2AQFA

Structural and functional analysis of ada2 alpha swirm domain
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
90
structure length
90
Chain Sequence
GSNSGRRSAPPLNLTGLPGTEKLNEKEKELCQVVRLVPGAYLEYKSALLNECHKQGGLRLAQARALIKIDVNKTRKIYDFLIREGYITKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords transcriptional adaptor 2, Ada2 alpha
publication title Structure and chromosomal DNA binding of the SWIRM domain.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription
total genus 20
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2005-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04433 SWIRM SWIRM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.780 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2aqfA00
2AQEA 2DCEA 2AQFA 2CUJA 2ELJA
chains in the Genus database with same CATH superfamily
4DYRA 4XLCA 1UJ8A 1YW7A 2VONA 2GBYA 2EV6A 3ZQHA 3CF2A 4BEHB 4HYEA 2CQNA 2QQAA 2L7ZA 1GDTA 1VQNI 4EM0B 2F5CA 2K02A 3IH4A 5ICEA 2IRFG 3HOWJ 2X6WA 1IF1A 1WPKA 2DMQA 2Q8KA 3QPSA 4ZDPA 5HODA 5F64A 4UB8C 1W36C 4G7OF 3ZQ7A 3K4NA 1T39A 4EJWA 3I54A 3KZZA 2HYGD 2P4WA 3M07A 3A4CA 3OOUA 1XSDA 3GW2A 2VJIA 2LTPA 4GYGA 5HVQC 4XLPF 2W85A 2KPMA 3FKIJ 2VPRA 2HTSA 4DJAA 1R71A 4IF4A 2W82A 4KISA 3K4BA 2N8GA 3J7YJ 1U5TA 4D5CA 5D6EA 3TDZC 3DKXA 1QBJA 5EEHA 3LSIA 3D5SC 5BNGA 1T95A 2EA2A 1D0YA 2NYXA 2W4SA 2VQCA 3O8HA 3VWBA 1WKMA 1U5TB 3FM5A 3FHNA 2PJRB 2CUFA 3V4GA 1RC9A 1SVLA 3OR2C 3O6BB 1MMGA 1Y0UA 3J7AY 2XB0X 3GMEA 2ZMEC 5D5VB 3WHBA 3AFHA 2G0EA 2M7BA 2FA5A 2H8WA 1MSEC 4BKXA 1ETOA 4P9UA 4BQQA 4QPOA 3KEOA 4NQWB 2JPCA 4AVPA 1IRGA 1HKSA 1R58A 4HX4A 3W2WA 4J19A 2DMUA 2G7HA 2AS5F 4X0GA 2QYOA 4YFNF 2Y2ZA 2LF8A 1EH7A 2WB1N 3FM3A 4C9YA 2VPLA 3PFYA 2LF7A 2PX9A 4RBOA 4NBQA 1MBKA 2FD5A 4AIJA 4FCYA 5B66C 4A93J 2EIMH 3ZMDA 3SDBA 1GUUA 2R4GA 2GQQA 1FT9A 4KIFA 4ZYHA 5LGNA 1FYKA 3ISPA 4XKVA 4RGRA 1X1BA 3W3CA 4IOAF 2XGEA 1BW6A 4BUPA 3JAMZ 3ZQCA 3VSKA 3OYHA 2K27A 3CTAA 4XRSA 1MDMB 3CCVI 1U9OA 3KCCA 2P5KA 1ON2A 5HS7A 3KP3A 4HA8A 5FKNA 2YSRA 4UNOA 3M1CA 1SFKA 4BQAA 3GTMJ 3MWMA 5LBQA 3PUFA 4QLCU 2CUEA 2WTEA 3DBRB 1OYIA 2VBWA 4HX8A 3JAMK 4NUBA 4BXFA 1ZQ3P 2FBHA 4KA4A 3CMEI 3HKZN 2FUG2 2G9WA 4FX0A 2HYJA 3DCFA 4HDUA 1S5LC 1FC3A 5IYBJ 2OCEA 3LSPA 2E60A 2JPBA 1WJ5A 2XC7A 2H1KA 3BR0A 3BROA 4E7IA 3KE2A 2EBIA 5K5QA 1USTA 1A5JA 4RB3C 3KLNA 5D4RA 5ICFA 1HCRA 3BY6A 1RKTA 3K1NA 1X3ZB 2W1OA 2XPVA 2ZO4A 2R92J 3KP2A 2PMHA 4HAMA 2RC4A 4XICA 4LB5A 4AUXA 4WXCA 4CCMA 1AKHA 3CD6I 2XGDA 3L00A 3WTXC 3A03A 3E97A 1FMWA 2E1CA 3FMRA 4A6EA 1Z7LA 2K86A 1IRZA 3Q9VA 5FLMJ 5HS8A 2CWEA 2F2EA 3AAFA 3N4MA 1LPQA 1AKHB 5HNFA 2X1EA 2HZDA 2DQLA 2R7RA 2BOLA 1S29A 1VQ4I 1T33A 1BIAA 2X6OA 5EYRA 1MKMA 1VQLI 1DU0A 1VTNC 2EFPA 3MKWB 1ZAOA 3QU3A 4UUSA 1W4MA 3FKJA 4AYBN 3BG3A 3IC7A 2QKLB 2BVLA 1FNNA 5FRMA 2FOWA 2RV8A 2A6HF 3GCMA 4BAYA 2HDDA 3CDIA 4CICA 4NC8A 5D4SA 4A5NA 5B3SH 2GIZA 2KLOA 2E36A 4UUSB 2LKXA 2OQRA 1T8IA 2E2JJ 1YRNB 1FEXA 3H36A 1NG6A 4HEA2 4RS8A 4BL0B 3H3UA 1DU6A 2LY9A 3F8CA 1J7KA 1WJFA 3KEYA 4MHGA 1XN7A 2CFXA 2E1NA 4OINF 3HRSA 4GGGA 1O3SA 4G7ZF 2R7WA 1I27A 2A5WA 1H0MA 3K2AA 2LP0A 1UB9A 3TO9A 2DAOA 3KZYA 2ESHA 2COBA 2DMPA 5M5XJ 2ZMEB 3H3ZA 5CPRB 2L7KA 2NVXJ 4M72A 3ROUA 4L9JA 1TC3C 4NC7A 1ZR4A 4HRIA 1X3UA 2NS8A 1TZLA 4G7HF 4WK8F 1WJBA 2QENA 4OMYA 1RNLA 1UMQA 2EB7A 1BJZA 5FJ8J 1IXRC 2A61A 1FYLA 4LFUA 5J47A 3GO5A 4ZC3A 4IXAA 1G3WA 5H6QA 3A1YA 2F48A 2Q0OA 2H1LA 2OU2A 3CJTB 2HKOA 1K61A 1IGNA 2M4GA 1T56A 1D5VA 2COMA 3DV8A 4BDZA 1AHDP 1SMYF 3LSTA 1ETKA 4DGWB 3C7JA 1HBXG 3GWZA 1ZLJA 2LKPA 2K3FA 5JFRA 3KPHA 2LLKA 2R5ZB 1BOAA 4WXHA 2QSFX 4B43A 1ZG1A 5CQGA 5FGMA 1BBYA 4A3EJ 3MKLA 2W25A 2DBBA 2L3DA 1ZG5A 3KIOA 2Y75A 5TJJA 2HOEA 5IOZA 1S3JA 3PQJA 4BHPA 1V54H 3I58A 1K78B 3NEUA 1TQMA 3ERED 2B7EA 3DBLB 5AIQA 3FIWA 1ZK8A 2MABA 5F04A 1HW5A 1DPUA 3OOPA 4FISA 3J7AO 3IRQA 1I6HJ 1YIOA 1YYVA 3J7ZI 2X6XA 1SFOJ 1WH5A 3TEDA 2HNHA 5CJ9A 2HQAA 3ZQLA 3U9GA 4IRGA 3HXLA 2XKPA 3H9QA 2WB1A 2MW8A 1V4RA 3EETA 1ZRFA 4KMFA 4F92B 2R3SA 3HOUJ 1V3FA 2JSCA 2BE5F 5FKMA 3D5RC 3EUHC 3I4MJ 5GPAA 2DJIA 2RNJA 5GAHJ 2MC4A 4E7KA 4FE7A 1MBJA 3SDGA 4ESJA 3CJQB 3R6SA 4OOIA 4ZZDA 4BY1J 2YUSA 2LBFA 4OAZA 4C3HJ 3DEWA 2Z99A 3CCYA 2MD0A 3BT9A 2JUCA 2EFQA 3IV5A 1LVKA 3OYIA 1VQ9I 5KAFC 2LVSA 5HLTA 2K9SA 2HPIA 2ZFUA 2Z2SB 2HWVA 4EJUA 5CVRA 3BR6A 3RQIA 3C2BA 1XD7A 3OYDA 2RQQA 4XKCA 2VQHA 2JK3A 3HKZA 4MGRA 5HDGA 4G6TB 1QZYA 3PFIA 3WG9A 3S15J 4KICA 1R4NB 2Y69H 3ABKH 1UZCA 4ESFA 4E7LA 2ZXIA 1RKWA 4M73A 4ZYDA 1OJLA 2DA6A 2GZWA 2L2OA 1APLC 1TWCJ 3K2ZA 2NVYJ 4FTHA 3DLAA 3R0AA 4WXDA 2EZLA 4J01A 2QF7A 2HOTA 4KT6A 2EINH 1ERDA 1DGWY 5BPIA 4I09A 2O9LA 2DO7A 1VQ5I 2EIJH 2XHKA 1MMAA 5FKLA 3RZDJ 2KIFA 4LIUA 1YI2I 2ZFWA 5LD2C 1FOKA 5JI6A 3GYHX 2HVSA 2AQEA 2DYRH 3RCOA 3EPZA 4H0EA 3FXKA 3UKGA 2GXGA 3ESWB 2MLKA 1OCCH 2I10A 3F8NA 4F93B 1IN8A 1Z3YA 5E3MA 4HZFA 3HSRA 3OYMA 1BL0A 2XROA 2VT3A 3JRBA 4IHSA 3GFIA 2DOFA 4AYBA 2IS2A 1YJNI 3QAHA 1Y39A 2ISYA 1MD0A 2EH3A 3N05A 5EEGA 3E5QA 4ASNA 1ZGJA 3DU6A 4ZTFA 5J1YA 1YO5C 2BVMA 1S9HA 1IN6A 3CC7I 4A0XA 1HSTA 4XN0A 2OTLI 4M9XA 1IN7A 3LSRA 2LYCA 4IX7A 4HF2A 1DGRM 3GTOJ 1J5YA 3IAM2 5E17F 5LHIA 2HI3A 2VJJA 2ACJA 4IQJA 3F21A 4UV9A 1O57A 1B72A 2DA1A 1YE9A 3RTRA 1SFXA 5B1AH 1GHCA 2QKMB 1JKQC 3U1DA 1K4TA 2QVOA 3S93A 3Q3SA 2JVGA 3E6CC 2JUGA 2QEXI 1DQUA 2FXAA 2L9RA 1RUOA 3VDXA 4HSRA 3B6CA 4IVNA 3RPUD 1MBHA 2YU3A 4QSHA 3CP8A 1QZZA 3GZNB 1T2KA 5KCMA 2YPRA 2OC6A 3DTIA 3F9KA 4CHUA 2KRFA 2UXXA 1KQ0A 5HS9A 3RI4A 3M8FA 2IP2A 2ECCA 3I55I 4M71A 3HJEA 4IKFA 3EUAA 3H0GJ 2E19A 3ZGKA 4IOCF 3G6EI 1IDYA 1D1CA 1MZBA 2MBFA 3RQ4A 3HPHA 4UXNA 2HU9A 1LFPA 1NTCA 2LH9A 3BJOA 1BI3A 1B4AA 4BHBA 4L0ZB 1JTXA 3HOSA 3JCUC 1BI0A 2MYSA 1T6SA 5J1RA 2O5RA 1DPRA 5JVGF 3X2QH 3ML6A 1VQKI 1LKXA 2CQXA 4EVIA 3MD2A 1FOWA 2E2HJ 1SVOA 4KYWA 4LMYA 1WZ2A 3BQZA 3CLQA 5J6XA 4RB1A 1UHMA 4HF0A 4OIQF 1PUFB 2R7UA 2JSPA 1Q1VA 4GCVA 4F55A 4G94A 1U5TC 2HQRA 2O03A 3DWLE 4RMNA 3TBIA 3BTIA 2RDPA 4AVZA 4BQOA 2CH0A 5M5YJ 1HA8A 4ZYEA 3LAJA 3HSEA 4MTEA 1FYMA 3MCZA 3T5XA 3FXRA 2Z16A 4XKWA 1SAXA 3TP0A 1N77A 1I3QJ 2IA0A 3A02A 1X1PA 3KP4A 2STWA 3BZKA 1XTAA 3S2WA 1QGPA 5KAIC 4OAYA 1XGNA 3BWGA 2K40A 1VQ6I 5ED4A 4ZDLA 4RGUA 2V9VA 2O8XA 4BXUA 4BACA 4C2MJ 4RDUA 1OPCA 2BW3A 4L9VA 2D2WA 2LSOA 1WHUA 5IYCJ 5EGOA 4BE1A 3QPHA 1YOVB 3HOZJ 3L09A 2Y31A 2PG4A 1FLIA 1B6AA 2IW5A 3L7WA 3RYPA 1XB4A 2DLLA 1AU7A 4EJOA 2XSDC 3ZMTA 5M3MJ 4XLNF 2WBMA 5K5RA 4O5VA 1TLHB 3AKZA 2JVHA 1Y6IA 2LK2A 3OIQA 3ERMA 4PDKA 4JK1X 4UVAA 2CW8A 4U7BA 1OCTC 2QQ9A 2CUZA 4CA0A 2ZJRF 5BMZA 2P7CB 4RB0A 2VKEA 2VI6A 2VASA 3UR3C 5DDGA 4CZZA 3ZPLA 5E3LA 3J80K 2GIVA 5LFAA 6PAXA 4BU2A 3TQNA 1I5ZA 1YHQI 3F23A 3HUGB 1BIBA 1T98A 3BPVA 4D7NA 1U0JA 1HDDC 2CW7A 3SEZA 3OSFA 3U2RA 4L0YB 1WJAA 2DJNA 1IN4A 3TGNA 3N97A 2V9KA 3T0YA 3I71A 3KP5A 2P6SA 1P6RA 3ECOA 3PQKA 2HXIA 4MLOA 4MQ9F 5C3EJ 3F3XA 1E3HA 5DEQA 1R1VA 1ZH5A 3Q5FA 5B5EC 4D1QA 1ZR2A 4EATA 2QBYB 3U1KA 3L2QA 2AO9A 4XRSG 4HNUA 3JRIA 2GXAA 2ZB9A 4M9ZA 3GTQJ 4RAYA 5CVUA 1F43A 2OV7A 1UG2A 3VSLA 1ZYRF 4JP0A 3HOYJ 1ZGAA 3C2HA 4CYCA 1KZHA 3CESA 2BXYA 1P92A 3T8TA 1CF7A 2ZCWA 2O7OA 3I64A 4BQNA 3SZGA 4L5IA 1JHHA 4IEJA 3QODA 1R9TJ 1ZTRA 4CYCB 2R7QA 4FQGA 3SFIA 5FROA 1CF7B 3S17J 1SMTA 1Z6RA 2IT0A 5DTDA 1XGMA 1TT5B 3LMMA 2MLGA 1LEAA 3ZRGA 1QPMA 4PGGA 2CV1A 3OS2A 1G2HA 2LFBA 1R49A 2R7FA 3HOVJ 4B09A 4PJMA 1LQ1A 2K9MA 1YLFA 4XIDA 3WU2C 2HKXA 1LVAA 3HL2A 3RPUA 3A01A 2OQGA 3IL2A 1TNSA 3BG9A 2I5UA 2JA8J 2OCCH 1XX5A 3GX4X 2PJPA 3OYCA 1JGGA 2VC0A 3NAUA 3A01B 1R23A 2M45A 3WU1B 1VQPI 1OQYA 1F4KA 2GA1A 1K6YA 3FX3A 3SQNA 1U6GA 2KL4A 3IWFA 5DCMA 5FLXZ 1ENHA 2F6CA 2XF7A 5ICCA 3FF5A 3KZIC 2DTRA 3CF5F 4U87A 3BPXA 2R93J 4HSTA 4B3XA 1A6QA 4G8XA 2J5PA 2XAHA 2BHYA 3BR5A 4HQMA 2A68F 2DXIA 4B4CA 4AC0A 1ACIA 4CCOA 2M0CA 5H2FC 3HTSB 3CDLA 4JQFA 5B1BH 4UY8I 5FLXK 4U0VA 1TNTA 1P4AA 3I59A 5K7ZA 1D1AA 3JTHA 5JHFA 1WI9A 1JHFA 4WX9A 2LC2A 5JLXA 1IC8A 3ZOBA 4A6DA 4OWRB 4PZJA 3BZ6A 2LY1A 1OR7A 3C18A 4Q4ZF 3E1SA 1JUSA 5KNLA 1IRXA 3BC8A 4X1EA 3CCSI 4G9YA 2R7TA 3FBIB 1BC8C 2P0WA 1H9TA 1FBUA 4LOCA 2ETHA 1X2NA 5CVIA 4A69C 4Q47A 3TOBA 1T08B 2RNGA 5LGUA 4L9NA 2MC3A 5AIPA 4GXOA 4CSWA 1IXSB 2Z1DA 3BTJA 1KU2A 3LAPA 4M3FA 3HOXJ 3IUOA 2V4JC 2E71A 2Y9ZA 1IV8A 4M6YA 1Z91A 1FZPB 2IVMA 2VIXA 1YS6A 2VBYA 3ZP5A 5HDNA 2GLOA 1PP8F 2HQ5A 1MMNA 1YG2A 1RIOH 3BG5A 5CVVA 1MW7A 2ZJQF 3LSJA 3SJMA 1W0TA 5FD6A 1ZLKA 2DI3A 5CQEA 2E2IJ 2UWMA 2XB5A 2QGUA 4C2UA 3F8BA 3G2BA 4DYCA 4K2EA 4YFXF 1WQ2A 3PO3J 3CC2I 1IV6A 3SZPA 4AD9A 5GAEJ 5DD4A 3OSGA 4MFEA 3REOA 4UUTA 5HLHA 4JX4A 2OZUA 4XN3A 2M87A 4HLYA 5J40A 3QYBA 3I5UA 5DV5A 5DM7F 4XR6A 2KT0A 3ABUA 5LHGA 1JJ8C 4HF1A 1PJRA 2OD5A 2WY8Q 2NRAC 4KIBA 2G7UA 4N4NB 1X2MA 1FX7A 5TISC 3ZCOA 4CZCA 1W5TA 1X19A 2PMUA 3KYCB 2VLAA 5EZGA 4LK0F 4WF2A 3PIOF 1KONA 3S8PA 2QCOA 1I1SA 3IWZA 1SD5A 3PM1A 3VB2A 3IH3A 3RIRA 5F08A 5KK1A 2V1DA 4CCKA 2FOKA 3K4CA 3QPLA 5C44J 1R6RA 1Z77A 3CJNA 3GTPJ 2XSJC 1D8JA 1SD6A 3W6JB 4EJVA 2ECBA 3ZN1A 1TTYA 4N9HA 4BE0A 3HDDA 3MZHA 2CU7A 3KP7A 2PMZN 2QLZA 3JSOA 4ZDOA 3S1NJ 2EIKH 2Y30A 3MFKA 1ITYA 3FXLA 4L5JA 4RGXA 2DTZA 2LY2A 2IGOA 3GVAA 3ZQFA 3V7RA 1VQ7I 2K9NA 4F52A 1FIPA 1E0EA 1ZHFA 2L9NA 2UUZA 4HOBA 2F5EA 3BR2A 1YQAA 2GA2A 3S3NA 4AU7A 5FB2A 1JJ6C 2R7SA 1EH8A 5DM6F 1A31A 2HDCA 1LFBA 4CUGA 4HX7A 5LRRA 3VPRA 1JE8A 4LG0A 3IAS2 2IBDA 5FKOA 2IEKA 4RA2A 3DPLC 5IPAA 3CCLI 2XAGA 3A0HC 4Y33A 2BZTA 2XDVA 2Z5UA 3LSHA 4LG0B 4RAZA 2R7XA 3ABTA 2XVCA 1B8IA 4KUMA 4EEFG 3ULQB 4PSWA 2F5DA 2KQRA 3DFGA 4L9TA 4P96A 1W5CC 4HLXA 2V26A 4U88A 4KMUX 5F0FA 5DUIA 5JR3A 1BOBA 1B8IB 2EFWA 3OS1A 4W97A 2CQQA 3P9IA 3CCUI 1HW2A 4F91B 2HEOA 3JTGA 4QIWN 4A3IJ 4ESBA 2ISZA 1FSHA 1NHAA 2DT7B 2VB6A 3HGYA 4LLNA 3DF8A 1S8NA 4FASD 2KIMA 1O3RA 2DU9A 2CS3A 1FTTA 4YRVA 2FE3A 4YIRX 1W5SA 5ILUA 1I3AA 2JA5J 2Y9YA 3K4JA 1QVUA 3R60A 4YELA 1R5GA 3AG3H 1D0ZA 3IKTA 2RN7A 1CGPA 5J3LA 3E0JB 3C3WA 2JRMA 2KIUA 3IH2A 2QQ8A 3L2RA 1NH3A 2W00A 1I6XA 4G6DA 1U8BA 4IHWA 1Q1HA 2IJLA 1FBQA 1P7IA 1MH4A 4IHVA 4BBRJ 1POGA 2MH9A 2EA4A 5D8LB 4EV0A 3C2GA 5IT3A 4MEYF 3BQYA 2MGQA 3L2UA 1TT0A 1RI7A 2CJJA 2DA2A 4ENJA 5E1XA 1X58A 2L4AA 1S6LA 2ICWG 4ETSA 4DNCA 1PDNC 2X9DA 1IZ1A 3E7LA 4UVBA 4ITVA 3GTJJ 1LB2A 2V6EA 1JKRC 2X6YA 2WAFA 4L18B 3WGHA 4M74A 4S0HB 3MMYB 2BEOA 1UAAA 3A2KA 2NXNB 4HV6A 4L5EA 1U9NA 1FWZA 2XAQA 4DW6A 5DCFA 4EGYA 1CQTA 3K4KA 2F4OB 2LBFB 2GXBA 3LSGA 3BJ6A 3B73A 2E1MC 1D3YA 2R7ZJ 1VQ8I 4XMYA 1MSFC 4C3JJ 1X4OA 1SC7A 1GV5A 1Y1WJ 1JUMA 1IO2A 3KYDB 3U21A 2QQBA 5F6FA 1VZ0A 3H3VK 5HNHA 3GLXA 4FETA 5L3EA 5EG0A 3WGIA 4J00A 3NRVA 3RKXA 3JW4A 1HOMA 1EF4A 1MJ9A 1ORKA 3FZVA 2QSGX 3E6BA 2ME6A 3DKYA 3OY9A 3ABMH 3CZ6A 2KZGA 4GRIA 2FX0A 3BCBA 4BDYA 2UZKA 1FP1D 2ELJA 4DBQA 1GXPA 2PFBA 3SHFA 2OTJI 2CRGA 1B59A 3I4PA 1V55H 3HG9A 3IKVA 4I7HA 3FXMA 2LMDA 4P9FA 4Y3OA 3VYUB 3WGGA 1S7EA 2ZXWH 2EPFA 1LEBA 3ONQA 1AOYA 5IP9J 2WAEA 2P7VB 4I02A 4TV7A 1H8AC 2EZIA 3G4SI 1F5TA 2Q2EA 4KN4X 2A3SA 3LSKA 1MBFA 2A6TA 1QPIA 3CP2A 3EYYA 4RB2C 1YFHA 2A69F 4OU0A 5CLSA 1L0OC 5J4YA 2FBIA 3TL4X 3OYEA 2XF6A 4I0AA 4D0PA 1WSUA 2ELHA 3PUBA 3T1BA 2MSYA 4YG2F 1XG1A 3TW6A 3CCJI 3EDPA 3PO2J 3M7GA 5ICGA 4CXFA 1O3TA 4OMZA 3G1MA 4CGZA 4II2A 4Y7NJ 5C4JJ 2IS1A 5ILSA 1LUJB 3K0LA 5D5WB 3E5XA 2RQPA 1Z0XA 3HPGA 2LRDA 3KP6A 3CCMI 1PP7U 1E2XA 5DUKA 4UV8A 5L3DA 2JA2A 1X1AA 3DTKA 2DFEA 2KJCA 1Z1DA 3FMQA 3KLOA 1Z05A 2VKVA 3VFZA 1UCRA 2NNYA 2VKDA 1SFUA 1Y1VJ 1GXQA 2VC1A 3CO7C 5HLGA 3S16J 1NK3P 1E3OC 3V42A 5M5WJ 3CCRI 3ZMUA 1HXDA 1MNEA 3HHGA 3LWFA 4JX6A 4S04A 1V5GA 2HQNA 2B9SA 1R1TA 3QWLA 4UVCA 1IN5A 1OYWA 1ONVA 1ETVA 2L9VA 2KFDA 3HRUA 4RGSA 1HF0A 4ZYAA 1B72B 4BJ5C 2PEXA 2VXZA 1OCPA 4I99C 5CYVA 2Z33A 1P4WA 2M0MA 1HDPA 1O3QA 3RZOJ 5IYDJ 3PIPF 1AA7A 2VE9A 3F6OA 4MNUA 4BXXJ 3B6AA 4DZPA 3MKYB 2HFHA 4N4OB 1DP7P 1USSA 2F4IA 5K1YA 4Q5SF 4KN7X 2P6TA 2HGCA 2O61A 1X3WB 5C4XJ 3HRMA 1OKRA 1XPXA 1BM9A 2K4BA 2LKSA 1ON1A 2X1DA 3DQVC 4GFBA 1LFUP 2E5ZA 2GAUA 3BZCA 4EJTA 2R5YA 2OJED 2WC2A 4D9JA 2J5OA 3ZMVA 2DA4A 4JYKA 2LR8A 1D8KA 3V8LA 3OL3A 3O8GA 1R36A 2R5YB 3CMAI 3P5JA 3DEUA 4MQVA 3BLYA 2F5FA 2E1MB 3H9JA 1SD7A 4RAFA 2FU4A 2R7VA 2OZ6A 2L5QA 4IO9F 2K3PA 1YJWI 3H35A 5GTIC 1TQPA 1G4DA 2X48A 4H4KC 3WG7H 3F0CA 1XGSA 3VYRB 2OPTA 4XOTA 2ZJPF 3L2CA 4JBAA 5EJCA 4CCJA 1OCRH 1JKOC 3OYJA 4GDFA 4IRIA 2JMWA 2ZJ2A 3ZN0A 4NHJA 2BV6A 4JX5A 2DT5A 1K6OA 1Z6TA 1I50J 3TDUC 5L3GA 3ELKA 1BN5A 2CG4A 1TW2A 4XLFA 4HG2A 1WVRA 2E34A 1HW1A 3HHHA 4I76A 3KX2A 4C30A 1RETA 2BW3B 3FXQA 1YTYA 5BS6A 5EGOB 3LQQA 2FMLA 5E8IA 3MQ0A 1OR7C 2IXSA 4LIVA 4A3LJ 1SEUA 3BOQA 1M1EB 5FFZA 2Z3YA 1RUNA 1RR8C 2JRTA 2BYVE 2VBZA 4XM3A 1ODDA 4RM2A 3ZXSA 1KU9A 2LREA 1G6NA 2VJ5A 2IGNA 4DBRA 1ZREA 1YS7A 4B8XA 4XRFA 5F27A 1WH7A 5ILVA 3I4NJ 1BR1A 2ESNA 2A05A 5GAGJ 2W7NA 2DDBA 4Z2YA 4E7SA 3I53A 1EH6A 1MJBA 4NC6A 3ZQIA 4M6XA 2KMUA 1SAUA 2H8RA 2K7LA 1JGSA 4LK1F 2KP6A 3BR1A 2JA7J 3RSNA 2IGMA 3DTEA 3I0TA 1O7LA 2HR3A 2OAZA 2B63J 2EV5A 5CKTA 4BS9A 1ZGWA 1R5ID 1LE8A 4YIIA 4S05A 2D1VA 2DCEA 3H5NA 3HRTA 3KFWX 1KGSA 3MZYA 2CFOA 3R4KA 1OCZH 3G3ZA 2IS6A 1LE8B 2WV0A 2OA4A 1ETQA 4R1HA 4HNTA 4ABZA 3S2DJ 5F1RA 1FOYA 3K1PA 1P7JA 2KRCA 3CQZJ 1J0RA 5LHHA 4HV5A 4P1WA 1AWCA 1EV7A 1BR2A 4G6QA 3D0SA 2XAFA 4LLLA 4O3MA 2C6YA 2ZNYA 2EK5A 4GYIA 5GPCA 3NQOA 3E5UA 1BI2A 4B48A 2D5VA 2ZSIB 1I1GA 3RKYA 3M4OJ 2FMYA 4LJZF 2A6EF 2DMTA 3DPUA 3QPTA 4KFCA 1P4XA 3CUQA 1VNDA 2E35A 3HIFA 4BHCA 3HB9A 2DN0A 2DFIA 2EZKA 3GF2A 4UB6C 5LGTA 2M1BA 5IT9Z 3I9V2 2O0YA 1TWHJ 3I3LA 4BGDA 2VL8A 1K83J 4XSXF 2M5WA 2LOOA 3Q0WA 1R22A 4BEHA 3ASOH 4C3IJ 2FSWA 2V1XA 1ZRDA 3G73A 3HM5A 5IP7J 4PGHA 1P2FA 1KYWA 5IT9K 1X1CA 4IPAA 2MFZA 3RKWA 3QQAA 4M3GA 1SANA 2LNBA 5J8CA 5GTHC 3F8MA 2O8KA 3CCEI 5E18F 2X85A 1BW5A 3TW7A 2H09A 3HYIA 5BPDA 3G1OA 4PFOA 2IGKA 4XNFA 3ASNH 2HS5A 4DQ2A 1E17A 1WJCA 5FLVA 4AIKA 3AG1H 1O7FA 3K70D 2GM4A 2JWTA 2L7FP 3TO7A 4CH7A 5H20A 3ZQQA 2M30A 2L7MP 2QZ8A 5D8KB 2NVUB 4ZH4F 2GOXB 2DFFA 4IQ4A 1K7AA 5AONA 5HDKA 2LDUA 3KYLA 2ZNZA 3WTVC 2PJRA 2FEZA 5DCMB 3OWTA 4QWQA 2XPWA 2GWRA 1QZEA 4A2UA 4DOZA 2DDAA 5D5XB 3CUOA 4HW0A 5J1UA 4HDVA 2BY3A 3S14J 3CC4I 1Y8RB 4NQWA 2ME0A 2HPMA 3GBGA 3HZJA 4MIMA 4R8HA 1FMVA 3GFMA 1U3EM 3FXOA 3I59B 2TCTA 2XGCA 5F0CA 1TP4A 2WAQN 4C2TA 4V2GA 2QSHX 4XKBA 1R1UA 3R0JA 3WE2A 4ZJZA 3K70C 1OMIA 1YW8A 3E6DA 1QO0D 5FO5A 3QU6A 4ENKA 4ZTJA 2JA6J 4RLFA 2CSOA 3L9FA 3PSIA 4A3GJ 5DS9A 1BA5A 4DIQA 4AIDA 1QRYA 2VODA 2MA3A 2P81A 4IZZA 1A35A 3LSMA 1X1DA 2K9QA 5KVRA 4F3QA 1MDMA 2HTJA 2X1CA 3JRGA 1Y56A 3CCQI 1ULYA 1OLTA 2W57A 3K7AJ 3LNQA 3OYKA 3F8FA 4M3DA 1IRFA 3DP7A 2DODA 5DYMA 2KZVA 2Y0SN 3LA7A 4OIPF 2A07F 4V2FA 4XOPA 1KU3A 1WJDA 2HXOA 3VODA 2R0QC 4KJZA 3OIOA 2XRNA 4IHYA 1B9NA 4IRHA 1J2XA 2TRTA 5JVTA 2EQRA 2O6GE 1IUYA 2L01A 4NB5A 3H0DA 2AQFA 2HVRA 1HSJA 3DXJF 5TRDA 1W1WE 3K4MA 2P5VA 1HLVA 1T0FA 2DK8A 3WU0A 4M3BA 4U0WA 3M8JA 1FIAA 2UXNA 2DT6A 4ZYGA 4U7DA 3OR1C 4CDGA 3QP5A 1IW7F 3HGGA 4ON0A 1G8XA 2QWWA 3TOAA 1YJ9I 5D6FA 2JJ7A 3DKWA 3S3OA 3FK7A 1NG7A 1IJWC 3ECHA 4O6JA 1DUXC 3BCAA 4XSZF 1D1BA 2M8GX 1B1BA 3F6VA 3FISA 4YEJA 5A2QZ 3OS0A 3GLLA 2ZXJA 3AL0C 1SVMA 2K4JA 2ZXHA 1RRJA 1TWGJ 5KHDA 3RDIA 5K7FA 2OUMA 4B44A 3VYTB 4XK4A 5E1ZB 3D1NI 3OMYA 1A04A 1J75A 1BJAA 3K1MA 3GFJA 1FPQA 4XLEA 5LLQA 4RAGA 3SXYA 4F7ZA 1Y8QB 4U0YA 3BG6A 5A2QK 4RM3A 2L02A 4XL9A 1A36A 4BJ6C 3KETA 3ZR8X 2W84A 4M3EA 2PN6A 4N9IA 3W2AA 2BHZA 2IAIA 2P8TA 3JRAA 3S2HJ 2EJRA 3OYAA 2M34A 3F22A 1MNMC 1YRNA 1TL8A 4KT5C 4M9SA 5D5UB 5GADJ 2EFOA 1VI0A 4LB6B 2ZC2A 3E6MA 5EDNA 3SEQA 4XONA 2YS9A 3AG2H 1GVDA 2M7AA 3FXUA 2H94A 2A5YB 2FQ4A 1QQIA 1QU3A 5LEJA 2KJBA 1JT6A 1REPC 1YX3A 5IY5H 2M9HA 1VF9A 1H89C 3V7SA 2CQKA 4XLAA 3W2VA 3JRCA 1FSEA 2BGCA 3RKQA 2ZMEA 4ENMA 1Z7UA 1ZARA 2YR2A 2BXZA 3P9CA 2P5LC 1ZELA 5EZHA 4PJLA 4B47A 1MBEA 1YW9A 1IUFA 1QA6A 3M3YJ 3BR3A 4B3AA 4A3MJ 3W6KB 1RR7A 2K9LA 1X4PA 3G71I 4N0BA 4P55A 1A6IA 2FF4A 4CYDA 2M2EA 1IG7A 2KDOA 2OBPA 2Z9OA 1XMKA 2BBYA 2EZHA 4BJTA 4AIHA 1GV2A 1WJEA 4AWXB 3JRHA 2I8DA 1Z3XA 1JT0A 2DA7A 1S7OA 2CMPA 1H88C 4DZJA 2FNPA 1G3YA 2K5CA 1WWXA 4E7HA 1R5HA 1RZ4A 1IXCA 5E20A 1D0XA 1F36A 4W1UA 2X0LA 1T38A 1J09A 3WHCA 3CDHA 5E79C 3DPTA 1EA3A 2QM3A 2HVQA 3EUKL 3GXOA 2NNNA 1QNTA 2HDWA 2IA2A 4FHTA 3MVPA 4FE4A 1DDNA 2R5ZA 3RJPA 3GZ6A 2XAJA 4HQEA 2CYYA 4BNCA 3S1MJ 2DK5A 1ETXA 2RAEA 4RLQA 3E3VA 2EWNA 1KQ9A 5J8FA 5LRSA 1LDKB 2FQ3A 4CCLA 1MNDA 1K78A 1LDJA 3DBHB 3FK6A 2V9PA 3IRRA 2E5NA 3PL8A 4E6KG 3MEXA 5LEKA 1WRJA 2RKHA 4BY7J 1K4SA 1IAWA 2IPQX 4ANJA 4WWCA 1HKQA 4A3BJ 2WA0A 4A3DJ 4MFDA 1N25A 3BJAA 4OIOF 3H9GA 3O3KA 3SFZA 4KDPA 1HC8A 5K5OA 2KHMA 2ELKA 5IP6A 1Z9CA 1XS9A 4EM2A 2H6CA 1G3SA 2WAQA 3JR9A 2ZSHB 4LLGF 2XPUA 2R7OA 2DQRA 1ETYA 4XORA 4D5FA 2M3AA 1S7AA 2QUFA 2XUBA 4XLHA 1XSVA 1EKEA 2PBIA 2YX7A 3RYRA 3P7NA 1W7PD 2YU9J 2AHQA 5BOXA 3ABLH 2KDZA 2D45A 1L3LA 3HTUA 2XIGA 1JKPC 2VQGA 3P9KA 2VOOA 1WGXA 3KEQA 4P5OA 5FD5A 4IHXA 3S32A 5HLIA 9ANTA 3HEFA 3AL0B 3Q0VA 1V5FA 1QHGA 2L9SA 2X51A 1R4MB 1Z21A 3LA2A 1FJLA 2JZYA 4V19K 1MMSA 5J4VA 3MKZA 3M9AA 4A12A 2WV1A 2CGPA 3WODF 1O4XA 3Q0UA 2XF5A 4Y4RA 5ERIA 3HOTA 2Y0SA 4I01A 3G1LA 5L3FA 2UV1A 2DMNA 1K79A 4II3A 3S1QJ 2W48A 1HKTA 3QP6A 4QPQA 5EG0B 3MN2A 4A0YA 1B9MA 2H27A 1BR4A 2IA1A 2NVTJ 4EQQA 4IHTA 1UFMA 3H92A 2L4MA 4OIRF 4KIGA 3W6VA 3M8EA 3ZMZA 3OYBA 3H5RA 2MH2A 1JUPA 3JRDA 3L2WA 2VT2A 2FRHA 2VXDA 2W24A 3K69A 2VQLA 5E3OA 1LNWA 1KQ8A 1XDSA 1G3TA 3MAJA 2R7DA 5F0HA 3QYEA 4ENNA 4A0ZA 3GTLJ 3PJRA 2FJ1A 2GOMA 2DOAA 3LFKA 2ID3A 3HSFA 2KKOA 4Y17A 1MIJA 2XGXA 1VQOI 2WADA 4PJ0C 2KIQA 2Y48A 3NWTA 2NOGA 2PQ8A 3GTGJ 5H6RA 1FY7A 1UHSA 3QRFF 3K9TA 3BP8A 3EQLF 2Q2EB 1TQIA 2DA5A 2XAUA 1BC7C 2VOPA 4MTDA 2NAZA 2EFNA 1JI8A 3VOEA 3DU5A 3QYFA 2V1UA 4AM3A 1GVJA 2PMZA 4GO1A 4LD5A 4Z6YA 2DFHA 3OIPA 2IS4A 2OF7A 4Y15A 1I39A 2CUJA 3FWEA 2HZTA 2VJ4A 4A3FJ 3WE3A 4EMSA 1FTZA 2JT1A 4FX4A 3V7CA 2XKOA 3DEEA 1QVTA 2NVQJ 2E1OA 3JSPA 3CMYA 1VQMI 1MGTA 3A0BC 3CJRB 2M8EA 1U8RA 1F9NA 3PNVA 4I6ZA 4MEXF 2M4KA 5TGTA 1FBSA 4I0BA 1YITI 2LG4A 4KNYA 1U78A 1YIJI 1C0WA 3OYFA 1OISA 1WCMJ 3LA3A 2LD5A 4PCQA 4LITA 4XBFA 1XMXA 1MJAA 3K4LA 5L3BA 3ZMSA 5BQTA 1TW3A 2NS7A 3HC7A 3VEPA 3NARA 3O2PE 4BE2A 3SYTA 3GUDA 2WY7Q 1OFCX 2L54A 1OYYA 2CQ7A 3CUQC 3OV8A 3UNGC 4KITB 1ZRCA 5K7HA 3BG7A 2JN6A 1SFEA 4E4HA 4M6VA 2JTVA 1R00A 2RREA 3S3MA 1D5YA 2STTA 2V7FA 3GZ5A 4I98B 3TKYA 1V5EA 3OYLA 4A3CJ 3BTCA 2AXLA 2VBXA 2XV4S 3M1EA 4UHTA 1TWAJ 2DYSH 1HQCA 3L2VA 2XRLA 3EUHA 1ZG3A 1XMAA 3CLOA 4HBLA 3LFUA 3TMOA 1KYZA 3CMMA 3NWSA 3FBNB 5FRNA 3Q9SA 3R61A 3TP3A 4Y52J 1NK2P 3FMSA 2DPUA 3BTLA 1OCOH 3V8KA 3COAC 1F1ZA 1UG0A 4PUSA 4CCNA 1BI1A 4NDLA 2DW4A 4Y13A 2HOSA 2L0KA 5EEAA 4PK4A 1PUFA 4A3KJ 1U2WA 1J59A 4NNJA 2NOJB 1MMDA 5FKKA 1MBGA 2RGVA 1XGOA 4E7JA 1VFCA 4UUVA 3LOCA 2HOAA 4D7MA 1W7PA 2F5VA 2VE8A 3H1CA 1WI3A 1P9QC 3F72A 3WTWC 1STZA 2V1NA 3WTUC 2O3FA 2KRHA 2K85A 1XDUA 4FT8A 5CVJA 5E3NA 5E8GA 1W7PB 1TWFJ 2QA4I 4PSXA 1JXSA 3OYGA 3EYIA 4BYYA 3C1DA 1W0UA 1FOXA 1PVEA 2BY0A 2E7XA 3PNTA 4ZZLA 4WCGA 1LDDA 2BY2A 1UELB 1EJ9A 2DA3A 1UHWA 4PJJA 1JTYA 1QHHD 2VN2A 2BY1A 1GLNA 3IHUA 4EGZA 2CW0F 3RPQA 2WWYA 1GT0C 1S72I 2XASA 3ZQGA 5HOOA 3WTYC 3T8RA 1E3PA 2EV0A 1SD4A 3JRFA 4BH9A 1J9IA 2EILH 5E1WA 3AG4H 2MD5A 3D5LA 4HNVA 1XCVA 4R79A 2ID6A 1DP3A 1ETWA 4A5MA 1R7JA 1XCBA 2KISA 3QOEA 5IOYA 3J81Z 3CO6C 2Q1ZB 4BBSJ 4LG3A 3WTSC 4I2OA 4B1RA 2CO5A 3S1RJ 1PUEE 2B0LA 1RPWA 4G12A 2YX4A 3PNYA 5FFXA 4JOMA 4Q48A 3OYNA 3MZ8A 2FNAA 3IP4B 3J80Z 2AXTC 5JLWA 1ZKGA 2ADUA 3HBLA 5JHUA 2PLYA 3PSFA 3GEZA 2CV2A 4X6AJ 1ZN2A 5M3FJ 5GP9A 1FP2A 4PFPA 3WTZA 4YFKF 2PI0A 3J81K 3L1PA 4XQFA 5L3CA 2FBKA 3QOPA 3I56I 3WTTC 2DPDA 1N78A 2E7WA 4IJAA 1KU7A 2VUMJ 1KA8A 1Y0NA 2NS0A 3OL4A 4E70A 3HUGA 1IDZA 3V8JA 4XRMA 2JQ7A 4CO8A 3K10A 2VKHA 2Y0MA 2V79A 1WFXA 3K6GA 3GFLA 3B02A 1MH3A 1RESA 2X4HA 1N75A 2ZKZA 4DYQA 3FHZA 1PYVA 4EM1A 2ZBKA 1T0FC 2QBYA 1YX5A 1Z67A 2D1HA 1W36D 3VYSB 4A3JJ 2DOEA 4HPQA 3H5AA 1TBXA 2H6BA 3GTKJ 1G59A 3TO6A 3FDYA 1LJ9A 2RVCA 3LL7A 2MG4A 1XSXA 3SZTA 4LGWA 5F1JA 2CV0A 3LQRA 5DD8A 3CUQB 3FXJA 4IL6C 3BDDA 2F4MB 4E7ZA 3DLLF 4PJNA 5EF6A 4QTRA 4MO7A 2HYFA 2TDXA 4YIFA 1H9GA 1XC5A 2V6CA 3JREA
chains in the Genus database with same CATH topology
4XLCA 4IKFA 3EUAA 3AL0C 3ZGKA 2ZXHA 3CF2A 4BEHB 5KHDA 3K4KA 1D1CA 2OUMA 2LBFB 4B44A 3VYTB 3RQ4A 3HPHA 3LSGA 2HU9A 1LFPA 3OMYA 2E1MC 2LH9A 4XMYA 2X6WA 3HOSA 4XLEA 2MYSA 4ZDPA 1X4OA 3BG6A 4RM3A 2O5RA 1W36C 3U21A 4XL9A 3K4NA 4BJ6C 3ZR8X 1LKXA 1VZ0A 5HNHA 3OOUA 3A4CA 3MD2A 4FETA 2VJIA 3W2AA 4J00A 5HVQC 3A2KA 2KPMA 3OYAA 2R7UA 2JSPA 4F55A 4DJAA 4RMNA 3TBIA 3DWLE 3DKYA 4BQOA 4AVZA 2W82A 2CH0A 3CZ6A 3K4BA 3OY9A 4KISA 1HA8A 4GRIA 3DKXA 3BCBA 2Z16A 4XKWA 3LSIA 4BDYA 3D5SC 2ELJA 3SEQA 1T95A 4XONA 4DBQA 1N77A 1D0YA 2M7AA 2W4SA 2VQCA 3VWBA 3FHNA 2PJRB 1QU3A 3OR2C 3HG9A 1MMGA 3J7AY 4OAYA 1YX3A 4Y3OA 4ZDLA 4XLAA 3W2VA 3VYUB 4BACA 3AFHA 2M7BA 2BW3A 3ONQA 4BQQA 2WAEA 1ZELA 4PJLA 4QPOA 4B47A 4BE1A 4NQWB 3LSKA 2A6TA 2K9LA 3CP2A 3W2WA 1X4PA 4X0GA 4C9YA 2KDOA 2VPLA 3PFYA 3TL4X 3OYEA 2XF6A 4BJTA 2WBMA 1WJEA 3PUBA 2I8DA 1Z3XA 3SDBA 3AKZA 2CMPA 2JVHA 2R4GA 1Y6IA 2K5CA 3OIQA 4E7HA 4XKVA 1X1BA 2CW8A 3W3CA 4U7BA 1D0XA 4II2A 4BUPA 2CUZA 4CA0A 2IS1A 3VSKA 1J09A 2VASA 3OYHA 3UR3C 3HPGA 2LRDA 3DPTA 1EA3A 2JA2A 2HVQA 3EUKL 1X1AA 3M1CA 1SFKA 2HDWA 3DTKA 5LFAA 4BU2A 2VKDA 4RLQA 3HUGB 1U0JA 4NUBA 2CW7A 3SEZA 4BXFA 1WJAA 1LDKB 2FUG2 3V42A 4CCLA 1MNDA 2V9KA 1MNEA 2E5NA 1V5GA 3PL8A 4E6KG 4MLOA 2E60A 4ZYAA 1WJ5A 4BJ5C 2XC7A 2VXZA 4ANJA 4D1QA 4EATA 4E7IA 2M0MA 2WA0A 3L2QA 4HNUA 3H9GA 2KHMA 1AA7A 2W1OA 2OV7A 3VSLA 2WAQA 3MKYB 4N4OB 2ZSHB 3C2HA 2F4IA 2R7OA 3CESA 4XORA 3OS0A 2M3AA 4CCMA 4XLHA 4BQNA 3SZGA 3QODA 2X1DA 3DQVC 2R7QA 2E5ZA 1FMWA 5FROA 2VQGA 4P5OA 1Z7LA 4D9JA 3S32A 3AL0B 1V5FA 5HNFA 1QHGA 2L9SA 2X1EA 2X51A 1Z21A 2HZDA 3LMMA 2R7RA 2BOLA 3OL3A 3ZRGA 3MKZA 2CV1A 3OS2A 3BLYA 2E1MB 3H9JA 4Y4RA 2XF5A 3HOTA 4PJMA 2K9MA 3MKWB 2Y0SA 2R7VA 3HL2A 2L5QA 3FKJA 2UV1A 4II3A 2QKLB 2BVLA 2K3PA 5FRMA 3H35A 4QPQA 4NC8A 4H4KC 3OYCA 2KLOA 1BR4A 3VYRB 4XOTA 1K6YA 1NG6A 2KL4A 4HEA2 3OYBA 4BL0B 3H5RA 4CCJA 3L2WA 2VXDA 3OYJA 2F6CA 2XF7A 2VQLA 1WJFA 3KEYA 4U87A 3QYEA 4HSTA 4B3XA 2R7WA 2A5WA 3PJRA 4XLFA 2GOMA 2DXIA 2DOAA 4HG2A 4CCOA 3KX2A 2WADA 4JQFA 3NWTA 4C30A 5CPRB 2BW3B 2L7KA 1D1AA 5JHFA 2LC2A 2Q2EB 1OR7C 2IXSA 4LIVA 4OWRB 2XAUA 4NC7A 2LY1A 4HRIA 3E1SA 1TZLA 5KNLA 1JI8A 1IRXA 1WJBA 3BC8A 3DU5A 3QYFA 2R7TA 3FBIB 4XM3A 4RM2A 3ZXSA 2LREA 2P0WA 2VJ5A 2IGNA 2PMZA 4DBRA 3OIPA 1BR1A 2IS4A 4ZC3A 2W7NA 4E7SA 2RNGA 3A1YA 2KMUA 1SAUA 2CUJA 2VJ4A 4CSWA 2Z1DA 2KP6A 3RSNA 2IGMA 3DTEA 3IUOA 2M4GA 2V4JC 5CKTA 4BS9A 4BDZA 3DEEA 4DGWB 2DCEA 3H5NA 3CJRB 2VIXA 3PNVA 2CFOA 2M4KA 5TGTA 4B43A 2IS6A 1MMNA 5CQGA 4HNTA 1MW7A 2LG4A 2KRCA 3OYFA 4P1WA 1BR2A 4LITA 5CQEA 2UWMA 3K4LA 4C2UA 3G2BA 3HC7A 4B48A 2MABA 2ZSIB 4BE2A 3SYTA 2WY7Q 4XN3A 3DPUA 3UNGC 3QYBA 2X6XA 4KITB 3BG7A 4XR6A 2HNHA 4E4HA 2HQAA 2RREA 3S3MA 2V7FA 3HXLA 3H9QA 1PJRA 2WY8Q 2WB1A 3I9V2 1V5EA 3I3LA 3OYLA 4BGDA 4N4NB 4F92B 3ZCOA 2VL8A 4CZCA 1X19A 3D5RC 2VLAA 3EUHC 2DJIA 2MC4A 2LOOA 4E7KA 3L2VA 1KONA 3CJQB 3S8PA 4BEHA 3LFUA 3TMOA 3CMMA 3NWSA 2LBFA 3FBNB 5FRNA 4OAZA 4CCKA 1X1CA 3K4CA 1R6RA 2MFZA 2MD0A 2XSJC 1LVKA 4BE0A 3OYIA 5HLTA 2HPIA 2X85A 2ZFUA 2Z2SB 4CCNA 1UG0A 4PUSA 4PFOA 4ZDOA 2IGKA 4XNFA 3OYDA 2RQQA 4PK4A 4XKCA 1WJCA 2VQHA 4NNJA 2NOJB 1MMDA 3HKZA 2LY2A 2IGOA 3K70D 4CH7A 4G6TB 3ZQQA 4E7JA 4F52A 1E0EA 2L9NA 2GOXB 2F5VA 4IQ4A 2UUZA 4E7LA 2ZXIA 3S3NA 1P9QC 4AU7A 2V1NA 3KYLA 2R7SA 2PJRA 3OWTA 2KRHA 2L2OA 4CUGA 4PSXA 3DLAA 4DOZA 3OYGA 3IAS2 3PNTA 4J01A 1UELB 3DPLC 4PJJA 1QHHD 4KT6A 4Y33A 1ERDA 1DGWY 2HPMA 3GBGA 2XDVA 1FMVA 3LSHA 1GLNA 2R7XA 1MMAA 5HOOA 4LIUA 5LD2C 4PSWA 2KQRA 4C2TA 4XKBA 3D5LA 4ZJZA 3K70C 4ZTJA 2AQEA 4R79A 2HVSA 1DP3A 3RCOA 2V26A 3EPZA 3QOEA 4RLFA 3PSIA 2Q1ZB 4LG3A 1BOBA 4F93B 4DIQA 1Z3YA 3OS1A 4JOMA 3OYNA 4IZZA 4F91B 3OYMA 3LSMA 1X1DA 3IP4B 4F3QA 4AYBA 3PSFA 2CV2A 2DT7B 2X1CA 2VB6A 1Y56A 4PFPA 2IS2A 1OLTA 4XQFA 3OYKA 1N78A 4FASD 3N05A 2CS3A 4YRVA 3DU6A 3OL4A 2KZVA 4ZTFA 2BVMA 1S9HA 1WJDA 3K4JA 4XOPA 4YELA 3K10A 2VKHA 4KJZA 4XN0A 1WFXA 1D0ZA 3K6GA 3E0JB 2LYCA 4IX7A 1DGRM 3IAM2 1N75A 3L2RA 4IQJA 2W00A 2VJJA 1PYVA 3H0DA 2AQFA 2HVRA 1YE9A 3RTRA 1T0FC 2QKMB 1YX5A 3K4MA 1W36D 3VYSB 4HPQA 3C2GA 3S93A 3H5AA 2JVGA 3M8JA 2JUGA 1G59A 3FDYA 1DQUA 3L2UA 1TT0A 2DT6A 3VDXA 4HSRA 3LL7A 3OR1C 3RPUD 2CV0A 1G8XA 3CP8A 4E7ZA 5KCMA 4ITVA 4PJNA 2OC6A 3DTIA 3F9KA 1NG7A 3S3OA 2V6EA 2X6YA 2WAFA 3BCAA 1D1BA 3MMYB 3PNYA 4YEJA 1UAAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AQE A;  2DCE A;  2AQF A;  2CUJ A;  2ELJ A; 
#chains in the Genus database with same CATH topology
 4DYR A;  4XLC A;  1UJ8 A;  1YW7 A;  2VON A;  2GBY A;  2EV6 A;  3ZQH A;  3CF2 A;  4BEH B;  4HYE A;  2CQN A;  2QQA A;  2L7Z A;  1GDT A;  1VQN I;  4EM0 B;  2F5C A;  2K02 A;  3IH4 A;  5ICE A;  2IRF G;  3HOW J;  2X6W A;  1IF1 A;  1WPK A;  2DMQ A;  2Q8K A;  3QPS A;  4ZDP A;  5HOD A;  5F64 A;  4UB8 C;  1W36 C;  4G7O F;  3ZQ7 A;  3K4N A;  1T39 A;  4EJW A;  3I54 A;  3KZZ A;  2HYG D;  2P4W A;  3M07 A;  3A4C A;  3OOU A;  1XSD A;  3GW2 A;  2VJI A;  2LTP A;  4GYG A;  5HVQ C;  4XLP F;  2W85 A;  2KPM A;  3FKI J;  2VPR A;  2HTS A;  4DJA A;  1R71 A;  4IF4 A;  2W82 A;  4KIS A;  3K4B A;  2N8G A;  3J7Y J;  1U5T A;  4D5C A;  5D6E A;  3TDZ C;  3DKX A;  1QBJ A;  5EEH A;  3LSI A;  3D5S C;  5BNG A;  1T95 A;  2EA2 A;  1D0Y A;  2NYX A;  2W4S A;  2VQC A;  3O8H A;  3VWB A;  1WKM A;  1U5T B;  3FM5 A;  3FHN A;  2PJR B;  2CUF A;  3V4G A;  1RC9 A;  1SVL A;  3OR2 C;  3O6B B;  1MMG A;  1Y0U A;  3J7A Y;  2XB0 X;  3GME A;  2ZME C;  5D5V B;  3WHB A;  3AFH A;  2G0E A;  2M7B A;  2FA5 A;  2H8W A;  1MSE C;  4BKX A;  1ETO A;  4P9U A;  4BQQ A;  4QPO A;  3KEO A;  4NQW B;  2JPC A;  4AVP A;  1IRG A;  1HKS A;  1R58 A;  4HX4 A;  3W2W A;  4J19 A;  2DMU A;  2G7H A;  2AS5 F;  4X0G A;  2QYO A;  4YFN F;  2Y2Z A;  2LF8 A;  1EH7 A;  2WB1 N;  3FM3 A;  4C9Y A;  2VPL A;  3PFY A;  2LF7 A;  2PX9 A;  4RBO A;  4NBQ A;  1MBK A;  2FD5 A;  4AIJ A;  4FCY A;  5B66 C;  4A93 J;  2EIM H;  3ZMD A;  3SDB A;  1GUU A;  2R4G A;  2GQQ A;  1FT9 A;  4KIF A;  4ZYH A;  5LGN A;  1FYK A;  3ISP A;  4XKV A;  4RGR A;  1X1B A;  3W3C A;  4IOA F;  2XGE A;  1BW6 A;  4BUP A;  3JAM Z;  3ZQC A;  3VSK A;  3OYH A;  2K27 A;  3CTA A;  4XRS A;  1MDM B;  3CCV I;  1U9O A;  3KCC A;  2P5K A;  1ON2 A;  5HS7 A;  3KP3 A;  4HA8 A;  5FKN A;  2YSR A;  4UNO A;  3M1C A;  1SFK A;  4BQA A;  3GTM J;  3MWM A;  5LBQ A;  3PUF A;  4QLC U;  2CUE A;  2WTE A;  3DBR B;  1OYI A;  2VBW A;  4HX8 A;  3JAM K;  4NUB A;  4BXF A;  1ZQ3 P;  2FBH A;  4KA4 A;  3CME I;  3HKZ N;  2FUG 2;  2G9W A;  4FX0 A;  2HYJ A;  3DCF A;  4HDU A;  1S5L C;  1FC3 A;  5IYB J;  2OCE A;  3LSP A;  2E60 A;  2JPB A;  1WJ5 A;  2XC7 A;  2H1K A;  3BR0 A;  3BRO A;  4E7I A;  3KE2 A;  2EBI A;  5K5Q A;  1UST A;  1A5J A;  4RB3 C;  3KLN A;  5D4R A;  5ICF A;  1HCR A;  3BY6 A;  1RKT A;  3K1N A;  1X3Z B;  2W1O A;  2XPV A;  2ZO4 A;  2R92 J;  3KP2 A;  2PMH A;  4HAM A;  2RC4 A;  4XIC A;  4LB5 A;  4AUX A;  4WXC A;  4CCM A;  1AKH A;  3CD6 I;  2XGD A;  3L00 A;  3WTX C;  3A03 A;  3E97 A;  1FMW A;  2E1C A;  3FMR A;  4A6E A;  1Z7L A;  2K86 A;  1IRZ A;  3Q9V A;  5FLM J;  5HS8 A;  2CWE A;  2F2E A;  3AAF A;  3N4M A;  1LPQ A;  1AKH B;  5HNF A;  2X1E A;  2HZD A;  2DQL A;  2R7R A;  2BOL A;  1S29 A;  1VQ4 I;  1T33 A;  1BIA A;  2X6O A;  5EYR A;  1MKM A;  1VQL I;  1DU0 A;  1VTN C;  2EFP A;  3MKW B;  1ZAO A;  3QU3 A;  4UUS A;  1W4M A;  3FKJ A;  4AYB N;  3BG3 A;  3IC7 A;  2QKL B;  2BVL A;  1FNN A;  5FRM A;  2FOW A;  2RV8 A;  2A6H F;  3GCM A;  4BAY A;  2HDD A;  3CDI A;  4CIC A;  4NC8 A;  5D4S A;  4A5N A;  5B3S H;  2GIZ A;  2KLO A;  2E36 A;  4UUS B;  2LKX A;  2OQR A;  1T8I A;  2E2J J;  1YRN B;  1FEX A;  3H36 A;  1NG6 A;  4HEA 2;  4RS8 A;  4BL0 B;  3H3U A;  1DU6 A;  2LY9 A;  3F8C A;  1J7K A;  1WJF A;  3KEY A;  4MHG A;  1XN7 A;  2CFX A;  2E1N A;  4OIN F;  3HRS A;  4GGG A;  1O3S A;  4G7Z F;  2R7W A;  1I27 A;  2A5W A;  1H0M A;  3K2A A;  2LP0 A;  1UB9 A;  3TO9 A;  2DAO A;  3KZY A;  2ESH A;  2COB A;  2DMP A;  5M5X J;  2ZME B;  3H3Z A;  5CPR B;  2L7K A;  2NVX J;  4M72 A;  3ROU A;  4L9J A;  1TC3 C;  4NC7 A;  1ZR4 A;  4HRI A;  1X3U A;  2NS8 A;  1TZL A;  4G7H F;  4WK8 F;  1WJB A;  2QEN A;  4OMY A;  1RNL A;  1UMQ A;  2EB7 A;  1BJZ A;  5FJ8 J;  1IXR C;  2A61 A;  1FYL A;  4LFU A;  5J47 A;  3GO5 A;  4ZC3 A;  4IXA A;  1G3W A;  5H6Q A;  3A1Y A;  2F48 A;  2Q0O A;  2H1L A;  2OU2 A;  3CJT B;  2HKO A;  1K61 A;  1IGN A;  2M4G A;  1T56 A;  1D5V A;  2COM A;  3DV8 A;  4BDZ A;  1AHD P;  1SMY F;  3LST A;  1ETK A;  4DGW B;  3C7J A;  1HBX G;  3GWZ A;  1ZLJ A;  2LKP A;  2K3F A;  5JFR A;  3KPH A;  2LLK A;  2R5Z B;  1BOA A;  4WXH A;  2QSF X;  4B43 A;  1ZG1 A;  5CQG A;  5FGM A;  1BBY A;  4A3E J;  3MKL A;  2W25 A;  2DBB A;  2L3D A;  1ZG5 A;  3KIO A;  2Y75 A;  5TJJ A;  2HOE A;  5IOZ A;  1S3J A;  3PQJ A;  4BHP A;  1V54 H;  3I58 A;  1K78 B;  3NEU A;  1TQM A;  3ERE D;  2B7E A;  3DBL B;  5AIQ A;  3FIW A;  1ZK8 A;  2MAB A;  5F04 A;  1HW5 A;  1DPU A;  3OOP A;  4FIS A;  3J7A O;  3IRQ A;  1I6H J;  1YIO A;  1YYV A;  3J7Z I;  2X6X A;  1SFO J;  1WH5 A;  3TED A;  2HNH A;  5CJ9 A;  2HQA A;  3ZQL A;  3U9G A;  4IRG A;  3HXL A;  2XKP A;  3H9Q A;  2WB1 A;  2MW8 A;  1V4R A;  3EET A;  1ZRF A;  4KMF A;  4F92 B;  2R3S A;  3HOU J;  1V3F A;  2JSC A;  2BE5 F;  5FKM A;  3D5R C;  3EUH C;  3I4M J;  5GPA A;  2DJI A;  2RNJ A;  5GAH J;  2MC4 A;  4E7K A;  4FE7 A;  1MBJ A;  3SDG A;  4ESJ A;  3CJQ B;  3R6S A;  4OOI A;  4ZZD A;  4BY1 J;  2YUS A;  2LBF A;  4OAZ A;  4C3H J;  3DEW A;  2Z99 A;  3CCY A;  2MD0 A;  3BT9 A;  2JUC A;  2EFQ A;  3IV5 A;  1LVK A;  3OYI A;  1VQ9 I;  5KAF C;  2LVS A;  5HLT A;  2K9S A;  2HPI A;  2ZFU A;  2Z2S B;  2HWV A;  4EJU A;  5CVR A;  3BR6 A;  3RQI A;  3C2B A;  1XD7 A;  3OYD A;  2RQQ A;  4XKC A;  2VQH A;  2JK3 A;  3HKZ A;  4MGR A;  5HDG A;  4G6T B;  1QZY A;  3PFI A;  3WG9 A;  3S15 J;  4KIC A;  1R4N B;  2Y69 H;  3ABK H;  1UZC A;  4ESF A;  4E7L A;  2ZXI A;  1RKW A;  4M73 A;  4ZYD A;  1OJL A;  2DA6 A;  2GZW A;  2L2O A;  1APL C;  1TWC J;  3K2Z A;  2NVY J;  4FTH A;  3DLA A;  3R0A A;  4WXD A;  2EZL A;  4J01 A;  2QF7 A;  2HOT A;  4KT6 A;  2EIN H;  1ERD A;  1DGW Y;  5BPI A;  4I09 A;  2O9L A;  2DO7 A;  1VQ5 I;  2EIJ H;  2XHK A;  1MMA A;  5FKL A;  3RZD J;  2KIF A;  4LIU A;  1YI2 I;  2ZFW A;  5LD2 C;  1FOK A;  5JI6 A;  3GYH X;  2HVS A;  2AQE A;  2DYR H;  3RCO A;  3EPZ A;  4H0E A;  3FXK A;  3UKG A;  2GXG A;  3ESW B;  2MLK A;  1OCC H;  2I10 A;  3F8N A;  4F93 B;  1IN8 A;  1Z3Y A;  5E3M A;  4HZF A;  3HSR A;  3OYM A;  1BL0 A;  2XRO A;  2VT3 A;  3JRB A;  4IHS A;  3GFI A;  2DOF A;  4AYB A;  2IS2 A;  1YJN I;  3QAH A;  1Y39 A;  2ISY A;  1MD0 A;  2EH3 A;  3N05 A;  5EEG A;  3E5Q A;  4ASN A;  1ZGJ A;  3DU6 A;  4ZTF A;  5J1Y A;  1YO5 C;  2BVM A;  1S9H A;  1IN6 A;  3CC7 I;  4A0X A;  1HST A;  4XN0 A;  2OTL I;  4M9X A;  1IN7 A;  3LSR A;  2LYC A;  4IX7 A;  4HF2 A;  1DGR M;  3GTO J;  1J5Y A;  3IAM 2;  5E17 F;  5LHI A;  2HI3 A;  2VJJ A;  2ACJ A;  4IQJ A;  3F21 A;  4UV9 A;  1O57 A;  1B72 A;  2DA1 A;  1YE9 A;  3RTR A;  1SFX A;  5B1A H;  1GHC A;  2QKM B;  1JKQ C;  3U1D A;  1K4T A;  2QVO A;  3S93 A;  3Q3S A;  2JVG A;  3E6C C;  2JUG A;  2QEX I;  1DQU A;  2FXA A;  2L9R A;  1RUO A;  3VDX A;  4HSR A;  3B6C A;  4IVN A;  3RPU D;  1MBH A;  2YU3 A;  4QSH A;  3CP8 A;  1QZZ A;  3GZN B;  1T2K A;  5KCM A;  2YPR A;  2OC6 A;  3DTI A;  3F9K A;  4CHU A;  2KRF A;  2UXX A;  1KQ0 A;  5HS9 A;  3RI4 A;  3M8F A;  2IP2 A;  2ECC A;  3I55 I;  4M71 A;  3HJE A;  4IKF A;  3EUA A;  3H0G J;  2E19 A;  3ZGK A;  4IOC F;  3G6E I;  1IDY A;  1D1C A;  1MZB A;  2MBF A;  3RQ4 A;  3HPH A;  4UXN A;  2HU9 A;  1LFP A;  1NTC A;  2LH9 A;  3BJO A;  1BI3 A;  1B4A A;  4BHB A;  4L0Z B;  1JTX A;  3HOS A;  3JCU C;  1BI0 A;  2MYS A;  1T6S A;  5J1R A;  2O5R A;  1DPR A;  5JVG F;  3X2Q H;  3ML6 A;  1VQK I;  1LKX A;  2CQX A;  4EVI A;  3MD2 A;  1FOW A;  2E2H J;  1SVO A;  4KYW A;  4LMY A;  1WZ2 A;  3BQZ A;  3CLQ A;  5J6X A;  4RB1 A;  1UHM A;  4HF0 A;  4OIQ F;  1PUF B;  2R7U A;  2JSP A;  1Q1V A;  4GCV A;  4F55 A;  4G94 A;  1U5T C;  2HQR A;  2O03 A;  3DWL E;  4RMN A;  3TBI A;  3BTI A;  2RDP A;  4AVZ A;  4BQO A;  2CH0 A;  5M5Y J;  1HA8 A;  4ZYE A;  3LAJ A;  3HSE A;  4MTE A;  1FYM A;  3MCZ A;  3T5X A;  3FXR A;  2Z16 A;  4XKW A;  1SAX A;  3TP0 A;  1N77 A;  1I3Q J;  2IA0 A;  3A02 A;  1X1P A;  3KP4 A;  2STW A;  3BZK A;  1XTA A;  3S2W A;  1QGP A;  5KAI C;  4OAY A;  1XGN A;  3BWG A;  2K40 A;  1VQ6 I;  5ED4 A;  4ZDL A;  4RGU A;  2V9V A;  2O8X A;  4BXU A;  4BAC A;  4C2M J;  4RDU A;  1OPC A;  2BW3 A;  4L9V A;  2D2W A;  2LSO A;  1WHU A;  5IYC J;  5EGO A;  4BE1 A;  3QPH A;  1YOV B;  3HOZ J;  3L09 A;  2Y31 A;  2PG4 A;  1FLI A;  1B6A A;  2IW5 A;  3L7W A;  3RYP A;  1XB4 A;  2DLL A;  1AU7 A;  4EJO A;  2XSD C;  3ZMT A;  5M3M J;  4XLN F;  2WBM A;  5K5R A;  4O5V A;  1TLH B;  3AKZ A;  2JVH A;  1Y6I A;  2LK2 A;  3OIQ A;  3ERM A;  4PDK A;  4JK1 X;  4UVA A;  2CW8 A;  4U7B A;  1OCT C;  2QQ9 A;  2CUZ A;  4CA0 A;  2ZJR F;  5BMZ A;  2P7C B;  4RB0 A;  2VKE A;  2VI6 A;  2VAS A;  3UR3 C;  5DDG A;  4CZZ A;  3ZPL A;  5E3L A;  3J80 K;  2GIV A;  5LFA A;  6PAX A;  4BU2 A;  3TQN A;  1I5Z A;  1YHQ I;  3F23 A;  3HUG B;  1BIB A;  1T98 A;  3BPV A;  4D7N A;  1U0J A;  1HDD C;  2CW7 A;  3SEZ A;  3OSF A;  3U2R A;  4L0Y B;  1WJA A;  2DJN A;  1IN4 A;  3TGN A;  3N97 A;  2V9K A;  3T0Y A;  3I71 A;  3KP5 A;  2P6S A;  1P6R A;  3ECO A;  3PQK A;  2HXI A;  4MLO A;  4MQ9 F;  5C3E J;  3F3X A;  1E3H A;  5DEQ A;  1R1V A;  1ZH5 A;  3Q5F A;  5B5E C;  4D1Q A;  1ZR2 A;  4EAT A;  2QBY B;  3U1K A;  3L2Q A;  2AO9 A;  4XRS G;  4HNU A;  3JRI A;  2GXA A;  2ZB9 A;  4M9Z A;  3GTQ J;  4RAY A;  5CVU A;  1F43 A;  2OV7 A;  1UG2 A;  3VSL A;  1ZYR F;  4JP0 A;  3HOY J;  1ZGA A;  3C2H A;  4CYC A;  1KZH A;  3CES A;  2BXY A;  1P92 A;  3T8T A;  1CF7 A;  2ZCW A;  2O7O A;  3I64 A;  4BQN A;  3SZG A;  4L5I A;  1JHH A;  4IEJ A;  3QOD A;  1R9T J;  1ZTR A;  4CYC B;  2R7Q A;  4FQG A;  3SFI A;  5FRO A;  1CF7 B;  3S17 J;  1SMT A;  1Z6R A;  2IT0 A;  5DTD A;  1XGM A;  1TT5 B;  3LMM A;  2MLG A;  1LEA A;  3ZRG A;  1QPM A;  4PGG A;  2CV1 A;  3OS2 A;  1G2H A;  2LFB A;  1R49 A;  2R7F A;  3HOV J;  4B09 A;  4PJM A;  1LQ1 A;  2K9M A;  1YLF A;  4XID A;  3WU2 C;  2HKX A;  1LVA A;  3HL2 A;  3RPU A;  3A01 A;  2OQG A;  3IL2 A;  1TNS A;  3BG9 A;  2I5U A;  2JA8 J;  2OCC H;  1XX5 A;  3GX4 X;  2PJP A;  3OYC A;  1JGG A;  2VC0 A;  3NAU A;  3A01 B;  1R23 A;  2M45 A;  3WU1 B;  1VQP I;  1OQY A;  1F4K A;  2GA1 A;  1K6Y A;  3FX3 A;  3SQN A;  1U6G A;  2KL4 A;  3IWF A;  5DCM A;  5FLX Z;  1ENH A;  2F6C A;  2XF7 A;  5ICC A;  3FF5 A;  3KZI C;  2DTR A;  3CF5 F;  4U87 A;  3BPX A;  2R93 J;  4HST A;  4B3X A;  1A6Q A;  4G8X A;  2J5P A;  2XAH A;  2BHY A;  3BR5 A;  4HQM A;  2A68 F;  2DXI A;  4B4C A;  4AC0 A;  1ACI A;  4CCO A;  2M0C A;  5H2F C;  3HTS B;  3CDL A;  4JQF A;  5B1B H;  4UY8 I;  5FLX K;  4U0V A;  1TNT A;  1P4A A;  3I59 A;  5K7Z A;  1D1A A;  3JTH A;  5JHF A;  1WI9 A;  1JHF A;  4WX9 A;  2LC2 A;  5JLX A;  1IC8 A;  3ZOB A;  4A6D A;  4OWR B;  4PZJ A;  3BZ6 A;  2LY1 A;  1OR7 A;  3C18 A;  4Q4Z F;  3E1S A;  1JUS A;  5KNL A;  1IRX A;  3BC8 A;  4X1E A;  3CCS I;  4G9Y A;  2R7T A;  3FBI B;  1BC8 C;  2P0W A;  1H9T A;  1FBU A;  4LOC A;  2ETH A;  1X2N A;  5CVI A;  4A69 C;  4Q47 A;  3TOB A;  1T08 B;  2RNG A;  5LGU A;  4L9N A;  2MC3 A;  5AIP A;  4GXO A;  4CSW A;  1IXS B;  2Z1D A;  3BTJ A;  1KU2 A;  3LAP A;  4M3F A;  3HOX J;  3IUO A;  2V4J C;  2E71 A;  2Y9Z A;  1IV8 A;  4M6Y A;  1Z91 A;  1FZP B;  2IVM A;  2VIX A;  1YS6 A;  2VBY A;  3ZP5 A;  5HDN A;  2GLO A;  1PP8 F;  2HQ5 A;  1MMN A;  1YG2 A;  1RIO H;  3BG5 A;  5CVV A;  1MW7 A;  2ZJQ F;  3LSJ A;  3SJM A;  1W0T A;  5FD6 A;  1ZLK A;  2DI3 A;  5CQE A;  2E2I J;  2UWM A;  2XB5 A;  2QGU A;  4C2U A;  3F8B A;  3G2B A;  4DYC A;  4K2E A;  4YFX F;  1WQ2 A;  3PO3 J;  3CC2 I;  1IV6 A;  3SZP A;  4AD9 A;  5GAE J;  5DD4 A;  3OSG A;  4MFE A;  3REO A;  4UUT A;  5HLH A;  4JX4 A;  2OZU A;  4XN3 A;  2M87 A;  4HLY A;  5J40 A;  3QYB A;  3I5U A;  5DV5 A;  5DM7 F;  4XR6 A;  2KT0 A;  3ABU A;  5LHG A;  1JJ8 C;  4HF1 A;  1PJR A;  2OD5 A;  2WY8 Q;  2NRA C;  4KIB A;  2G7U A;  4N4N B;  1X2M A;  1FX7 A;  5TIS C;  3ZCO A;  4CZC A;  1W5T A;  1X19 A;  2PMU A;  3KYC B;  2VLA A;  5EZG A;  4LK0 F;  4WF2 A;  3PIO F;  1KON A;  3S8P A;  2QCO A;  1I1S A;  3IWZ A;  1SD5 A;  3PM1 A;  3VB2 A;  3IH3 A;  3RIR A;  5F08 A;  5KK1 A;  2V1D A;  4CCK A;  2FOK A;  3K4C A;  3QPL A;  5C44 J;  1R6R A;  1Z77 A;  3CJN A;  3GTP J;  2XSJ C;  1D8J A;  1SD6 A;  3W6J B;  4EJV A;  2ECB A;  3ZN1 A;  1TTY A;  4N9H A;  4BE0 A;  3HDD A;  3MZH A;  2CU7 A;  3KP7 A;  2PMZ N;  2QLZ A;  3JSO A;  4ZDO A;  3S1N J;  2EIK H;  2Y30 A;  3MFK A;  1ITY A;  3FXL A;  4L5J A;  4RGX A;  2DTZ A;  2LY2 A;  2IGO A;  3GVA A;  3ZQF A;  3V7R A;  1VQ7 I;  2K9N A;  4F52 A;  1FIP A;  1E0E A;  1ZHF A;  2L9N A;  2UUZ A;  4HOB A;  2F5E A;  3BR2 A;  1YQA A;  2GA2 A;  3S3N A;  4AU7 A;  5FB2 A;  1JJ6 C;  2R7S A;  1EH8 A;  5DM6 F;  1A31 A;  2HDC A;  1LFB A;  4CUG A;  4HX7 A;  5LRR A;  3VPR A;  1JE8 A;  4LG0 A;  3IAS 2;  2IBD A;  5FKO A;  2IEK A;  4RA2 A;  3DPL C;  5IPA A;  3CCL I;  2XAG A;  3A0H C;  4Y33 A;  2BZT A;  2XDV A;  2Z5U A;  3LSH A;  4LG0 B;  4RAZ A;  2R7X A;  3ABT A;  2XVC A;  1B8I A;  4KUM A;  4EEF G;  3ULQ B;  4PSW A;  2F5D A;  2KQR A;  3DFG A;  4L9T A;  4P96 A;  1W5C C;  4HLX A;  2V26 A;  4U88 A;  4KMU X;  5F0F A;  5DUI A;  5JR3 A;  1BOB A;  1B8I B;  2EFW A;  3OS1 A;  4W97 A;  2CQQ A;  3P9I A;  3CCU I;  1HW2 A;  4F91 B;  2HEO A;  3JTG A;  4QIW N;  4A3I J;  4ESB A;  2ISZ A;  1FSH A;  1NHA A;  2DT7 B;  2VB6 A;  3HGY A;  4LLN A;  3DF8 A;  1S8N A;  4FAS D;  2KIM A;  1O3R A;  2DU9 A;  2CS3 A;  1FTT A;  4YRV A;  2FE3 A;  4YIR X;  1W5S A;  5ILU A;  1I3A A;  2JA5 J;  2Y9Y A;  3K4J A;  1QVU A;  3R60 A;  4YEL A;  1R5G A;  3AG3 H;  1D0Z A;  3IKT A;  2RN7 A;  1CGP A;  5J3L A;  3E0J B;  3C3W A;  2JRM A;  2KIU A;  3IH2 A;  2QQ8 A;  3L2R A;  1NH3 A;  2W00 A;  1I6X A;  4G6D A;  1U8B A;  4IHW A;  1Q1H A;  2IJL A;  1FBQ A;  1P7I A;  1MH4 A;  4IHV A;  4BBR J;  1POG A;  2MH9 A;  2EA4 A;  5D8L B;  4EV0 A;  3C2G A;  5IT3 A;  4MEY F;  3BQY A;  2MGQ A;  3L2U A;  1TT0 A;  1RI7 A;  2CJJ A;  2DA2 A;  4ENJ A;  5E1X A;  1X58 A;  2L4A A;  1S6L A;  2ICW G;  4ETS A;  4DNC A;  1PDN C;  2X9D A;  1IZ1 A;  3E7L A;  4UVB A;  4ITV A;  3GTJ J;  1LB2 A;  2V6E A;  1JKR C;  2X6Y A;  2WAF A;  4L18 B;  3WGH A;  4M74 A;  4S0H B;  3MMY B;  2BEO A;  1UAA A;  3A2K A;  2NXN B;  4HV6 A;  4L5E A;  1U9N A;  1FWZ A;  2XAQ A;  4DW6 A;  5DCF A;  4EGY A;  1CQT A;  3K4K A;  2F4O B;  2LBF B;  2GXB A;  3LSG A;  3BJ6 A;  3B73 A;  2E1M C;  1D3Y A;  2R7Z J;  1VQ8 I;  4XMY A;  1MSF C;  4C3J J;  1X4O A;  1SC7 A;  1GV5 A;  1Y1W J;  1JUM A;  1IO2 A;  3KYD B;  3U21 A;  2QQB A;  5F6F A;  1VZ0 A;  3H3V K;  5HNH A;  3GLX A;  4FET A;  5L3E A;  5EG0 A;  3WGI A;  4J00 A;  3NRV A;  3RKX A;  3JW4 A;  1HOM A;  1EF4 A;  1MJ9 A;  1ORK A;  3FZV A;  2QSG X;  3E6B A;  2ME6 A;  3DKY A;  3OY9 A;  3ABM H;  3CZ6 A;  2KZG A;  4GRI A;  2FX0 A;  3BCB A;  4BDY A;  2UZK A;  1FP1 D;  2ELJ A;  4DBQ A;  1GXP A;  2PFB A;  3SHF A;  2OTJ I;  2CRG A;  1B59 A;  3I4P A;  1V55 H;  3HG9 A;  3IKV A;  4I7H A;  3FXM A;  2LMD A;  4P9F A;  4Y3O A;  3VYU B;  3WGG A;  1S7E A;  2ZXW H;  2EPF A;  1LEB A;  3ONQ A;  1AOY A;  5IP9 J;  2WAE A;  2P7V B;  4I02 A;  4TV7 A;  1H8A C;  2EZI A;  3G4S I;  1F5T A;  2Q2E A;  4KN4 X;  2A3S A;  3LSK A;  1MBF A;  2A6T A;  1QPI A;  3CP2 A;  3EYY A;  4RB2 C;  1YFH A;  2A69 F;  4OU0 A;  5CLS A;  1L0O C;  5J4Y A;  2FBI A;  3TL4 X;  3OYE A;  2XF6 A;  4I0A A;  4D0P A;  1WSU A;  2ELH A;  3PUB A;  3T1B A;  2MSY A;  4YG2 F;  1XG1 A;  3TW6 A;  3CCJ I;  3EDP A;  3PO2 J;  3M7G A;  5ICG A;  4CXF A;  1O3T A;  4OMZ A;  3G1M A;  4CGZ A;  4II2 A;  4Y7N J;  5C4J J;  2IS1 A;  5ILS A;  1LUJ B;  3K0L A;  5D5W B;  3E5X A;  2RQP A;  1Z0X A;  3HPG A;  2LRD A;  3KP6 A;  3CCM I;  1PP7 U;  1E2X A;  5DUK A;  4UV8 A;  5L3D A;  2JA2 A;  1X1A A;  3DTK A;  2DFE A;  2KJC A;  1Z1D A;  3FMQ A;  3KLO A;  1Z05 A;  2VKV A;  3VFZ A;  1UCR A;  2NNY A;  2VKD A;  1SFU A;  1Y1V J;  1GXQ A;  2VC1 A;  3CO7 C;  5HLG A;  3S16 J;  1NK3 P;  1E3O C;  3V42 A;  5M5W J;  3CCR I;  3ZMU A;  1HXD A;  1MNE A;  3HHG A;  3LWF A;  4JX6 A;  4S04 A;  1V5G A;  2HQN A;  2B9S A;  1R1T A;  3QWL A;  4UVC A;  1IN5 A;  1OYW A;  1ONV A;  1ETV A;  2L9V A;  2KFD A;  3HRU A;  4RGS A;  1HF0 A;  4ZYA A;  1B72 B;  4BJ5 C;  2PEX A;  2VXZ A;  1OCP A;  4I99 C;  5CYV A;  2Z33 A;  1P4W A;  2M0M A;  1HDP A;  1O3Q A;  3RZO J;  5IYD J;  3PIP F;  1AA7 A;  2VE9 A;  3F6O A;  4MNU A;  4BXX J;  3B6A A;  4DZP A;  3MKY B;  2HFH A;  4N4O B;  1DP7 P;  1USS A;  2F4I A;  5K1Y A;  4Q5S F;  4KN7 X;  2P6T A;  2HGC A;  2O61 A;  1X3W B;  5C4X J;  3HRM A;  1OKR A;  1XPX A;  1BM9 A;  2K4B A;  2LKS A;  1ON1 A;  2X1D A;  3DQV C;  4GFB A;  1LFU P;  2E5Z A;  2GAU A;  3BZC A;  4EJT A;  2R5Y A;  2OJE D;  2WC2 A;  4D9J A;  2J5O A;  3ZMV A;  2DA4 A;  4JYK A;  2LR8 A;  1D8K A;  3V8L A;  3OL3 A;  3O8G A;  1R36 A;  2R5Y B;  3CMA I;  3P5J A;  3DEU A;  4MQV A;  3BLY A;  2F5F A;  2E1M B;  3H9J A;  1SD7 A;  4RAF A;  2FU4 A;  2R7V A;  2OZ6 A;  2L5Q A;  4IO9 F;  2K3P A;  1YJW I;  3H35 A;  5GTI C;  1TQP A;  1G4D A;  2X48 A;  4H4K C;  3WG7 H;  3F0C A;  1XGS A;  3VYR B;  2OPT A;  4XOT A;  2ZJP F;  3L2C A;  4JBA A;  5EJC A;  4CCJ A;  1OCR H;  1JKO C;  3OYJ A;  4GDF A;  4IRI A;  2JMW A;  2ZJ2 A;  3ZN0 A;  4NHJ A;  2BV6 A;  4JX5 A;  2DT5 A;  1K6O A;  1Z6T A;  1I50 J;  3TDU C;  5L3G A;  3ELK A;  1BN5 A;  2CG4 A;  1TW2 A;  4XLF A;  4HG2 A;  1WVR A;  2E34 A;  1HW1 A;  3HHH A;  4I76 A;  3KX2 A;  4C30 A;  1RET A;  2BW3 B;  3FXQ A;  1YTY A;  5BS6 A;  5EGO B;  3LQQ A;  2FML A;  5E8I A;  3MQ0 A;  1OR7 C;  2IXS A;  4LIV A;  4A3L J;  1SEU A;  3BOQ A;  1M1E B;  5FFZ A;  2Z3Y A;  1RUN A;  1RR8 C;  2JRT A;  2BYV E;  2VBZ A;  4XM3 A;  1ODD A;  4RM2 A;  3ZXS A;  1KU9 A;  2LRE A;  1G6N A;  2VJ5 A;  2IGN A;  4DBR A;  1ZRE A;  1YS7 A;  4B8X A;  4XRF A;  5F27 A;  1WH7 A;  5ILV A;  3I4N J;  1BR1 A;  2ESN A;  2A05 A;  5GAG J;  2W7N A;  2DDB A;  4Z2Y A;  4E7S A;  3I53 A;  1EH6 A;  1MJB A;  4NC6 A;  3ZQI A;  4M6X A;  2KMU A;  1SAU A;  2H8R A;  2K7L A;  1JGS A;  4LK1 F;  2KP6 A;  3BR1 A;  2JA7 J;  3RSN A;  2IGM A;  3DTE A;  3I0T A;  1O7L A;  2HR3 A;  2OAZ A;  2B63 J;  2EV5 A;  5CKT A;  4BS9 A;  1ZGW A;  1R5I D;  1LE8 A;  4YII A;  4S05 A;  2D1V A;  2DCE A;  3H5N A;  3HRT A;  3KFW X;  1KGS A;  3MZY A;  2CFO A;  3R4K A;  1OCZ H;  3G3Z A;  2IS6 A;  1LE8 B;  2WV0 A;  2OA4 A;  1ETQ A;  4R1H A;  4HNT A;  4ABZ A;  3S2D J;  5F1R A;  1FOY A;  3K1P A;  1P7J A;  2KRC A;  3CQZ J;  1J0R A;  5LHH A;  4HV5 A;  4P1W A;  1AWC A;  1EV7 A;  1BR2 A;  4G6Q A;  3D0S A;  2XAF A;  4LLL A;  4O3M A;  2C6Y A;  2ZNY A;  2EK5 A;  4GYI A;  5GPC A;  3NQO A;  3E5U A;  1BI2 A;  4B48 A;  2D5V A;  2ZSI B;  1I1G A;  3RKY A;  3M4O J;  2FMY A;  4LJZ F;  2A6E F;  2DMT A;  3DPU A;  3QPT A;  4KFC A;  1P4X A;  3CUQ A;  1VND A;  2E35 A;  3HIF A;  4BHC A;  3HB9 A;  2DN0 A;  2DFI A;  2EZK A;  3GF2 A;  4UB6 C;  5LGT A;  2M1B A;  5IT9 Z;  3I9V 2;  2O0Y A;  1TWH J;  3I3L A;  4BGD A;  2VL8 A;  1K83 J;  4XSX F;  2M5W A;  2LOO A;  3Q0W A;  1R22 A;  4BEH A;  3ASO H;  4C3I J;  2FSW A;  2V1X A;  1ZRD A;  3G73 A;  3HM5 A;  5IP7 J;  4PGH A;  1P2F A;  1KYW A;  5IT9 K;  1X1C A;  4IPA A;  2MFZ A;  3RKW A;  3QQA A;  4M3G A;  1SAN A;  2LNB A;  5J8C A;  5GTH C;  3F8M A;  2O8K A;  3CCE I;  5E18 F;  2X85 A;  1BW5 A;  3TW7 A;  2H09 A;  3HYI A;  5BPD A;  3G1O A;  4PFO A;  2IGK A;  4XNF A;  3ASN H;  2HS5 A;  4DQ2 A;  1E17 A;  1WJC A;  5FLV A;  4AIK A;  3AG1 H;  1O7F A;  3K70 D;  2GM4 A;  2JWT A;  2L7F P;  3TO7 A;  4CH7 A;  5H20 A;  3ZQQ A;  2M30 A;  2L7M P;  2QZ8 A;  5D8K B;  2NVU B;  4ZH4 F;  2GOX B;  2DFF A;  4IQ4 A;  1K7A A;  5AON A;  5HDK A;  2LDU A;  3KYL A;  2ZNZ A;  3WTV C;  2PJR A;  2FEZ A;  5DCM B;  3OWT A;  4QWQ A;  2XPW A;  2GWR A;  1QZE A;  4A2U A;  4DOZ A;  2DDA A;  5D5X B;  3CUO A;  4HW0 A;  5J1U A;  4HDV A;  2BY3 A;  3S14 J;  3CC4 I;  1Y8R B;  4NQW A;  2ME0 A;  2HPM A;  3GBG A;  3HZJ A;  4MIM A;  4R8H A;  1FMV A;  3GFM A;  1U3E M;  3FXO A;  3I59 B;  2TCT A;  2XGC A;  5F0C A;  1TP4 A;  2WAQ N;  4C2T A;  4V2G A;  2QSH X;  4XKB A;  1R1U A;  3R0J A;  3WE2 A;  4ZJZ A;  3K70 C;  1OMI A;  1YW8 A;  3E6D A;  1QO0 D;  5FO5 A;  3QU6 A;  4ENK A;  4ZTJ A;  2JA6 J;  4RLF A;  2CSO A;  3L9F A;  3PSI A;  4A3G J;  5DS9 A;  1BA5 A;  4DIQ A;  4AID A;  1QRY A;  2VOD A;  2MA3 A;  2P81 A;  4IZZ A;  1A35 A;  3LSM A;  1X1D A;  2K9Q A;  5KVR A;  4F3Q A;  1MDM A;  2HTJ A;  2X1C A;  3JRG A;  1Y56 A;  3CCQ I;  1ULY A;  1OLT A;  2W57 A;  3K7A J;  3LNQ A;  3OYK A;  3F8F A;  4M3D A;  1IRF A;  3DP7 A;  2DOD A;  5DYM A;  2KZV A;  2Y0S N;  3LA7 A;  4OIP F;  2A07 F;  4V2F A;  4XOP A;  1KU3 A;  1WJD A;  2HXO A;  3VOD A;  2R0Q C;  4KJZ A;  3OIO A;  2XRN A;  4IHY A;  1B9N A;  4IRH A;  1J2X A;  2TRT A;  5JVT A;  2EQR A;  2O6G E;  1IUY A;  2L01 A;  4NB5 A;  3H0D A;  2AQF A;  2HVR A;  1HSJ A;  3DXJ F;  5TRD A;  1W1W E;  3K4M A;  2P5V A;  1HLV A;  1T0F A;  2DK8 A;  3WU0 A;  4M3B A;  4U0W A;  3M8J A;  1FIA A;  2UXN A;  2DT6 A;  4ZYG A;  4U7D A;  3OR1 C;  4CDG A;  3QP5 A;  1IW7 F;  3HGG A;  4ON0 A;  1G8X A;  2QWW A;  3TOA A;  1YJ9 I;  5D6F A;  2JJ7 A;  3DKW A;  3S3O A;  3FK7 A;  1NG7 A;  1IJW C;  3ECH A;  4O6J A;  1DUX C;  3BCA A;  4XSZ F;  1D1B A;  2M8G X;  1B1B A;  3F6V A;  3FIS A;  4YEJ A;  5A2Q Z;  3OS0 A;  3GLL A;  2ZXJ A;  3AL0 C;  1SVM A;  2K4J A;  2ZXH A;  1RRJ A;  1TWG J;  5KHD A;  3RDI A;  5K7F A;  2OUM A;  4B44 A;  3VYT B;  4XK4 A;  5E1Z B;  3D1N I;  3OMY A;  1A04 A;  1J75 A;  1BJA A;  3K1M A;  3GFJ A;  1FPQ A;  4XLE A;  5LLQ A;  4RAG A;  3SXY A;  4F7Z A;  1Y8Q B;  4U0Y A;  3BG6 A;  5A2Q K;  4RM3 A;  2L02 A;  4XL9 A;  1A36 A;  4BJ6 C;  3KET A;  3ZR8 X;  2W84 A;  4M3E A;  2PN6 A;  4N9I A;  3W2A A;  2BHZ A;  2IAI A;  2P8T A;  3JRA A;  3S2H J;  2EJR A;  3OYA A;  2M34 A;  3F22 A;  1MNM C;  1YRN A;  1TL8 A;  4KT5 C;  4M9S A;  5D5U B;  5GAD J;  2EFO A;  1VI0 A;  4LB6 B;  2ZC2 A;  3E6M A;  5EDN A;  3SEQ A;  4XON A;  2YS9 A;  3AG2 H;  1GVD A;  2M7A A;  3FXU A;  2H94 A;  2A5Y B;  2FQ4 A;  1QQI A;  1QU3 A;  5LEJ A;  2KJB A;  1JT6 A;  1REP C;  1YX3 A;  5IY5 H;  2M9H A;  1VF9 A;  1H89 C;  3V7S A;  2CQK A;  4XLA A;  3W2V A;  3JRC A;  1FSE A;  2BGC A;  3RKQ A;  2ZME A;  4ENM A;  1Z7U A;  1ZAR A;  2YR2 A;  2BXZ A;  3P9C A;  2P5L C;  1ZEL A;  5EZH A;  4PJL A;  4B47 A;  1MBE A;  1YW9 A;  1IUF A;  1QA6 A;  3M3Y J;  3BR3 A;  4B3A A;  4A3M J;  3W6K B;  1RR7 A;  2K9L A;  1X4P A;  3G71 I;  4N0B A;  4P55 A;  1A6I A;  2FF4 A;  4CYD A;  2M2E A;  1IG7 A;  2KDO A;  2OBP A;  2Z9O A;  1XMK A;  2BBY A;  2EZH A;  4BJT A;  4AIH A;  1GV2 A;  1WJE A;  4AWX B;  3JRH A;  2I8D A;  1Z3X A;  1JT0 A;  2DA7 A;  1S7O A;  2CMP A;  1H88 C;  4DZJ A;  2FNP A;  1G3Y A;  2K5C A;  1WWX A;  4E7H A;  1R5H A;  1RZ4 A;  1IXC A;  5E20 A;  1D0X A;  1F36 A;  4W1U A;  2X0L A;  1T38 A;  1J09 A;  3WHC A;  3CDH A;  5E79 C;  3DPT A;  1EA3 A;  2QM3 A;  2HVQ A;  3EUK L;  3GXO A;  2NNN A;  1QNT A;  2HDW A;  2IA2 A;  4FHT A;  3MVP A;  4FE4 A;  1DDN A;  2R5Z A;  3RJP A;  3GZ6 A;  2XAJ A;  4HQE A;  2CYY A;  4BNC A;  3S1M J;  2DK5 A;  1ETX A;  2RAE A;  4RLQ A;  3E3V A;  2EWN A;  1KQ9 A;  5J8F A;  5LRS A;  1LDK B;  2FQ3 A;  4CCL A;  1MND A;  1K78 A;  1LDJ A;  3DBH B;  3FK6 A;  2V9P A;  3IRR A;  2E5N A;  3PL8 A;  4E6K G;  3MEX A;  5LEK A;  1WRJ A;  2RKH A;  4BY7 J;  1K4S A;  1IAW A;  2IPQ X;  4ANJ A;  4WWC A;  1HKQ A;  4A3B J;  2WA0 A;  4A3D J;  4MFD A;  1N25 A;  3BJA A;  4OIO F;  3H9G A;  3O3K A;  3SFZ A;  4KDP A;  1HC8 A;  5K5O A;  2KHM A;  2ELK A;  5IP6 A;  1Z9C A;  1XS9 A;  4EM2 A;  2H6C A;  1G3S A;  2WAQ A;  3JR9 A;  2ZSH B;  4LLG F;  2XPU A;  2R7O A;  2DQR A;  1ETY A;  4XOR A;  4D5F A;  2M3A A;  1S7A A;  2QUF A;  2XUB A;  4XLH A;  1XSV A;  1EKE A;  2PBI A;  2YX7 A;  3RYR A;  3P7N A;  1W7P D;  2YU9 J;  2AHQ A;  5BOX A;  3ABL H;  2KDZ A;  2D45 A;  1L3L A;  3HTU A;  2XIG A;  1JKP C;  2VQG A;  3P9K A;  2VOO A;  1WGX A;  3KEQ A;  4P5O A;  5FD5 A;  4IHX A;  3S32 A;  5HLI A;  9ANT A;  3HEF A;  3AL0 B;  3Q0V A;  1V5F A;  1QHG A;  2L9S A;  2X51 A;  1R4M B;  1Z21 A;  3LA2 A;  1FJL A;  2JZY A;  4V19 K;  1MMS A;  5J4V A;  3MKZ A;  3M9A A;  4A12 A;  2WV1 A;  2CGP A;  3WOD F;  1O4X A;  3Q0U A;  2XF5 A;  4Y4R A;  5ERI A;  3HOT A;  2Y0S A;  4I01 A;  3G1L A;  5L3F A;  2UV1 A;  2DMN A;  1K79 A;  4II3 A;  3S1Q J;  2W48 A;  1HKT A;  3QP6 A;  4QPQ A;  5EG0 B;  3MN2 A;  4A0Y A;  1B9M A;  2H27 A;  1BR4 A;  2IA1 A;  2NVT J;  4EQQ A;  4IHT A;  1UFM A;  3H92 A;  2L4M A;  4OIR F;  4KIG A;  3W6V A;  3M8E A;  3ZMZ A;  3OYB A;  3H5R A;  2MH2 A;  1JUP A;  3JRD A;  3L2W A;  2VT2 A;  2FRH A;  2VXD A;  2W24 A;  3K69 A;  2VQL A;  5E3O A;  1LNW A;  1KQ8 A;  1XDS A;  1G3T A;  3MAJ A;  2R7D A;  5F0H A;  3QYE A;  4ENN A;  4A0Z A;  3GTL J;  3PJR A;  2FJ1 A;  2GOM A;  2DOA A;  3LFK A;  2ID3 A;  3HSF A;  2KKO A;  4Y17 A;  1MIJ A;  2XGX A;  1VQO I;  2WAD A;  4PJ0 C;  2KIQ A;  2Y48 A;  3NWT A;  2NOG A;  2PQ8 A;  3GTG J;  5H6R A;  1FY7 A;  1UHS A;  3QRF F;  3K9T A;  3BP8 A;  3EQL F;  2Q2E B;  1TQI A;  2DA5 A;  2XAU A;  1BC7 C;  2VOP A;  4MTD A;  2NAZ A;  2EFN A;  1JI8 A;  3VOE A;  3DU5 A;  3QYF A;  2V1U A;  4AM3 A;  1GVJ A;  2PMZ A;  4GO1 A;  4LD5 A;  4Z6Y A;  2DFH A;  3OIP A;  2IS4 A;  2OF7 A;  4Y15 A;  1I39 A;  2CUJ A;  3FWE A;  2HZT A;  2VJ4 A;  4A3F J;  3WE3 A;  4EMS A;  1FTZ A;  2JT1 A;  4FX4 A;  3V7C A;  2XKO A;  3DEE A;  1QVT A;  2NVQ J;  2E1O A;  3JSP A;  3CMY A;  1VQM I;  1MGT A;  3A0B C;  3CJR B;  2M8E A;  1U8R A;  1F9N A;  3PNV A;  4I6Z A;  4MEX F;  2M4K A;  5TGT A;  1FBS A;  4I0B A;  1YIT I;  2LG4 A;  4KNY A;  1U78 A;  1YIJ I;  1C0W A;  3OYF A;  1OIS A;  1WCM J;  3LA3 A;  2LD5 A;  4PCQ A;  4LIT A;  4XBF A;  1XMX A;  1MJA A;  3K4L A;  5L3B A;  3ZMS A;  5BQT A;  1TW3 A;  2NS7 A;  3HC7 A;  3VEP A;  3NAR A;  3O2P E;  4BE2 A;  3SYT A;  3GUD A;  2WY7 Q;  1OFC X;  2L54 A;  1OYY A;  2CQ7 A;  3CUQ C;  3OV8 A;  3UNG C;  4KIT B;  1ZRC A;  5K7H A;  3BG7 A;  2JN6 A;  1SFE A;  4E4H A;  4M6V A;  2JTV A;  1R00 A;  2RRE A;  3S3M A;  1D5Y A;  2STT A;  2V7F A;  3GZ5 A;  4I98 B;  3TKY A;  1V5E A;  3OYL A;  4A3C J;  3BTC A;  2AXL A;  2VBX A;  2XV4 S;  3M1E A;  4UHT A;  1TWA J;  2DYS H;  1HQC A;  3L2V A;  2XRL A;  3EUH A;  1ZG3 A;  1XMA A;  3CLO A;  4HBL A;  3LFU A;  3TMO A;  1KYZ A;  3CMM A;  3NWS A;  3FBN B;  5FRN A;  3Q9S A;  3R61 A;  3TP3 A;  4Y52 J;  1NK2 P;  3FMS A;  2DPU A;  3BTL A;  1OCO H;  3V8K A;  3COA C;  1F1Z A;  1UG0 A;  4PUS A;  4CCN A;  1BI1 A;  4NDL A;  2DW4 A;  4Y13 A;  2HOS A;  2L0K A;  5EEA A;  4PK4 A;  1PUF A;  4A3K J;  1U2W A;  1J59 A;  4NNJ A;  2NOJ B;  1MMD A;  5FKK A;  1MBG A;  2RGV A;  1XGO A;  4E7J A;  1VFC A;  4UUV A;  3LOC A;  2HOA A;  4D7M A;  1W7P A;  2F5V A;  2VE8 A;  3H1C A;  1WI3 A;  1P9Q C;  3F72 A;  3WTW C;  1STZ A;  2V1N A;  3WTU C;  2O3F A;  2KRH A;  2K85 A;  1XDU A;  4FT8 A;  5CVJ A;  5E3N A;  5E8G A;  1W7P B;  1TWF J;  2QA4 I;  4PSX A;  1JXS A;  3OYG A;  3EYI A;  4BYY A;  3C1D A;  1W0U A;  1FOX A;  1PVE A;  2BY0 A;  2E7X A;  3PNT A;  4ZZL A;  4WCG A;  1LDD A;  2BY2 A;  1UEL B;  1EJ9 A;  2DA3 A;  1UHW A;  4PJJ A;  1JTY A;  1QHH D;  2VN2 A;  2BY1 A;  1GLN A;  3IHU A;  4EGZ A;  2CW0 F;  3RPQ A;  2WWY A;  1GT0 C;  1S72 I;  2XAS A;  3ZQG A;  5HOO A;  3WTY C;  3T8R A;  1E3P A;  2EV0 A;  1SD4 A;  3JRF A;  4BH9 A;  1J9I A;  2EIL H;  5E1W A;  3AG4 H;  2MD5 A;  3D5L A;  4HNV A;  1XCV A;  4R79 A;  2ID6 A;  1DP3 A;  1ETW A;  4A5M A;  1R7J A;  1XCB A;  2KIS A;  3QOE A;  5IOY A;  3J81 Z;  3CO6 C;  2Q1Z B;  4BBS J;  4LG3 A;  3WTS C;  4I2O A;  4B1R A;  2CO5 A;  3S1R J;  1PUE E;  2B0L A;  1RPW A;  4G12 A;  2YX4 A;  3PNY A;  5FFX A;  4JOM A;  4Q48 A;  3OYN A;  3MZ8 A;  2FNA A;  3IP4 B;  3J80 Z;  2AXT C;  5JLW A;  1ZKG A;  2ADU A;  3HBL A;  5JHU A;  2PLY A;  3PSF A;  3GEZ A;  2CV2 A;  4X6A J;  1ZN2 A;  5M3F J;  5GP9 A;  1FP2 A;  4PFP A;  3WTZ A;  4YFK F;  2PI0 A;  3J81 K;  3L1P A;  4XQF A;  5L3C A;  2FBK A;  3QOP A;  3I56 I;  3WTT C;  2DPD A;  1N78 A;  2E7W A;  4IJA A;  1KU7 A;  2VUM J;  1KA8 A;  1Y0N A;  2NS0 A;  3OL4 A;  4E70 A;  3HUG A;  1IDZ A;  3V8J A;  4XRM A;  2JQ7 A;  4CO8 A;  3K10 A;  2VKH A;  2Y0M A;  2V79 A;  1WFX A;  3K6G A;  3GFL A;  3B02 A;  1MH3 A;  1RES A;  2X4H A;  1N75 A;  2ZKZ A;  4DYQ A;  3FHZ A;  1PYV A;  4EM1 A;  2ZBK A;  1T0F C;  2QBY A;  1YX5 A;  1Z67 A;  2D1H A;  1W36 D;  3VYS B;  4A3J J;  2DOE A;  4HPQ A;  3H5A A;  1TBX A;  2H6B A;  3GTK J;  1G59 A;  3TO6 A;  3FDY A;  1LJ9 A;  2RVC A;  3LL7 A;  2MG4 A;  1XSX A;  3SZT A;  4LGW A;  5F1J A;  2CV0 A;  3LQR A;  5DD8 A;  3CUQ B;  3FXJ A;  4IL6 C;  3BDD A;  2F4M B;  4E7Z A;  3DLL F;  4PJN A;  5EF6 A;  4QTR A;  4MO7 A;  2HYF A;  2TDX A;  4YIF A;  1H9G A;  1XC5 A;  2V6C A;  3JRE A; 
#chains in the Genus database with same CATH homology
 4XLC A;  4IKF A;  3EUA A;  3AL0 C;  3ZGK A;  2ZXH A;  3CF2 A;  4BEH B;  5KHD A;  3K4K A;  1D1C A;  2OUM A;  2LBF B;  4B44 A;  3VYT B;  3RQ4 A;  3HPH A;  3LSG A;  2HU9 A;  1LFP A;  3OMY A;  2E1M C;  2LH9 A;  4XMY A;  2X6W A;  3HOS A;  4XLE A;  2MYS A;  4ZDP A;  1X4O A;  3BG6 A;  4RM3 A;  2O5R A;  1W36 C;  3U21 A;  4XL9 A;  3K4N A;  4BJ6 C;  3ZR8 X;  1LKX A;  1VZ0 A;  5HNH A;  3OOU A;  3A4C A;  3MD2 A;  4FET A;  2VJI A;  3W2A A;  4J00 A;  5HVQ C;  3A2K A;  2KPM A;  3OYA A;  2R7U A;  2JSP A;  4F55 A;  4DJA A;  4RMN A;  3TBI A;  3DWL E;  3DKY A;  4BQO A;  4AVZ A;  2W82 A;  2CH0 A;  3CZ6 A;  3K4B A;  3OY9 A;  4KIS A;  1HA8 A;  4GRI A;  3DKX A;  3BCB A;  2Z16 A;  4XKW A;  3LSI A;  4BDY A;  3D5S C;  2ELJ A;  3SEQ A;  1T95 A;  4XON A;  4DBQ A;  1N77 A;  1D0Y A;  2M7A A;  2W4S A;  2VQC A;  3VWB A;  3FHN A;  2PJR B;  1QU3 A;  3OR2 C;  3HG9 A;  1MMG A;  3J7A Y;  4OAY A;  1YX3 A;  4Y3O A;  4ZDL A;  4XLA A;  3W2V A;  3VYU B;  4BAC A;  3AFH A;  2M7B A;  2BW3 A;  3ONQ A;  4BQQ A;  2WAE A;  1ZEL A;  4PJL A;  4QPO A;  4B47 A;  4BE1 A;  4NQW B;  3LSK A;  2A6T A;  2K9L A;  3CP2 A;  3W2W A;  1X4P A;  4X0G A;  4C9Y A;  2KDO A;  2VPL A;  3PFY A;  3TL4 X;  3OYE A;  2XF6 A;  4BJT A;  2WBM A;  1WJE A;  3PUB A;  2I8D A;  1Z3X A;  3SDB A;  3AKZ A;  2CMP A;  2JVH A;  2R4G A;  1Y6I A;  2K5C A;  3OIQ A;  4E7H A;  4XKV A;  1X1B A;  2CW8 A;  3W3C A;  4U7B A;  1D0X A;  4II2 A;  4BUP A;  2CUZ A;  4CA0 A;  2IS1 A;  3VSK A;  1J09 A;  2VAS A;  3OYH A;  3UR3 C;  3HPG A;  2LRD A;  3DPT A;  1EA3 A;  2JA2 A;  2HVQ A;  3EUK L;  1X1A A;  3M1C A;  1SFK A;  2HDW A;  3DTK A;  5LFA A;  4BU2 A;  2VKD A;  4RLQ A;  3HUG B;  1U0J A;  4NUB A;  2CW7 A;  3SEZ A;  4BXF A;  1WJA A;  1LDK B;  2FUG 2;  3V42 A;  4CCL A;  1MND A;  2V9K A;  1MNE A;  2E5N A;  1V5G A;  3PL8 A;  4E6K G;  4MLO A;  2E60 A;  4ZYA A;  1WJ5 A;  4BJ5 C;  2XC7 A;  2VXZ A;  4ANJ A;  4D1Q A;  4EAT A;  4E7I A;  2M0M A;  2WA0 A;  3L2Q A;  4HNU A;  3H9G A;  2KHM A;  1AA7 A;  2W1O A;  2OV7 A;  3VSL A;  2WAQ A;  3MKY B;  4N4O B;  2ZSH B;  3C2H A;  2F4I A;  2R7O A;  3CES A;  4XOR A;  3OS0 A;  2M3A A;  4CCM A;  4XLH A;  4BQN A;  3SZG A;  3QOD A;  2X1D A;  3DQV C;  2R7Q A;  2E5Z A;  1FMW A;  5FRO A;  2VQG A;  4P5O A;  1Z7L A;  4D9J A;  3S32 A;  3AL0 B;  1V5F A;  5HNF A;  1QHG A;  2L9S A;  2X1E A;  2X51 A;  1Z21 A;  2HZD A;  3LMM A;  2R7R A;  2BOL A;  3OL3 A;  3ZRG A;  3MKZ A;  2CV1 A;  3OS2 A;  3BLY A;  2E1M B;  3H9J A;  4Y4R A;  2XF5 A;  3HOT A;  4PJM A;  2K9M A;  3MKW B;  2Y0S A;  2R7V A;  3HL2 A;  2L5Q A;  3FKJ A;  2UV1 A;  4II3 A;  2QKL B;  2BVL A;  2K3P A;  5FRM A;  3H35 A;  4QPQ A;  4NC8 A;  4H4K C;  3OYC A;  2KLO A;  1BR4 A;  3VYR B;  4XOT A;  1K6Y A;  1NG6 A;  2KL4 A;  4HEA 2;  3OYB A;  4BL0 B;  3H5R A;  4CCJ A;  3L2W A;  2VXD A;  3OYJ A;  2F6C A;  2XF7 A;  2VQL A;  1WJF A;  3KEY A;  4U87 A;  3QYE A;  4HST A;  4B3X A;  2R7W A;  2A5W A;  3PJR A;  4XLF A;  2GOM A;  2DXI A;  2DOA A;  4HG2 A;  4CCO A;  3KX2 A;  2WAD A;  4JQF A;  3NWT A;  4C30 A;  5CPR B;  2BW3 B;  2L7K A;  1D1A A;  5JHF A;  2LC2 A;  2Q2E B;  1OR7 C;  2IXS A;  4LIV A;  4OWR B;  2XAU A;  4NC7 A;  2LY1 A;  4HRI A;  3E1S A;  1TZL A;  5KNL A;  1JI8 A;  1IRX A;  1WJB A;  3BC8 A;  3DU5 A;  3QYF A;  2R7T A;  3FBI B;  4XM3 A;  4RM2 A;  3ZXS A;  2LRE A;  2P0W A;  2VJ5 A;  2IGN A;  2PMZ A;  4DBR A;  3OIP A;  1BR1 A;  2IS4 A;  4ZC3 A;  2W7N A;  4E7S A;  2RNG A;  3A1Y A;  2KMU A;  1SAU A;  2CUJ A;  2VJ4 A;  4CSW A;  2Z1D A;  2KP6 A;  3RSN A;  2IGM A;  3DTE A;  3IUO A;  2M4G A;  2V4J C;  5CKT A;  4BS9 A;  4BDZ A;  3DEE A;  4DGW B;  2DCE A;  3H5N A;  3CJR B;  2VIX A;  3PNV A;  2CFO A;  2M4K A;  5TGT A;  4B43 A;  2IS6 A;  1MMN A;  5CQG A;  4HNT A;  1MW7 A;  2LG4 A;  2KRC A;  3OYF A;  4P1W A;  1BR2 A;  4LIT A;  5CQE A;  2UWM A;  3K4L A;  4C2U A;  3G2B A;  3HC7 A;  4B48 A;  2MAB A;  2ZSI B;  4BE2 A;  3SYT A;  2WY7 Q;  4XN3 A;  3DPU A;  3UNG C;  3QYB A;  2X6X A;  4KIT B;  3BG7 A;  4XR6 A;  2HNH A;  4E4H A;  2HQA A;  2RRE A;  3S3M A;  2V7F A;  3HXL A;  3H9Q A;  1PJR A;  2WY8 Q;  2WB1 A;  3I9V 2;  1V5E A;  3I3L A;  3OYL A;  4BGD A;  4N4N B;  4F92 B;  3ZCO A;  2VL8 A;  4CZC A;  1X19 A;  3D5R C;  2VLA A;  3EUH C;  2DJI A;  2MC4 A;  2LOO A;  4E7K A;  3L2V A;  1KON A;  3CJQ B;  3S8P A;  4BEH A;  3LFU A;  3TMO A;  3CMM A;  3NWS A;  2LBF A;  3FBN B;  5FRN A;  4OAZ A;  4CCK A;  1X1C A;  3K4C A;  1R6R A;  2MFZ A;  2MD0 A;  2XSJ C;  1LVK A;  4BE0 A;  3OYI A;  5HLT A;  2HPI A;  2X85 A;  2ZFU A;  2Z2S B;  4CCN A;  1UG0 A;  4PUS A;  4PFO A;  4ZDO A;  2IGK A;  4XNF A;  3OYD A;  2RQQ A;  4PK4 A;  4XKC A;  1WJC A;  2VQH A;  4NNJ A;  2NOJ B;  1MMD A;  3HKZ A;  2LY2 A;  2IGO A;  3K70 D;  4CH7 A;  4G6T B;  3ZQQ A;  4E7J A;  4F52 A;  1E0E A;  2L9N A;  2GOX B;  2F5V A;  4IQ4 A;  2UUZ A;  4E7L A;  2ZXI A;  3S3N A;  1P9Q C;  4AU7 A;  2V1N A;  3KYL A;  2R7S A;  2PJR A;  3OWT A;  2KRH A;  2L2O A;  4CUG A;  4PSX A;  3DLA A;  4DOZ A;  3OYG A;  3IAS 2;  3PNT A;  4J01 A;  1UEL B;  3DPL C;  4PJJ A;  1QHH D;  4KT6 A;  4Y33 A;  1ERD A;  1DGW Y;  2HPM A;  3GBG A;  2XDV A;  1FMV A;  3LSH A;  1GLN A;  2R7X A;  1MMA A;  5HOO A;  4LIU A;  5LD2 C;  4PSW A;  2KQR A;  4C2T A;  4XKB A;  3D5L A;  4ZJZ A;  3K70 C;  4ZTJ A;  2AQE A;  4R79 A;  2HVS A;  1DP3 A;  3RCO A;  2V26 A;  3EPZ A;  3QOE A;  4RLF A;  3PSI A;  2Q1Z B;  4LG3 A;  1BOB A;  4F93 B;  4DIQ A;  1Z3Y A;  3OS1 A;  4JOM A;  3OYN A;  4IZZ A;  4F91 B;  3OYM A;  3LSM A;  1X1D A;  3IP4 B;  4F3Q A;  4AYB A;  3PSF A;  2CV2 A;  2DT7 B;  2X1C A;  2VB6 A;  1Y56 A;  4PFP A;  2IS2 A;  1OLT A;  4XQF A;  3OYK A;  1N78 A;  4FAS D;  3N05 A;  2CS3 A;  4YRV A;  3DU6 A;  3OL4 A;  2KZV A;  4ZTF A;  2BVM A;  1S9H A;  1WJD A;  3K4J A;  4XOP A;  4YEL A;  3K10 A;  2VKH A;  4KJZ A;  4XN0 A;  1WFX A;  1D0Z A;  3K6G A;  3E0J B;  2LYC A;  4IX7 A;  1DGR M;  3IAM 2;  1N75 A;  3L2R A;  4IQJ A;  2W00 A;  2VJJ A;  1PYV A;  3H0D A;  2AQF A;  2HVR A;  1YE9 A;  3RTR A;  1T0F C;  2QKM B;  1YX5 A;  3K4M A;  1W36 D;  3VYS B;  4HPQ A;  3C2G A;  3S93 A;  3H5A A;  2JVG A;  3M8J A;  2JUG A;  1G59 A;  3FDY A;  1DQU A;  3L2U A;  1TT0 A;  2DT6 A;  3VDX A;  4HSR A;  3LL7 A;  3OR1 C;  3RPU D;  2CV0 A;  1G8X A;  3CP8 A;  4E7Z A;  5KCM A;  4ITV A;  4PJN A;  2OC6 A;  3DTI A;  3F9K A;  1NG7 A;  3S3O A;  2V6E A;  2X6Y A;  2WAF A;  3BCA A;  1D1B A;  3MMY B;  3PNY A;  4YEJ A;  1UAA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...