;  2TRC B;  4LG8 A;  2Q7Q A;  4NC4 A;  5SXM A;  2H3X A;  4J79 A;  4O3U B;  1B9Y A;  4CZX A;  1MG2 A;  2Z2P A;  2XYI A;  3DM0 A;  2G9A A;  2AQ5 A;  2CO0 A;  2YNN A;  2P9I C;  4K3J B;  4G1M A;  5CXC A;  5C2V B;  3MUN A;  3ZDX A;  1BPO A;  3KCI A;  5EAL A;  5M5U A;  2GC4 A;  4A09 B;  4X60 B;  2PBI B;  4BUJ C;  4GM9 A;  1UTC A;  5HE1 B;  1QFS A;  2BKL A;  1GOF A;  2H68 A;  2Z2N A;  3RRM C;  2OK6 A;  2YB8 B;  1UOP A;  3IUL A;  2J56 H;  3C99 A;  5CXC B;  3IJE A;  2HU7 A;  1N6D A;  3P4F A;  1JV2 A;  3IVM A;  5TEF A;  4PBY A;  4FAV D;  2EIE A;  5AJA A;  4FA5 D;  2P9P C;  2XE4 A;  2HU8 A;  2OJY A;  4FAN D;  4GQ2 P;  1NEX B;  2HES X;  4WJK A;  1NR0 A;  1PEV A;  2OIZ A;  3I7N A;  5FXY A;  4H5I A;  4L1Q D;  3IIY A;  4BCC A;  4A08 B;  2H6K A;  5EAP A;  2I0R A;  3N0E A;  4J8G A;  2UZY B;  1JTD B;  2HKR A;  3FCU A;  2B5M A;  5FKQ A;  4D9S A;  3IUQ A;  3IJ0 A;  4J82 A;  3I7P A;  4A7J A;  2H9P A;  5THA A;  4X3E A;  4J0X A;  4UI9 R;  3AH8 B;  2AGZ A;  2XL2 A;  3I2N A;  1R5M A;  5IJ8 E;  4I79 A;  4QRJ A;  2PM9 B;  3EI4 A;  3L4O D;  4GGA A;  4ZOZ A;  3O4G A;  3SN6 B;  4UM9 A;  3VGZ A;  4FA1 D;  4O2W A;  4Z7Q A;  5M5R A;  3MKS B;  2B5N A;  1N6F A;  3QHY B;  5IGO A;  4Z7N A;  2IUR A;  4AMY A;  3N0D A;  1MDA H;  1Q47 A;  4A0B B;  2IUV A;  3DXK C;  1XIP A;  2H9L A;  3UVO A;  3K6S A;  1UOQ A;  3I7O A;  3ZDY A;  4G1E A;  5EMK B;  4Y7R A;  2HJ4 A;  4K3I D;  3K27 A;  4RE5 A;  4GQ1 A;  1H2W A;  3ORV D;  4U1E I;  3PSL A;  3RFG A;  2XZG A;  5EMM B;  3SJL D;  4JT6 C;  4PBZ A;  1SHY B;  5E6U A;  2AGX A;  2HJB A;  3NIF A;  2VZ1 A;  4JSX C;  3GRE A;  4A0A A;  4L3G D;  5IJ7 E;  4D6V A;  2P9U C;  2XL3 A;  3L4M D;  2XDW A;  4L1M A;  4GZ8 A;  3ZE1 A;  2YMU A;  2HYE A;  3JRP A;  4Z8L A;  3BWS A;  4PXW A;  2PM7 B;  3PVU B; 
#chains in the Genus database with same CATH homology
 4CY5 A;  4A0A B;  3OW8 A;  3F3G A;  2CO0 C;  3SVW D;  4ZOV A;  5FKT A;  3BG1 A;  2CN3 A;  1JMZ B;  4QL1 A;  3RFH A;  4CY3 A;  4H5J A;  2W18 A;  4CI2 A;  1GG2 B;  4N14 A;  1SQJ A;  3IKO A;  3OL2 B;  4X63 B;  3I7L A;  4NSX A;  3RMZ D;  3UVL A;  2YNP A;  5GXI A;  4O1Q D;  3JZN A;  3K26 A;  2CN2 A;  2J57 G;  4A11 A;  3RLM D;  4YVD A;  2I3T A;  4XYH A;  3OTT A;  4CY2 A;  3F3P A;  4CI8 A;  4JSN C;  5FKR A;  4R7A B;  4X61 B;  4A11 B;  3W15 A;  3C9C A;  2H13 A;  5H14 A;  2IUP A;  2PM6 B;  4ZOX A;  5IC7 A;  4JSV C;  3ZWL B;  5EAR A;  3HFQ A;  5CXB A;  1JMX B;  5TDH B;  3AFC A;  5H17 A;  1U4C A;  4XEI C;  2IWF A;  3SFZ A;  4CZV A;  2H6Q A;  3E0C A;  3MXX A;  4IMM A;  1XKS A;  4E5Z A;  4AEZ A;  4ERQ A;  5GMK n;  5CXB B;  2B5L A;  5KDO B;  3JZH A;  2OVP B;  4E54 A;  5C2W B;  4PNK B;  5FKS A;  2I3S A;  2H47 A;  2H9N A;  2OVR B;  3J80 g;  1K8K C;  5K1C C;  3SCY A;  2OK4 A;  2AGY A;  1PI6 A;  2AH0 A;  2OVQ B;  4BH6 A;  5HYN B;  3IIW A;  4HDJ A;  3SMR A;  3OKT A;  4E54 B;  1MG3 A;  1K32 A;  2J55 H;  3MZL A;  1PBY B;  3EI4 B;  1TBG A;  2H6N A;  4AOW A;  1QNI A;  4GMB A;  5GSA A;  1A0R B;  2IUQ A;  2QXV A;  4LG9 A;  3UVM A;  4GM3 A;  3JB9 L;  5TEE A;  4FA4 D;  4PSW B;  3C5M A;  5EM2 A;  2YNO A;  3AL8 A;  3PXS D;  5B4W A;  4ZOY A;  3PSC B;  3EU7 A;  2IWK A;  3I8E A;  3DWL C;  3V7D B;  2BCJ B;  2CE9 A;  2UZX B;  4JD2 C;  4GM8 A;  4J86 A;  4A2M A;  5FQD A;  3JAM g;  5EM2 B;  2P9K C;  5CYK A;  3I8C A;  1GOT B;  2CE8 A;  3JRO A;  1XHM A;  4ESG A;  4ZN4 A;  3VH0 A;  3F3F A;  2P9S C;  3GFC A;  4L3H D;  3U4Y A;  5CYK B;  4FB1 D;  3OKY A;  4CI3 A;  3I7K A;  2AGL A;  4L9O A;  4QT8 A;  4CZY A;  4CC9 A;  3PE7 A;  4JT5 C;  2EBS A;  3EI1 A;  4O9D A;  2H14 A;  1ERJ A;  2YBA A;  5FLX g;  3OKY B;  3UR4 A;  3A0F A;  4G56 B;  3FRX A;  5FA5 B;  4OZU A;  1L0Q A;  3MKQ A;  4FHL A;  3SLE D;  3EI1 B;  1VYH C;  3DSM A;  4A09 A;  4A2L A;  5EML B;  2I0S A;  4Y5R D;  3MZK A;  2B4E A;  4LGN A;  3DXM C;  3NVN A;  2GC7 A;  1SQ9 A;  3NVQ A;  4J73 A;  2GNQ A;  2P9L C;  4OWR A;  4EWR A;  4O45 A;  4FWW A;  2XU7 A;  2QC5 A;  4JSP C;  4A08 A;  5HE0 B;  3KRX B;  4O3T B;  5AFU 3;  5HQG A;  3RSE C;  3EMH A;  5I5J A;  5EMJ B;  3J81 g;  1TYQ C;  2H9M A;  4CI1 A;  3SHF A;  3BG0 A;  3CIK B;  3RN1 D;  5IGQ A;  3B7F A;  4E5Z B;  1RI6 A;  2PM9 A;  5IT9 g;  5H1M A;  4ES0 A;  4D0K A;  3SBP A;  3SXT D;  5TF2 A;  1JOF A;  3SWS D;  2CNX A;  4XYI A;  4J84 A;  3CFV A;  3IJC A;  4A0B A;  5GXH A;  1YFQ A;  5HE3 B;  4FA9 D;  3ULE C;  3NVX A;  2HKM A;  4CY1 A;  3PVW B;  1OMW B;  4J87 A;  1N6E A;  1PGU A;  4GQB B;  3MMY A;  5I5M A;  3IJ1 A;  4J0W A;  4U7A A;  5JWZ A;  3CFS B;  3EWE A;  3FM0 A;  3KRW B;  1B9X A;  1GP2 B;  5I5I A;  4J8B A;  1S4U X;  2P9N C;  3I89 A;  4GGD A;  4J78 A;  2Z2O A;  4MK0 B;  4IA9 A;  3EG6 A;  1OLZ A;  3PXT D;  3AL8 B;  3EI2 A;  4ERZ A;  3SBR A;  3V5W B;  3ODT A;  4TZ4 A;  3I7H A;  3RN0 D;  3JPX A;  5K19 A;  5HE2 B;  2I0T A;  2AH1 A;  3EI3 A;  2MTA H;  3C75 H;  4ERY A;  2BBK H;  3UVN A;  3VA6 A;  1U2V C;  4KFM B;  5AMS A;  5C9Z B;  4PC0 A;  3EI2 B;  3UVK A;  4J77 A;  2IAA A;  3SBQ A;  3OKW A;  3JZG A;  4J81 A;  4JXM A;  3OL2 A;  2O9K A;  2AGW A;  3EI3 B;  1GXR A;  2G99 A;  4QQE A;  3UKR C;  4BL0 A;  3PXW D;  2HXC A;  1FWX A;  1JJU B;  3AL9 A;  4PSX B;  3FGB A;  5A2Q g;  3UKU C;  3V9F A;  1P22 A;  5EAM A;  4GGC A;  2TRC B;  4LG8 A;  2Q7Q A;  5SXM A;  2H3X A;  4J79 A;  4O3U B;  1B9Y A;  4CZX A;  1MG2 A;  2Z2P A;  2XYI A;  3DM0 A;  2G9A A;  2AQ5 A;  2CO0 A;  2YNN A;  2P9I C;  4K3J B;  5CXC A;  5C2V B;  5EAL A;  2GC4 A;  4A09 B;  4X60 B;  2PBI B;  4BUJ C;  4GM9 A;  5HE1 B;  2H68 A;  2Z2N A;  3RRM C;  2OK6 A;  2YB8 B;  2J56 H;  3C99 A;  5CXC B;  1N6D A;  3P4F A;  5TEF A;  4PBY A;  4FAV D;  5AJA A;  4FA5 D;  2P9P C;  2OJY A;  4FAN D;  4GQ2 P;  1NEX B;  2HES X;  1NR0 A;  1PEV A;  2OIZ A;  3I7N A;  5FXY A;  4H5I A;  4L1Q D;  3IIY A;  4A08 B;  2H6K A;  5EAP A;  2I0R A;  3N0E A;  4J8G A;  2UZY B;  2HKR A;  2B5M A;  5FKQ A;  3IJ0 A;  4J82 A;  3I7P A;  4A7J A;  2H9P A;  5THA A;  4X3E A;  4J0X A;  4UI9 R;  3AH8 B;  2AGZ A;  2XL2 A;  3I2N A;  1R5M A;  5IJ8 E;  4I79 A;  4QRJ A;  2PM9 B;  3EI4 A;  3L4O D;  4GGA A;  4ZOZ A;  3SN6 B;  3VGZ A;  4FA1 D;  3MKS B;  2B5N A;  1N6F A;  5IGO A;  2IUR A;  3N0D A;  1MDA H;  1Q47 A;  4A0B B;  2IUV A;  3DXK C;  1XIP A;  2H9L A;  3UVO A;  3I7O A;  5EMK B;  4Y7R A;  2HJ4 A;  4K3I D;  3K27 A;  4GQ1 A;  3ORV D;  4U1E I;  3PSL A;  3RFG A;  5EMM B;  3SJL D;  4JT6 C;  4PBZ A;  1SHY B;  2AGX A;  2HJB A;  4JSX C;  3GRE A;  4A0A A;  4L3G D;  5IJ7 E;  4D6V A;  2P9U C;  2XL3 A;  3L4M D;  4GZ8 A;  2YMU A;  2HYE A;  3JRP A;  4Z8L A;  3BWS A;  4PXW A;  2PM7 B;  3PVU B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...