2AQPA

Cu/zn superoxide dismutase from neisseria meningitidis e73a mutant
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
155
structure length
155
Chain Sequence
b'ASIEVKVQQLDPVNGNKDVGTVTITESNYGLVFTPDLQGLSAGLHGFHIHENPSCEPKEKEGKLTAGLGAGGHWDPKGAKQHGYPWQDDAHLGDLPALTVLHDGTATNPVLAPRLKHLDDVRGHSIMIHTGGDNHSDHPAPLGGGGPRMACGVIK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase [Cu-Zn]
publication title CU/ZN superoxide dismutase from neisseria meningitidis E73A mutant
rcsb
source organism Neisseria meningitidis
molecule tags Oxidoreductase
total genus 38
structure length 155
sequence length 155
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2005-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 2aqpA00
1SDAB 3H2QA 4U4IA 4A7QA 3CE1A 2SODB 3T5WA 1COBA 2GBTA 2GBUA 2WWOA 3K91A 1EQWA 4OJAA 1JK9B 3QQDA 1DSWA 1XTMA 1IBDA 1UXLA 3KM2A 1B4LA 1HL5A 3ECUA 2APSA 2VR7A 3GZOA 3LTVA 3GTTA 1Z9PA 1CBJA 2C9VA 2E47A 1Q0EA 1E9QB 1U3NA 1OZTG 1RK7A 2Z7WA 1QUPA 1P1VA 1XTLA 1XSOA 1OEZW 1BA9A 1ESOA 3L9EA 3MKGA 2AQRA 3L9YA 1L3NA 1PZSA 1SRDA 5KBKA 1PTZA 3KBFA 1F18A 2GBVA 3H2PA 1JCVA 3HOGA 2ZKWA 3F7KA 4A7VA 1Z9NA 2WKOA 1YAIA 2K4WA 4A7TA 3QQDB 1BZOA 1FUNA 1KMGA 4OH2A 1B4TA 3KBEA 3ECVA 3SODB 1PU0A 1SOSA 2R27A 4MCNA 1SXSA 1SXCA 2WYTA 1E9PA 4N3UA 4FF9A 1N19A 2JCWA 1IBBA 1TO4A 2WKOF 2WZ6A 3S0PA 3KH4A 2VR8A 5KBLA 3GZQA 1IBFA 1OZUA 2Z7YA 2AQNA 2LU5A 1YAZA 2VR6A 1SXAA 2E46A 1SPDA 1HL4A 2XJKA 4N3TA 5KBMA 2AQPA 1EJ8A 1SXZA 2C9UA 1E9OA 2ZOWA 4L05A 2Z7UA 3CQQA 2JLPA 3KH3A 1F1GA 4BD4A 3MNDA 3PU7A 1IBHA 1YSOA 2WWNA 4A7SA 1N18A 1F1AA 4B3EA 3GZPA 2V0AA 3KM1A 1TO5A 2AQSA 2AQTA 4MCMA 2WYZA 4A7GA 1JK9A 2WZ0A 1E9PB 1F1DA 4A7UA 1IB5A 1MFMA 4BCZA 2NNXA 2AEOA 1UXMA 1S4IA 1DO5A 2ZKYA 3HW7A 1E9QA 2AQQA 1OAJA 4BCYA 1AZVA 2AF2A 4A7GF 3RE0A 3GQFA 2Q2LA 1SDYA 1SXNA 1CB4A 2XJLA 2C9SA 3HFFA 2WZ5A 1SXBA 2Z7ZA 3GTVA 5CU9A 3ECWA 1E9OB 3F7LA 1OALA 3CQPA 2ZKXA
chains in the Genus database with same CATH superfamily
2Z9TA 1RLBA 2J55A 4FXKC 4U4IA 3E2HB 5JLZB 2QEJA 3OQRA 2ZG2A 1UWEH 3QJSB 4OCXH 2ICWJ 3A21A 4G1EA 1PY4A 1GVIA 4BFBD 4X99B 5HHNB 5GGRY 1CDJA 3AS3A 4IIZA 2R2EA 4QGYA 4X9YA 1V55B 2WLIB 4L4VB 4ZW5A 2UUDK 3F7YA 3E8VA 5LAXB 3ELQA 2B0SH 3MLYH 4WAFA 1JPTH 5FYKL 1NAML 1QSZA 1U3HB 3BH9B 3NRFA 1GW0A 4HWEL 2HLEB 2ZICA 1FFOB 5C0NC 3BT0A 1OEZW 3GSXB 5DD0H 3H9ZA 1R47A 1XV8A 3QRGH 4M7LT 4KKNA 3DETD 5SWSA 3X2QB 2VXSL 5I5JA 3BW9B 1A9VA 3H7LA 2FWUA 2AEQH 1KPVA 2DWSA 5E6RB 2AJUH 4HKXA 2OULB 2DQCH 3OTTA 3AUVA 5ICXA 2CHNA 1FNGA 5CN1A 3P9MB 4XVSH 1NCCH 2VZ1A 3N91A 4MJID 4I4WB 4PLJC 5F7HA 1YY9C 3F01A 1QKZL 1FL5A 1TTBA 3HE6D 5C09B 2VDKL 4FTVA 3VTMA 1X4ZA 4PWHA 1AR2A 5I1CH 3MLUH 4UYQA 5H2BA 4I18C 2R56L 4JFEA 1FRGH 4ENZA 2R9HC 1ZS2A 3IDGB 3MJ8A 3N5AA 5MENE 4LCWA 3MCKB 3T2PA 1A3LH 5FYLE 3UAFA 1XGRA 3I6LE 3MRKA 3FB6A 3AQXA 2R2EB 4FQXD 4G3YH 2YD9A 2WBJA 3K2IA 5F9JA 1CE6B 4O2CB 4R7VA 4BRJA 3JTSA 1TO5A 4HKJB 2ZX5A 1FFPA 1YN6A 3MQIA 4HETA 5E2WL 2QBWA 5F7NC 3QDME 1OTSD 4Y1AE 1XXFC 1HE7A 2EYSA 3FU7A 4JRYA 1OWWA 4UQDA 1MJUH 4E9TA 5B1JA 1O7DC 5SWSB 5E8DL 1U8OB 2P5EE 4PD4K 4L8SC 2PCFB 2MNUA 2ITCA 3I3BA 5IB4A 2EEXA 2C3XA 1BWWA 1U92B 2WANA 5I5IA 1P7BA 4PJIA 4HKXB 1HQRA 2YSTA 3IDNB 3FCTA 4GQ9L 1EJOL 3NJMA 1PG7W 1TETH 3WJLC 1LP9B 5F7UA 4QRRD 2ADIB 3MXWH 4IU2A 4WWKD 4Z7UA 1Y0LA 1DVUA 3WFCL 1F4XL 2VIRB 1B3IA 1FL5B 5SX4H 1ZPLA 2HRLA 4MMXC 5JQHC 3HVDA 5JIHA 5L7XL 1JXFA 2VN6A 3F5WA 4YE0A 3WNJA 3ZGHA 5A3IC 2YGPA 1L9PA 5F44A 4HULB 5A2IH 3OMIB 2A4CA 1TPXC 5E5MB 3BZDA 4R83A 3FO9B 4ZQKA 4KFZC 4M7LL 2ARWA 3D2UD 3S9DB 3UBXB 3KPSE 1KTDA 1TCRA 3AREC 3ARGA 1IKFH 3T0BA 3VFPA 3VGGA 1SN5A 2FLMA 4PRPE 3HC4L 3EKCA 4NUQA 4MCZA 1GRWA 2R1WB 5F7KC 1GJWA 3VFOB 5F9JB 4ZMQA 1W0WA 5HP5A 3JTSB 4ZUTB 5ICZA 4JGNA 1NCDL 1JGIA 3BOVA 4NBXB 8CGTA 1T7ZA 3I2CH 1QTPA 5AD0A 5JNYA 3GSNH 5FM8A 3HG1D 4YEFA 2NY0C 4DHLA 2ED7A 4W6YB 3TBWA 3N06B 3NGBB 5IB4B 3PWPD 2VSDA 3V5KA 1A8ZA 4KKCC 4PJIB 2PTTA 3CVHA 2OP4H 4ODWA 1HQRB 3LXAA 1MJ8H 1E5YA 3HNTH 3Q06A 4G43A 5I0YA 1JSYA 4MB4A 1BVZA 1CD1A 2BHZA 2XZZA 3FRUA 4IU2B 3MLTB 5KBMA 3MV11 5IFHL 3GSQA 1WLHA 5IGXL 1Y0LB 3E9UA 4NO3B 3WSQL 3GBEA 4DP6X 3MU3A 1KUMA 4EVNA 5EZLB 5LLIC 2OS7A 1R1CA 4PM1A 1ACZA 4HEPA 3ARFD 1O6SA 3NZHL 3SE8L 3MGOA 5CIPH 1JHTB 4N0UA 3VQLA 4G6KH 1J9SA 2YRZA 3FULA 1D9KD 1N6VA 3GMQA 2VSKB 4QRPE 3CXDL 4X6EB 2GAZB 5E9NA 2E7LC 4M8UA 2P80D 1MJ7L 3DVNB 4NUJA 5D7LA 5C0RH 1KTDB 1TCRB 3LIZA 4P2CG 3ARGB 5GXBB 2LU4A 2WAHA 2NNXA 2Z31B 4KJQD 3QZBA 3RGVD 1AOHA 5J4MA 2XRAH 1F4YH 1T5WB 3CLWA 5KSVA 2XQYG 1VPOL 4XXCA 3ESOA 5AYTA 4QXTA 3NBNA 4Q89A 3RPBA 3Q43A 1I7ZA 1E4XL 3WNPA 1KBWA 2BNQE 2Y3NA 4PG9A 1QLEB 5IVZA 2A6DA 4U3HA 1B3JA 4RWYH 3GMRB 3ZKXB 1JRHL 4PV8A 4J8RA 3CHRA 3ZZQA 2Q9OA 1IKNA 3QUMH 1IGMH 3ML8A 2BSEA 5D1ZD 1A5FL 2PTTB 2VXTH 7FABL 5IM7A 1F90H 1UXLA 1QQDB 5FB8B 3KXFD 2G75A 5KJRL 2P8LA 4G43B 2DTSA 1C08B 1T7VA 3P0GB 3LEVH 3D0VA 4IOSA 4CADB 4Z77A 2ADYA 5GHWH 3FRUB 1V5JA 2Q8AL 2Q5BA 4TLUA 1DVFC 1S7QA 4WW2C 5IBTH 4HLZG 3TA3C 2NX5A 1UVQA 2YD2A 3HUJE 3KL3A 3RB5A 4AYBA 2X4SB 1NBYA 3EYFA 3GRWL 4N0UB 4PUBL 1SGKA 1YMME 4I48B 3WJJA 1KGXA 1EUTA 4JFZL 4UV7L 2EUVA 1NSNL 5DHMC 4WWNA 3T3ME 4GUPA 4D0BA 5DEGB 4QNPE 2XICA 4AQOA 3LKQA 1G9NC 3PLYA 4V2BA 1RULH 4DFHA 1EFXD 4DUWA 3ENEA 2CR0A 4AL8C 1FDLL 1XGQA 2WXKA 3AAZA 4D7PA 2MRYA 1DP0A 1Q4NX 1OAZH 1CXLA 4LVEA 2Y1AA 4MCNA 1BBDL 5KVGL 3KGTA 3HIZA 2PKDA 2XIIA 3M8OL 4QXTB 2UWEE 5BJTA 4ODTH 4X6DA 43CAA 2EE0A 1T0OA 3R06B 5DEFB 1B0RB 1I7ZB 3L45A 1YJDC 3L4TA 3ZL2A 1JDCA 5KN5B 3FDWA 3IJYA 5HVFB 2WD0A 3BFOA 4OGYH 1DEEB 5GGUA 1CLZH 1QOKA 1RJLA 1UJ3B 3EJJX 5A16A 4CSTA 1AQKL 3GPSA 3T8VA 2YOAA 4JY6B 2KLRA 1WCBA 3C12A 1E6OL 1FO0H 1RZJH 1S2EA 1U3YA 2P8LB 4LP8A 3HHSA 2BWIA 4HCRL 4OLXH 1R5IA 4TRPH 4Z77B 4DVBA 2J8UF 1CXHA 5FGRA 1GZQA 2DQEL 3CC1A 2FBRA 4A2LA 4MJIB 1RIVL 3X3FH 2FD6L 5BOZG 4PS3A 1LO5A 1JJUA 1JGDA 1FNEB 2YZ8A 2OA9A 4QRQA 1PY0A 2H1LM 1SY6H 2QGCA 4EI6B 1NBYB 3D18B 3TXAA 5GS0C 1N10A 1S6NA 3IJEB 3ARSA 3WTVA 4ZS6D 1FHGA 1IBYA 2F8IA 1CXFA 5JIKA 5KSAA 5C3IA 3RGHA 4GUPB 2R29A 5DSCB 4AMXA 4QTFA 2X4NB 1RUMH 1T20A 2H8PA 2UZIL 1EAJA 3LHAA 1G5GA 1OB1B 4FQXB 1MY7A 2GUOA 4POYA 2VERN 3PFQA 4PRAA 3DJ9A 5D8JH 1T1YA 3RY4A 3CFDB 3E8UL 1Y6KR 1WGVA 5BVPL 2N0MA 5IEHA 3K6NA 1PPIA 1LYQA 4P2RD 4YXHH 1BQ5A 3LTVA 3WHE0 2UYLB 5CD5C 3S37L 3IJYB 2EDLA 4Z0XA 1IE4A 5GGUB 3KLAA 1SEBB 3ARBA 2IALA 3PL6D 5AW9B 5A16B 4HOWA 3WLBB 3MRBA 4YOKA 4O2FA 2NY3B 3IU3B 2ZCZA 1Q1JH 2X6AA 4PRHE 3RWIA 3IDUA 3LKSA 4JRLA 3T6QC 1BXVA 3HHSB 2MOVA 3JWNC 3L81A 4MJ4A 1XHHA 4DVBB 5EBGA 4QRRB 3VD1A 3P2TA 4R84A 3T0AA 1GZQB 2NY7H 5MEQB 3VTAA 3OAZK 3OVUB 1CFTA 4HISA 1JGDB 5F88B 3O4OB 1RZJC 4UB0L 4L23A 1U3ZA 1N8OE 1RPQA 3ZO0A 1J1OL 2C9PA 3C6LA 3VG9C 2IC2A 1X7SA 4PBVC 3S0PA 4ELKB 5ECJE 5KVFH 1DR9A 1G43A 1KJMA 1XCQA 4L1HA 1SXAA 1VF5C 3EDFA 3WENA 3A24A 4AM0A 3FU8A 3AQZA 2D7PA 1JZJA 5LXVA 1UG9A 5E94B 2AQPA 4UILL 5FYJL 2B2XH 2WUBH 1T1YB 4FQIH 3NMEA 1QFPA 3B5TA 3IMRA 2F19L 3QC5X 5C08D 3BPNC 2JQAA 1C5CL 4BDVA 5IEHB 1I85A 3ULUD 1NC4D 1A7QH 1UM4L 4Z0XB 4PHXA 4HF5H 2DIJA 4UIMA 3DIFB 2CJTA 2PTVA 3HC3H 1DLFH 4JPVL 5AZEH 3WXVL 1I9RL 4WLCA 1DBKH 2FX8L 1HSAA 2XZAL 4S1QH 4G70B 3RWIB 3LKSB 4ZFOL 3WEXB 4Z7VE 4L8CB 3M86A 4WHYH 3VA2C 3PWVB 4R7NA 5AQ0A 1ZVSA 2BHUA 1D5BB 4LRNL 4OKVA 2KI6A 2WV3A 1TZIA 1MWAL 3KPLA 4DP0X 1DVYA 4BEIA 3SCMD 2AJVH 3UTZA 3MROA 3MRCA 4F7MA 4X5PA 5EOCL 4G6AD 2DQHL 1S7VB 2VQ4A 3ARFB 3FUFA 4YGAB 4ELMB 1FH5H 1F13A 4LOUC 2XTLA 3C60D 4PWFA 5KSBB 5BMFL 2AXJA 2WGNB 4UUJA 3DJTA 2P9RA 4LSSH 1D9KB 1U2YA 2L4OA 3VXRD 1XMEB 2X3CA 3JWOH 1QPXA 4HV8B 2AJSH 2V17L 2UVFA 3RKPA 2VN4A 3VFMA 1BZQK 3ERXA 4X9FA 2WBJC 4KQ3L 4LPCA 3MRGA 3MFGB 3RGVB 3R4DA 3EHBB 4RESB 3SHSA 3TCXA 4RZKA 3SDCA 3UO8B 3MYZA 1LO0H 4MRBA 2EAEA 1RZ7H 3CVBA 3X13B 3QS2A 3SQBA 5JIMA 1HDMA 3CVHH 5LGJA 1L3NA 2VLME 3VFSA 3IFPA 2C1PB 4CMMA 5B1JC 4QRSB 2NZ1A 2Q3XA 4J6RL 2L7EA 2BY0A 3B1UA 4XRCA 1U8PA 2M83A 4K4KA 1JNLL 4NQSA 4UIMB 4PREA 2Z92B 1Z0NA 1JZFA 1BECA 1PKOA 3LEXA 3VFVA 5EF2A 4CC1A 4Q14A 4CMHB 5D1ZB 3CZUB 1XF4B 2HJFB 2XHNA 3KGRA 4IBYA 3QAZB 1H8OA 2TRHA 3EOBA 3P3SA 3ETSA 1AKJB 1OTTC 4QIRA 4R7NB 2QZ5A 1RMFL 2GTQA 1VGKA 1LO2H 3EW3B 3QXDA 2TSBA 4DGWC 3NDYE 4EZKA 1CTOA 4ZO6A 4K9JA 1MVUA 1E8XA 3LEYL 4GIAA 4JQIL 2XYCA 3GXDA 3MRCB 4K3JH 4F7MB 3GRWA 1MCLA 3ILPA 4FMVA 1MVFA 1EAPA 2BXZA 3KJ6H 3P0VL 4CRPA 4EPSA 3OKOB 5ALCH 4KI5E 4NKOB 1GGIL 4UDUA 1I8MB 3HN8A 5B7FA 3ARGC 2X2JA 3KVQA 3VFMB 1OAXL 4QCIB 3LKNA 1SHSA 3HI6H 1EFXB 4PP1C 2CM6A 1TQWA 2WTPA 4D9QD 3TH3T 5AVWB 3WKNA 4X9BA 4DP1X 1PLAA 5D6CB 3JWOC 1PFCA 4M02A 4PB9L 3CSFA 1EVUA 3G5VA 3SQBB 4U1IA 1HDMB 2NR6A 1S8DA 1G7QB 3KW8A 5C0CD 4CMMB 1ETZA 2GFBA 3ZKXC 1JI1A 1R3HA 2OZ4H 4JLRB 5F0LB 1XT5A 3O6KL 1A14L 4NQSB 5GGTH 5ID0A 1NIEA 2UZYB 1KB9J 3K0YA 3QVAA 3D0LB 2NY6C 3B2VL 3RDTC 2WCPA 3QDJA 2HWZH 2W8CA 3HNVH 4YFLI 1CF8H 3ZTNL 5TE7H 3ARDD 4GRLD 3RIAF 2DY2A 4XP9L 1WTLA 3WO3B 2LHAA 3EOBB 3WTXA 5C0BD 3L1GA 1J8HE 5AW5B 1TJIL 2FJFA 3O3UN 5JTWA 1EQWA 3QXDB 2F5BL 1J05B 3SGJA 4H20L 2UY6A 1KBVA 2F54A 1Z5HA 3CFQA 3GZOA 3MZTA 1OTUD 2XX1A 1EAPB 3GI8L 1KDJA 5FYKH 2HVKB 5GGSY 1EH9A 1E5BA 4G8EB 1NAMH 4XR8C 3FRPA 4M3HA 4HWEH 1X5HA 1HHGA 2BVPB 4UDUB 3MV7D 2IBGA 3OL2A 4JFYA 2G2RA 1C1EL 4DEPB 5JXED 3LKNB 2CO6A 4B5EA 4G71B 1N67A 2YMXL 4QOKD 5AUMA 1KBKA 1SVBA 2VXSH 3W9DA 4DKAA 4RAVA 2KT6A 2MCPL 4HSCX 4JFFE 2YK1H 2X3AA 1HCVA 3KYMA 4K7PH 3G5VB 1NUNB 1AQDA 1KLGA 2OXHA 3PF2A 5C3LD 1S8DB 3OAYH 4BGDA 4P2RB 4BUGA 3QPXL 2C4XA 1R3HB 4GAJL 5AAMA 4IMLB 5ADPL 2OMWA 4XGZA 4JFDE 1QKZH 1IKNC 4RGMB 3PL6B 4MXVE 1KXHA 2Z3FA 4TVUA 5DLML 5D93B 3DHUA 4PJHE 4GAFB 4WSGA 3TTYA 2I60L 1YUKB 2BRQA 5J11B 2R56H 1W16A 4ZODA 2EACA 3FFOA 1BYPA 3SO3C 2EC8A 2RACA 2GVYA 3SQOL 4F8LA 1J11A 3VI4A 3TF4A 4GKZB 3TBSB 2UY6B 4AV0A 2R29H 2W65B 3B9VA 4AIZA 1ZVYA 1YEGL 4R97B 5G5DA 1JUFB 2FR4A 3QQ9D 4NPKA 2QADC 3WJJC 3AWFA 5E1QA 5E2WH 4A7UA 4UTBA 4NFDA 4L3EB 1IGIL 2BY1A 1WPCA 2G2RB 5GRXG 4BSWA 1YYCA 3ATAA 1KIPA 3BDBA 5B8CA 3MNZA 5I1EH 4AYEC 2CO6B 2BRRH 5E8DH 4I9WE 3W9DB 4JFHE 1E4KA 4L1DA 1CB4A 3KYMB 5EU7E 2VDQB 4GQ9H 3SY6A 2OXHB 1EJOH 5C08B 3K0WA 4Q9RL 2FB4H 4F37K 4DTGL 4X98A 3C5JA 4ZMOA 1BLIA 5BZDA 3QNYA 3CFIC 4X8GA 5DTFB 4BFKA 3FU9A 1NUDA 4QKXB 3WFCH 5TDNA 1F4XH 2DI9A 2NY3C 4P3DA 4R96A 4XNYL 4UZGA 5HSFA 3AS1A 4HD5A 4FL4C 4H40A 4GW4A 3AB0B 4DAGL 4TNVF 1KCVL 4M7LH 3VI4B 4KXDA 2I7OA 1INEL 3INOA 5E6SB 4E5XA 5F96L 2UV3A 2PPCA 1G9MC 1F11B 1ADQL 3SO5A 1GIGL 1NFKA 3HC4H 1OP3K 3SCMB 2Y1YA 1N26A 5DJZB 4AIZB 3V6ZA 5IQ7L 4KZDH 3EGSA 2EUZA 1JPGA 4LOEA 3UTTD 2GBVA 3DOSB 3KCPB 3LKRA 2VLRD 4QYOB 5I66A 2FR4B 1GY1A 2YQBA 1G94A 4ZO9A 4YWGL 1HOCA 3C60B 5KSAC 3LNIA 1WS7A 2XCMC 5IWLA 2ESVE 2HFEA 4G82A 4EI5A 4D0CA 4BINA 3VXRB 4NQEA 1OPGL 2PXYD 3FUNA 5EBWB 3CMOH 1RUAL 5D2LA 3MNZB 5DR5L 5B8CB 1HEJC 4LBEB 4UV4L 3IKCA 4Y2OA 1RK1A 4JZJB 2D0GA 4R90L 4NC1C 3QIWA 4PGDA 1QA9A 1ZLDA 2IH3A 2VSMB 4IBLT 2FH8A 2R2CA 4H13C 2WXIA 5EV7A 2LE9A 4X98B 4G8GE 5HDOA 3U1PA 4HJTA 2BIMA 3RX8A 2WJ5A 1HXMB 2V7HA 1MHPL 3QNYB 3ZKSD 3ARBC 5IFHH 3HZ3A 5IGXH 5DJ8A 5LN8A 3L8QA 3WSQH 3RA7L 2CNYA 4I5BB 3ABGA 4R96B 2H32H 1LMKA 4PJ8D 1N18A 3ZXAC 5J6GB 2HKHH 3SE8H 1NGYA 4IHOA 2DTML 3S5ZA 4GW4B 2RAMA 2AQTA 2OW7A 4Q56A 3ZU8A 2QDWA 3CXDH 1ORQA 1MQKL 5DRXA 2FLRT 1NFIA 5I73B 6PCYA 5D1ZI 2D2OA 4E5XB 1CYXA 1ZT4B 4Y5VA 5AB2A 1YEKH 3L54A 4LRIA 2KLSA 2BZCA 3MPCA 3T77A 3BWZA 2X2IA 1NICA 2ZUUA 3EGSB 3IWVA 4GS7C 3KG5A 3UPRA 4Z7NF 3DRTB 2NXZC 3C6LC 1VPOH 3SKJL 1KIQA 2E7HA 2BOCA 4IRSD 4Q9QL 4BFGA 4XMTA 4HC1L 3KPRD 1KN4L 3S2AA 3UTPE 3MI6A 5EO1B 1E4XH 4X2UA 2B15A 3GRBA 5CEZD 2JKRM 3AM8A 5IG7A 1JRHH 3SGKA 5TQ0L 3NIFE 3EHBC 1KGWA 2FIRT 4CVXA 5AAPA 1A5FH 3I9IA 3EJUA 5IBLD 4K5MA 1I85C 5AOKA 2BVOA 5KJRH 1PZDA 2QV4A 2X9WA 4MNQE 2WM0A 2FJHA 3BEVA 1X5ZA 3WBDA 1U21A 3HLAA 1GZPA 3K2KA 1DL7L 5DJAB 1QRNA 4KKBC 4HHGA 3D06A 1X5AA 1KXVA 3DHMA 3JZ7A 2CDEB 2UZXA 2E9JA 2AQ3A 2X88A 3VFWA 1FIGL 4XPHL 4TNEA 2EXYC 3RI5K 5D2LF 1HQ4A 5EZJA 1NGYB 4IHOB 5F21B 3GRWH 4Z7OB 1OKEA 2QSQA 4U1JB 4ZO8A 2EVHA 3ARDB 4PWGA 5K1VA 4UV7H 5DRXB 4FC3E 3L6FA 4MSWA 1NSNH 1NFIB 5T3ZD 3ZT6A 1HEZA 3BWAB 3QZOA 4JN1L 2DM7A 4MLSA 5DRZA 5EO9A 3ULVD 4NZTL 1FDLH 4XBEL 4UM9A 4Y4HD 3UPRB 4F3FA 4IOIB 3R0NA 1G7IA 1BBDH 5TK2A 2VZOA 3TL5A 1RPUA 1N4XL 1LDPL 2BOCB 2OSYA 2BNUA 1ZWIB 4XT1C 1F6FB 4N8UA 3MV7B 3DK2A 4HCIA 3O3EB 5FGCB 3U0TB 3QEQE 3EO0B 1PZ3A 2GTWA 4TV3A 2FWLB 4ZAKD 2AK4E 2OMZA 4QOKB 1P7KA 4NQCA 2CZNA 3SDCC 4YBQC 3ECBA 5AKVA 1M9SA 4GG6A 4IU3B 1XSJA 1YN7B 2F53A 4OUUB 4ZFZA 2QPUA 1VFAB 4HCRH 3M45A 3KDMA 2GEQA 2TRYA 1H6TA 3V52H 1GZPB 1HH6B 1N0XL 1OM9A 2DQEH 3VW3L 1QFOA 3DO3A 4JG9A 5EU4B 1OQXA 1RIVH 4G8IA 2FD6H 4JY4A 2P8PA 2UZXB 4EDXA 1RUKL 1MDAA 2NLJA 1MCWW 2X89A 3BKML 1NH6A 4OZGF 4PSRA 3UBXG 4K8RL 5IJCC 1U30A 5AG8A 4I9XA 1OIOA 4F5CE 4CJ0A 3KW7A 1Z9MA 1F41A 5KTEL 3N42B 3UROR 4UT6A 3L6FB 4MSWB 3V8OA 3VVWA 5JMOC 3UTSD 1P4LB 1G7HA 1XGZA 3X14A 4FFZA 2NQ3A 2P5WA 2UZIH 3UTQB 3O2DA 5I8CB 5DRZB 4LLWA 4PV9A 4UM9B 4U31A 4P5KA 5D1QE 4F3FB 2YXVA 1ZA6A 3Q0HA 4WJKB 3UZEA 3E8UH 2IAMA 3MRNA 1L4IA 1Z5LA 2BNUB 5BVPH 1DDHA 1AXTL 1DHKA 3LZNA 2B08A 1OE3A 2APSA 3HS8A 5FFGA 4OF0A 4MASA 1TSHA 4WHCA 3S37H 1NKRA 2EYRB 2H3NA 1U3NA 3MV01 4AH2B 4OW6A 2L7QA 1QUPA 1SHMA 1TU2A 1ZA3B 2OMZB 4GG8B 3OJDB 1HL9A 3V4PB 3WAKA 2ATKA 3BH8B 2EIZA 4GG6B 1L9QA 3W11C 3K4ZA 3H9YA 1KPUA 2EINB 2NR6C 3GLDA 4JKPL 3ABMB 4LO9A 4P4KD 4Y5YA 4ZFZB 1LK2B 4UF7C 3WFHB 4RIRB 4XVTL 4D0DA 4HLZH 1KXQE 3PAUA 5I6KA 3KDMB 3BAWA 2MFNA 1A4JA 1T7YA 3FQUB 2X70A 3V9CA 4DK5A 4IGBA 2VMJA 4W4OA 4JY4B 2P8PB 4UB0H 1AY1L 2VMFA 5T3XE 1SOSA 3G9VA 5TFSL 1YEDB 4NO0A 1J1OH 5E99L 1H3UA 4FYRA 2W80C 4Q4IA 2BHFA 2HJKB 3H9SE 4MJ5A 4IBSA 3ROOB 4QXVA 3T08A 4WUUD 3SGJC 4Y9FA 1DANT 4I1PA 5IHLB 4L3CB 4MAZA 3F7VA 3TV8A 4D8PB 2YGOA 5E8NA 3CN1A 1G5AA 2Y07L 5IESL 1EJ8A 2MH4A 5E8PA 4UILH 1C8QA 5FYJH 1NANI 3N85H 5D70L 4GBXD 5KSUA 2D2CC 3UTTB 2IAMB 2VLRB 3ATBA 3MRNB 4D2NA 2F19H 4N5ED 4DP4X 3L95A 5D71L 5B1KA 5EZOL 3OMAB 2G3NA 4PJCA 3IN2A 4XNUL 3S8GB 1UM4H 5HYJE 3O8XA 4HCFA 2ITDB 3K8MA 1WBXB 4AI7A 2F5AL 5E4IA 4AGPA 2DMGA 5EG6C 3QUYD 4JPVH 1HH9B 3WXVH 1I9RH 4UOZA 4JAMA 2FQFA 1OARL 2FX8H 3DURA 4JDZA 4LHQB 2XZAH 4Y5YB 1S46A 5BXFA 3S96B 2G4GA 3GJEA 3GXUB 4HEPG 4FX5A 3CSTA 1A4JB 1I8AA 1UB6A 3TC9A 1SYSA 5AAMC 2VDNL 4LRNH 4I0CC 3V4VB 2RFXB 5I8OL 4IGBB 3MV8D 3X1NA 3HMXL 1MWAH 5LN4A 3FQNB 2DF3A 5GGRB 3RRQA 4CW1A 4PW9A 1N70A 3FL7A 5EOCH 2AMUA 2DQHH 4PJ8B 3SBPA 3VXNB 4LLYB 3D4GA 4G7QB 1YNTA 3JYCA 5HHOB 3FOMA 3ZY7A 3HVNA 5KW9H 2JKNA 1FZJB 1GR7A 1MFCL 1GTNA 2DYPA 1QNZL 3IU4L 4QR7A 2V17H 4YNYA 3MFFA 5GISL 3V6OA 3BUBA 4YIQB 3BJLA 3U0PB 3QJHA 4KQ3H 1S9KC 4JO4H 2X4UB 5I6LA 1OE1A 2ILLA 2QVIA 4M62H 4NGHL 3SYCA 3PXLA 1X7TA 3TYFA 1U58A 1KIRB 3A6BH 1N8ZB 5CJ5A 2QQNL 4QMEA 4PJCB 5B8CC 2JB5L 3KPRB 3V0FA 4E42B 2G9HA 1WD9A 4J6RH 1UGNA 3UZVB 1O6VA 5E8EB 1JNLH 3AROA 1E4KC 2ZNWA 4XNMB 1XIWD 2OX5A 4HJ0D 4KH9A 1FUNA 2XXCB 1C7TA 2ZUTA 4PCYA 2XZCL 5K59E 3BP4A 4XBGA 1MVYA 2AV1B 1UXWB 1I1FA 3ARUA 4PN6A 3GJEB 4LVNB 1NGXA 1A1OB 4HUNB 3PP4L 4WWID 4J3OD 1U8CA 5JW4N 1SYSB 1HI6B 4NQDE 4XPAL 2VM3A 1YMHA 2H26B 2VR8A 1Q94B 5ANMA 4JQIH 4IJTA 1MCQA 4MA3B 4XAWL 3P0VH 1ZLEA 1OAYL 2IH8A 1AHKA 2BINA 3ARPA 2HJLA 1ADWA 2Z7UA 1GGIH 1QAWA 3CNKA 4X6CB 1QLEL 1UXSA 4YNYB 3OV6A 4H8VA 1PLGL 4HUVA 1CFBA 3ARZA 2CCLA 1OAXH 3LDBB 4J1UA 2VOTA 3MXVL 1MKFA 3QUHA 3OR6A 5GQBA 3RVVC 4M6NL 2FNBA 4JM2A 4Y4HB 4FQ1L 3TYFB 3WAJA 1U58B 2EE6A 4PB9H 1HK6A 2YMOA 4EI5C 1QLRB 5ESQB 3BQUC 3BZFA 1ND0A 1E9QA 1KDIA 3VXMA 3ZL4L 1YEIL 1CLOL 1AS6A 5E1HB 2D8KA 4PRID 3UAJC 4TVPE 4KK9D 3ARVA 3O6KH 1JWSA 1A14H 1KN2L 1EXUA 1CFQA 2WQ8A 3L3HA 5D1XA 2K9UA 4ZAKB 4GXUN 2OX5B 3FHEA 3QIWC 5D2NA 1C16A 3B2VH 2EE2A 3EOAA 1H9VA 5IHWA 4AC2A 1K8DA 2GJ6D 3BP4B 4P9HL 4CSPA 5E08L 3D4ZA 2CSPA 1LHZA 4ZRGA 4XP9H 4LLMB 4FCHA 1NGXB 4FNPA 2HXAA 4HJJH 5IHUL 4WJ5A 3M1OA 2GBUA 2NNAA 5KYYA 1TJIH 4OI7A 1XTMA 3C87A 2EXWD 2Y22A 3I9AA 2F5BH 4YR6B 5F0MB 1KACB 3VWJA 4J3TA 1FZKA 4BKSC 4UQBA 2VT0A 4XOBA 1AACA 5FO2A 1Z9LA 2OSLA 4Q9CA 1HILA 3ZQWA 3BPLB 4FLRA 4IW4C 4XCYA 5D7IA 3L9EA 1FVCB 5IHHA 4IOFC 2DMHA 4HUVB 1CDUA 4U1KB 4Y5VC 1C1EH 4LRIC 3ATDA 4UOW1 4J1UB 3WKPA 1O7SA 3OKLA 1Z9SA 3DJZA 1T0PB 2WYIA 1Z7JA 2OR7A 4NBZB 1I7TA 5TDPA 4O58H 4H8WL 1KWKA 2UX6A 2GY7B 2NY2C 5LVEA 3NVQA 5AW0B 4MWFA 2QLVB 3ZZLA 3O4LA 4F20A 3AW5A 3OWRA 5D5ME 3M6DA 1QI3A 3QPXH 2Y36L 4MD0B 4QRTB 1MZYA 3SGKC 1ZK5A 2ENQA 3NIGF 4GAJH 5ADPH 4LMQI 4R7DB 1INQB 4TSAL 1EXUB 1T1XA 1BFOA 4OD1H 3FT2B 2LLNA 2CKBA 4HEMA 4ZSOE 1C16B 3O2VL 5KVEL 2DIBA 1OK8A 3TT3L 1MNNA 4DK6A 1BVLA 4Y8DC 2A83B 4NWUH 3GUTA 1SZNA 4QHUA 2I60H 1J7VR 2J6WA 3GXPA 4P4KB 2ZTBA 5TQ2L 3FB5A 5I6XC 3ZDZF 3N04A 2WWMD 2HRPH 4WJ5B 5JR1L 4KXZH 4QHMA 2DEXX 2IAND 3SQOH 2GEEA 4OZFA 2FO4B 4KY1L 4HK0A 4HWBA 4IBWA 1FZKB 2X5PA 4R0LA 4ZNEA 1QZ1A 5HD8C 4FFZH 4C55A 3O2DH 4X5RA 3SKOB 1YEGH 3TVMA 3ML9A 4MRCA 4BZ2L 2JIXD 2XN9D 3MBED 5CMAB 1WFMA 1F1DA 4HQQL 2HLFC 3K2UH 2Q7YA 3DIDA 1AD9A 1IGIH 4NO5A 1SLWA 2YA2A 3VWKA 3KMDA 4WUUB 1QZNA 3G6JE 4W9IC 1NFAA 1QEWB 3Q8FA 1ZDQA 2BW5A 5HGGS 4MHHI 3D39A 5AVVB 1Q9WB 1NCWL 1I7TB 4HIXL 3D4YA 1M57B 1IKOP 2ZE0A 5LNGA 4Q9RH 5J13C 3CFCL 1IIKA 1A1NA 2IQAB 4DTGH 2G5UA 2LFGA 4HBCL 4L1TA 2R8SL 3GSUB 4PRDA 1IFRA 2FWOB 2F1AA 4K23L 2WPGA 4ADIA 1ZXQA 4HZ1A 2VO5A 3DBSA 4AV5A 4RMUA 5AW7B 4JFOB 1T21A 1AO7A 5EBMA 5K9KB 3N41F 1W9XA 3QUYB 5CCHE 1QBLL 1OF2B 5T1LD 1IGCL 4QHUB 3V0VB 4PJXE 5FO9A 3GMPA 4P4RB 1HCZA 1NCBL 2JWYA 1ZHKA 4DAGH 5DJ2A 2NY5L 4QHMB 2JVUA 2Y0SA 5IW6A 1KCVH 2Z8RA 4ZX4A 4WO0A 3IF1A 1INEH 4HK0B 5GRZA 5F96H 1FHNA 3MV8B 1ADQH 5TD4A 3SDXE 1GIGH 4QRUA 3ZDXE 4A63A 4CNIA 4IKKA 5IJBC 3VXOA 4L4TE 1Q9LA 5IQ7H 4X5XA 1IILE 3DECA 1GSMA 5GPRA 4HH9A 1Q1PA 1YCSA 5MI0B 2BZDA 4MFHA 1AD9B 1KG0A 1SN0A 3Q1SL 4XN5A 5E1AB 3D0AA 1U2CA 4YAQA 5C6PB 3GHPA 3M7FB 1OPGH 2Y7QB 4KMQA 5FK9A 5D55A 1RUAH 4NS0A 5DR5H 5DJXB 3MACL 3D39B 3GB7B 1U8MB 3IFOA 4UV4H 4PJGE 1VSCA 3N43F 3BAEL 3COOA 4QT5A 4R90H 3UZEC 5L2JA 5KS9F 2UUDH 2IAMC 4K5OA 4DKFL 3I50L 1CT8A 1RHHA 3II2A 2DQFB 4IMKA 3ZE0E 2DZEA 3TIEB 1JNHB 2APBA 2P26A 4PRDB 1IM9A 2FHFA 4HUWB 1MHPH 1F3JA 1KOAA 4N4YB 2ALAA 1RZQA 1GMEA 3RA7H 1U8HB 3CFTA 1XIWB 1U95A 5L8JB 3DV6A 3GI9L 3NCEB 4Y5YC 5J1SC 1KJVB 3EBGA 4AVKA 2DTMH 3GMPB 1ZHKB 5I71C 3KBPA 4BHUA 3W5NA 1ZHNA 3BGFC 1LP9F 3TBVB 5DJ0B 5LBSA 4A67A 1GGCL 1GYAA 3N0PB 1G7JB 4W4OC 3T1WA 4XO8A 1DQIA 3DLQR 3I6GB 3OGCB 3DX2A 1BX2B 4M9PA 4QRUB 1RZ8A 3RZWA 1THCA 2CLZB 4HWUA 3VXOB 4MNHA 3H9HA 5AENA 1TNMA 2XXMB 3C08L 5GGVY 3IT8D 3IXTB 1MNUL 3QDMD 4XVUC 2OMUB 3SKJH 4RMTA 1OK0A 4X4ME 3QFJD 2ENPA 2X3BA 5DWUL 1PMYA 4HC1H 1KN4H 2BFVL 1PW3A 1FV1A 1KV3A 2P5ED 2QSCL 2CBTA 3LPFA 3O6LL 1OLLA 1S7SB 1BHGA 4PHZA 5H35B 2RD0A 1ORSA 2L3BA 5TQ0H 4M61B 1VDGA 4KTYA 5MERB 3N40P 3CHPA 1HHJA 2CBMA 4X5QA 1C12B 1FI8C 4OQ1A 3SOBL 3VDAA 4RSVA 3V0GA 1A9BB 3X1EA 3DNKA 3QC6X 3V6BR 4YXLL 3MVSA 4DGIH 5HDBE 1KGCE 4RNRA 2JCCB 4QEGA 5DEZA 3O8XC 4DFIA 2CR3A 1RK0A 1LE9B 1DL7H 4JHZA 3SDAD 3BUYA 3F04A 4PRIB 4PS8A 4YVUA 1FIGH 1U95B 4XPHH 5IHZB 5GS1C 2Y5TA 1PAZA 4OCLC 4LVNC 4WEEA 2GJ6B 4LIQL 5HDLA 2DIAA 2FH6A 3QT2A 4XMLH 3UACA 5I76A 1ZHNB 3KPSD 3A4AA 1ETB1 1UM6L 3HC0A 4PTUB 1Y1DA 4FDWA 1J1PL 5CILL 4KROC 2ZXAA 2X1XR 2XN2A 2VDLB 5FA4A 5ITBL 4CA4A 2VXQL 1OP9A 4NZTH 4B9FA 1TTUA 3H9HB 4XBEH 1E9PA 2MTPA 2RBLA 1CIUA 2ITEA 4B0MM 4C83A 1N4XH 1LDPH 2VDPB 4FEMA 3KNBA 5KBLA 4AEHL 2I27N 3V6OC 5AKTA 1KY6A 4YXKH 3MJ6A 2YXFA 1N3NA 3QS3A 1U33A 4G7VL 2BVYA 2CK2A 3R7RA 5T1MB 3S3SA 1V10A 3TS8A 3EOTH 1OGPA 1HHJB 4GXFA 3UGUA 1JGEA 2VL5A 3KPQA 1A66A 5CSBA 5GIRA 3LXBA 4PJ7F 4TTGA 4TULL 1ZSDB 1GCFA 2OXGA 3BPOB 4U3SB 1N0XH 3AITA 3HE6A 4LBAA 3FB7B 3FCGA 3ELAT 4NQXB 1MFAL 5HYQA 1RUKH 1S4IA 4LNRA 4KHTL 4Z3JA 1YDPB 5FA3B 3BKMH 4JY5L 4K8RH 1XGTA 4QRPD 5FECA 1MPAL 4O02B 2X1WL 4MZIA 5KTEH 4LSQL 2QGDA 1QSFE 1H5BB 1DQTA 2IANB 2NNRA 3NSDA 3GS0A 5FLVA 2FSDA 3OQ3B 3H2QA 3QCTH 4M7KL 1EHLL 3GXIA 1UADC 3IFNL 1S7XA 1WFNA 1SVCP 2Y24A 5DRWB 4NHUA 2ATPB 5DC0A 2VR5A 2XWJA 3MYJB 1FFNB 4C83B 5HPMB 3MBEB 2XN9B 1E27B 3KNBB 4AK1A 1EUUA 2YC1A 2IJ0C 5ACZB 2X4OA 1AXTH 2HT4D 1P84K 1N3NB 1UWXH 1KBPA 2RALA 1TJHL 3WTTA 1EHXA 4FQHA 3L3GB 4KV5F 3O3DB 2K7QA 5HY9B 5C0AE 4XMUA 4JM2C 3FO1B 2DI8A 1LXMA 4IS6A 3C5ZD 4WFGD 5E6IA 2A38A 2YUVA 3FPYA 1X5IA 2HVBA 3O41A 1P2CA 2Y6SD 1HESA 4JKPH 1ZKAA 1IC5L 3NSYA 4W4NA 4XVTH 4ZFFA 4FNTA 3E80A 3MBWA 1UENA 4BQ8A 3D25A 4HZLB 4YFLF 4PY8I 3P77A 4JR9L 5D1XC 3BP5B 3OJMB 1S9YA 5D2NC 4LNRB 2QVTA 1ILUA 4E5XG 1AY1H 5T1LB 5FECB 5TFSH 4LKXB 3H0TA 5E99H 5MENA 4E68A 3HTLX 3L3DA 1HZLA 1VCAA 1JF6A 3CN2A 2JKJA 3R0MA 4P05A 3VWJC 4AGMA 2IXQA 2G30A 3QDGE 3SY0A 3D69B 5F0PB 4B9GA 2Y07H 5IESH 2VDQL 3TBTA 4J3BA 4GUOA 2XWJB 2VLKD 5D70H 1IT9H 1I3UA 2ZWNA 3BKYL 4Y1AA 5JXAL 4ODVL 1NBZB 2YFNA 5D71H 5EC2B 2NY1C 3OMNB 5EZOH 1T89A 3ULUL 1GYUA 2QPSA 2CBPA 4FLSA 4FQHB 4QHPA 4XNUH 5F2FA 1QYGL 4B27A 1LEIB 2MOQA 3MCG1 4XXDB 5K5YA 1SLUA 4G8AC 3ET9F 3VGBA 5I0WA 5CZXC 3MO1B 2F5AH 2ZYRA 4OJYA 4P48A 5IW1B 1ZXKA 1B4RA 1KTLA 2V3DA 1T0MB 4XWOC 1O9ZA 1M9WA 3UPCA 2V5SA 3W1ZA 3WIFA 3O41B 1M71A 2ZOLB 4X7FC 1DJYA 5T33L 1KB5L 2HT2D 3AMKA 4PVNA 4TN9A 2WCSA 3KBHE 1R24B 4R9HA 2NOYA 2OI9C 2YXWA 1LEKB 3G5ZA 2VDNH 1T5XA 2NDFA 2WJ7A 3CN0A 4URKA 5I8OH 5IHBA 2AC0A 3BUTA 3HMXH 3VXPA 5C70A 3FB8A 3SE6A 3TN0A 4C4BA 2ADGA 3ASNB 5IIEA 3FTSA 4FXLA 5AL8A 3IAGC 1IGYA 4GIPD 3GSWB 5GGSB 1A1MA 4Z0BL 2XKSA 3DVGA 4LASL 1X9RA 2VLJD 3FH7A 1ETA1 1ZMYA 3WS3A 4PGZA 4UBDD 4I87A 4KPHL 1QNZH 1A6UL 2BVQA 3IU4H 4LLUA 4R0LC 5GISH 3UG4A 2ZXEB 4APXB 4PRPA 2VUKA 4U0RB 1U8IB 3TVMC 2NW2A 4YUEH 4NGHH 3U7AA 4WEMB 4H8PA 5ICUA 3QDMB 1YPZF 2YN5A 1L9SA 2BIPA 4BK8A 3VWKC 4E36A 3II1A 3IGAB 5HVHB 5DFVC 2WYHA 3ETTA 3ULAB 3DGGB 1OCOB 2B3IA 2P5EB 4JO1H 32C2A 4KAQH 3UEQA 2A77L 3DX7A 4N20A 4NZRL 5KG9A 3M07A 4FTVE 3QQDB 5HGBA 1PG7X 5DFWH 1VEPA 4K94C 4N2LA 3GMLA 4JFEE 1M71B 2XZCH 3PY9A 4XO5A 2Q3ZA 1TEGA 2A74A 2EDMA 4JDVB 5SV3A 1LMIA 1L3WA 3PP4H 1H15A 3WKYA 3QUKA 1A7PL 4XN7A 4XPAH 4ZDHB 1H3TA 2YXMA 3IE4A 4EEEA 4KMLB 2EABA 4U05A 3TN0B 3TF7C 4QLRA 1AD0B 4N28A 4XAWH 1ES0B 5I1GL 4N6QA 3T1FB 1OAYH 4A6YA 4G1MA 4LNVA 5KVFE 5DWPA 1L6PA 1XH3A 2DAVA 1FL3B 4QO1B 1FNFA 3KPSB 4JRYE 2HTKD 1IBHA 1QLEH 2VR9A 3V5DB 4CU8A 1PLGH 2NUTB 2YLKA 4PRPB 1T6VN 4XPGL 4NRZB 4X9GA 1I7RB 4RGOL 4BFJA 1WFIA 1XCTA 1ZOXA 3MXVH 5DQDL 4PS4L 3UG3A 5HTSA 2NW2B 3W82A 2VKWA 3GLZA 4M6NH 4FQ1H 4ELMF 4KJPC 2JKLA 4UTAA 5DMGD 5KSBF 1QI4A 3OKDB 1EA9C 4KITB 2BNQA 4Z7UE 3ZL4H 3ROLB 3MOQA 2YAQA 1YEIH 2BLFA 1CLOH 4JREC 1P5UA 1FVEB 1IGFL 2VABA 1UA6L 3DX7B 5I18L 3QNFA 1MCCA 1KN2H 3LPWA 2NYYC 4PLNC 4PIBA 5ABAA 3FQ1A 3H55A 4POUB 4P9HH 4IMKC 5E08H 3DUSA 2XYBA 4GJTB 4FG6D 2A74B 5IHUH 1RZFL 4AXWB 1T1WA 4DJMA 2ZXCA 4ODXA 4FFVD 5B22A 4BQ9A 2B7DT 2DQDL 4YBHA 3P9LA 3LV3A 3HUJA 3AXLA 4NQVA 3F6LA 5E9DA 1OF0A 3S3DB 4OIBA 4OJDH 4GFXA 4A6YB 3KD4A 1MCHA 4WKZB 1JGUH 1VZHA 4QRPB 3EZ8A 1A64A 3IMUA 1YEEL 5FUCE 4ZMPA 7CGTA 2A6JA 5MEPB 1FFQA 1MI5D 4OD3L 2CO7B 1EEQA 1Q9OA 4NFBA 3REWB 1NMAL 3QR2A 3VFNA 1FG2B 4PJ5D 2V2WA 2FAUA 3Q6FB 4ICWA 4J4PD 1TUPA 2E3VA 2V2TB 1TVDA 5F1IA 2BW4A 2XTJD 1J8KA 1CR9L 5JZ7C 3N3EA 4NQUA 3O11A 4H8WH 4QHLB 3O3AB 3W0WD 1BZOA 1KXTB 2UWEA 4AE0A 4ZQTA 2VLMD 4I88A 4TQHA 4EIUA 2BNQB 1E5UI 2D7OA 4YC2C 3QHZL 1F5WA 5D4HA 2GTZA 1H3VA 1P5UB 2Y36H 3ZZ1A 4F37F 1PIGA 4TSAH 5DJDA 3TT1L 3WN5A 4NPYB 1KCBA 4K7FB 3MNVB 3U30B 1NINA 1DLHA 3O2VH 2X42A 3LSOA 3QJVB 3TT3H 4N0FA 3T0ED 1ULVA 4OF5A 4Z3HA 5HYEA 1AZUA 1BD2E 5J9PA 4FG4A 4N9OB 5TQ2H 2DQJL 3RVUC 1A3RL 2GITA 2FL5B 5D7LE 3BPOC 1T1WB 5JR1H 3NSCA 4BSVA 4ZFQA 4HJEA 2I25N 4Y2NA 4KY1H 4KTDL 3CFNA 2FLBT 4P9HC 1RUQL 1J0HA 1N68A 4KK6C 3TBYB 3JTBA 4NQVB 1CGWA 2J8UE 3ZR6A 3OAUL 3GXNA 5BVJA 4PY7A 4YE4L 3DO7A 1YMMB 1F3RB 4KVCH 1AS7A 2YGNA 2WKLA 4HQQH 3T3MB 3CFKB 3CUPA 4S0SD 3FTGA 1MH5A 1WFTA 3LH8A 1J10A 5I75B 4EQ2A 3RX5A 4WJG3 2G3MA 3ARWA 3VFNB 5FYKU 4C4UA 3G04B 5I9QB 1BXUA 2ICEA 1B0WA 1B2WL 4JHAL 3MRFB 3ZW3A 1SXBA 1NIFA 3S5LB 4HIXH 3FFCE 4Q0XL 4F7TA 4KX8A 1UZ6F 2VLKB 4XX1E 1TJMA 2GK0A 4PV1C 1PNCA 3GSVB 5J6HA 2YO3A 3CFCH 4KJWC 3MN8A 4HUUA 4BK5A 2Q7AA 2WQVA 4HBCH 3LNGA 5DVLA 1MHHB 3LZLA 3QPKA 2WLKA 4K23H 1VHPA 2EH8L 2NX5E 3T65A 1H8NA 1IBDA 3BVVA 3WE6B 3WN5B 1OP4A 1WAEA 3I9PA 4H1LA 4OF6A 4RAUA 4OQTA 1FNHA 3LN5A 5HHVH 1QBLH 5KZCD 1YYLH 1IGCH 1T2JA 4JK0D 3DIVA 5CP7A 1JWUA 1YECL 5LHDA 1NCBH 1HX0A 5ALBL 2NY5H 2IOMA 3HE6C 4XH2B 4CDHA 3BZ5A 4E41D 4LPUA 5GSVB 5FYKE 2AXFA 5CCGE 4YHYC 1JK8A 4E9LA 3ETBF 3EGXA 2J6EA 3P3RA 3OB0H 4HIEB 1H3GA 3H8NA 3HFMH 4XO9A 5BVJB 2QTVA 2WZPD 3K72A 1E6JL 3OKKA 3FYIB 5DJCB 4DT2A 1JS4A 4HDIB 2VLJB 3ARTA 4LVHC 3IEAA 1ZTMA 3QQ4B 3Q1SH 1S5IL 4OGZA 3LMJL 2EEFA 3ECVA 3JTTB 3MACH 5TE4L 4YSUA 5BV7B 2ICEB 1OY3B 4X4YB 4JFFD 4XNXL 4PTTB 2XPGB 4YDVA 3BAEH 5IEKB 1ZIAA 1AZBA 1ASPA 4PGBB 2CGYA 3GZQA 4DKFH 3C8DA 3I50H 5GSRA 1ACCA 2GK0B 3BSHA 4JPKL 4ONHB 5DVOA 2V8LA 2XJKA 4PR5A 4N8VG 4XBMA 4YDJB 1J1XL 5E56A 5F97E 3V4VL 2W07A 1L6XA 4JFDD 3QYMA 2KBGA 1UD6A 3PGCA 5D7SH 3H6JA 2P42B 3VACA 1UWGL 1I53A 3N55A 4RAUB 5E6IC 1F3DH 5DZNA 4PJEB 4PRHB 3GI9H 4Y7MA 4Z7VA 3TEUA 1EO8H 1XGPB 1JWUB 5CP7B 5FDWA 1CVRA 3RI5F 3HPJA 3NJXA 4A55A 5ACMA 1CZ8L 1GGCH 2O72A 1A7BA 2GABA 1U8NB 2J71A 3TEXA 5IR1A 1HSBB 3ULUF 1A4KB 4YHNB 4L29A 4TUOB 1JK8B 4ODSH 1R3LA 4AEIL 1AGFB 2AZUA 3RWDA 1QSEE 1BJMA 2J88L 4MNGA 4PS7A 1WUZA 2XNAA 3OG4B 2ZP8A 3OPZL 3QARA 3C08H 4L8DB 3K72B 3OKKB 4WTZA 3AS0A 4C56E 1MNUH 4XCCL 3VDCA 3JYBA 1GMIA 3F7LA 3B83A 1FORL 1UH3A 4WI2A 3OKMA 3MHZA 1QHOA 3RWHA 1HINL 4GI9A 5I15L 4PQXA 3K1DA 4JFQA 5DWUH 4GNKB 2BFVH 5CEZL 4W1TA 3ALPA 3NEXA 3PWUB 4MD4A 2QSCH 3LAFA 3O6LH 4JFHD 5IMLB 3K91A 4KDWA 2FZ3A 4YDVB 1IU1A 2IIJA 5F6HI 5CEYA 3KWVA 2Q10A 3SOBH 1ZY9A 4O5LL 3VGAB 2CDFA 5I6NA 1ET5A 2C3HA 2A73B 3CFBA 2GIMA 4YXLH 2VTFA 3POHA 4R4ND 2W07B 2RHEA 3RNQA 4FKKA 3QA3B 4Y9EA 4X5WB 2EDDA 5I2IA 4FFTA 3TO2A 3LKOA 2EO1A 5DK3A 1M2VB 4YHPB 4GRLA 1E42A 5FUOL 1I4FA 4GH7B 3S34L 4NQTA 4K3DL 4Y4FD 1F18A 4Z7VB 4UIKL 2IO5A 4M93B 4LIQH 2A2QT 5EEWA 3HPJB 1G6RL 3PXHA 5BRQA 3PDOB 1LK3H 2PMZA 1R5VB 5KYUA 5T3ZL 4AG4L 5IR1B 1AHWB 1J1PH 1L0XA 4OZ4B 4S1DC 5DFTA 5CILH 4GKSA 5FO7A 4XP5L 3ULVL 3GLEA 1AP2A 4ZUSA 3P02A 5ITBH 4K71C 2VXQH 4ONGL 3RWDB 1M6UA 3ZRCC 2O1AA 4TF4A 5TGBA 4AEHH 2LU5A 3OKMB 2N59A 1AKPA 3KPMA 4UTAH 3CCHB 4NYLB 43C9B 4E0RA 1ID2A 3C2AL 3MLXL 5JOPE 4PJ5B 2VXUL 2Y7LA 3U4BL 4HAFA 3QIBD 3NJGA 1NFDF 4FQLL 4WNQB 4ILDA 2YKLH 1IV8A 4MA8H 4WU5B 1OP3H 3PU7A 4E9WA 2CDFB 4FCAA 4WO4D 2QMJA 3CFBB 4UQIM 3DXAD 1NOAA 1AR1D 2BIHA 3TFKC 5EUKA 4CC4A 4KZ0A 4TULH 1BAWA 5DT1L 3PHOA 1AGBB 5FKAA 4M00A 2R1XB 3TO2B 5GZNA 1MFAH 5CFHA 1RSYA 3L9BA 5C2BL 3L9RA 4KHTH 4AK2A 3ES6B 2QELA 5D9SB 4LXFA 2F15A 3G5XA 4JY5H 3LN9A 3MA7A 3T0EB 4B9CA 4YVNA 2A74C 1MPAH 2VN5A 5IT2L 1VIWA 2A1WL 1J8HA 3VRLE 1N9PA 4LSQH 4EUPA 3MJ7A 4G9FD 2FDBP 5GRWA 4YEEA 5FO7B 4BKTC 1H3WM 3Q2VA 1AP2B 3AU1B 4ORZC 4M7KH 3WHXA 1EHLH 2D7MA 5B1BB 1JPST 3QO1B 4GAYB 1LWJA 3ZRFC 4TVSa 3HZYA 4KH2A 3BDYL 4XPTL 4XXWA 5G55A 1CGSL 1PX3A 2VDMB 2Y5EA 1R3KA 2DEWX 2HYMA 3HG2A 2WKGA 4AIXA 2N7SA 5LCVA 1CGXA 2F1EA 5KVMC 3WMPA 2Q86A 4R8WH 1V3LA 4PGCA 1TJHH 5DUPL 3NUKA 3PNWA 5ISZD 4KKRA 2KS0A 4F80A 2YBRB 1A6VL 2AJZA 2XV3A 4MKMA 4YSRA 1FYTE 3ZUNC 1QG3A 2ZX7A 1EAQA 4LDOB 4B9PA 3VCLA 3FSOA 1KPRB 1T66C 1DZBA 1IC5H 3BD5A 3FCUB 1T3FA 2PPFA 3ZKNC 5EUKB 3BZEA 4RQQB 1P5UC 2X41A 4BFFA 2X6MA 1UWFA 1NEZB 1SF5A 2ZOOA 1RURH 1S7UA 4IBTA 1K3IA 1WS8A 4JR9H 1EJ6A 3BN3B 5CGYD 2E9IA 5T1DL 4J3OG 4V1DD 4NKDB 4PJHA 2YAHA 3MX0B 3G5XB 1B6UA 1AXIB 2NZ9C 2MWCA 3O3BA 4G9DA 1DEDA 5LGHL 3G9AB 2E4TA 2HLAA 1JD7A 2UY7B 3U46A 4N2CA 1J8HB 2AI0H 3AABA 3FQXA 2Z65C 3II3A 5C0FB 1H6FA 2AHIA 4EUPB 2RMNA 1OZUA 1FNSL 2E7CA 1ZS8A 3V0EA 1LGVA 2K8MA 1R19A 3RJQB 3FQTA 3JV5A 5IF0A 4F27A 2H0FA 4HS6A 2E0PA 4XO4A 3WHXB 3KVPA 2OMBA 2Q6WA 2ADJA 4Y4KA 1SUHA 2BNRD 1BXAA 3BPCA 1ZLSL 2VDQH 3EDEA 2PXYA 3BKYH 4A7SA 4ES8A 2J1XA 4ODVH 5FF6A 5JXAH 2OJEA 3PDGA 5I75C 3N42F 3UH8A 1TJGL 3ULUH 4PGCB 4R3SB 4I0KA 3PNWB 5HBBA 3V5HA 1QYGH 3VI3B 5JO5B 5C07E 3RYMA 3TNMB 4JFFB 2SEBB 1AYRA 3G3LA 3QDJE 4M5TA 3RY5A 1PZBA 5LWYL 4A2HA 1KJ2L 1HU8A 3F7QA 4YK4C 1E3FA 5A2BA 4BFOA 4XTRD 5T33H 3CZKA 1KB5H 3RBGA 3BZEB 3N1GC 2LABA 1NANH 1W6LA 4PY8J 3CZFB 1H3PL 1JPSL 4JFDB 3GHEL 2F54E 3WN5C 1ZHLB 3IJHB 3T9WA 2H45A 3M7OA 2ZWKA 4OLUL 5D7KD 1OM3L 1QWHA 3MRPB 4FNSA 1DBJL 1OSZA 4GW5A 4LASH 1S3KL 3U46B 1A8JH 3MODL 2OK0L 1SJXA 1L9MA 2E56A 1BMZA 4NN6B 1IQDA 4HJGA 3IJSB 1A6UH 4LPXA 4MGXA 3I85A 1CBJA 3WHE1 5KJ4A 5D1QD 3CD4A 2ADJB 2FIKA 4IKJA 4IRSA 5CGMA 4HG4K 2LV4A 4K2UL 4ZW8A 2W94A 1SYVB 4AKPA 3MRJA 2EE9A 2ESVA 4C58B 5JUEL 2VO8A 4WF7A 2ZG1A 4JN2A 5DDHB 3TLRA 2OJEB 4P2OB 1M3JA 3EFFA 4RGNC 3VD2A 4PWJA 1AZNA 2EDJA 3AC0A 4KKLD 4F92B 2NXYB 4K3HA 5CZKA 1JNNL 4AT6B 3QSKB 1UYWL 8FABA 5AB1A 2ZOTA 2A77H 4NZRH 4AZ8A 3EXLA 4N8PA 5FM5M 2ERJB 3HKZA 4I0PD 3AT8A 3IDMA 3IB4A 3KLHC 3EF7A 4GQRA 3HAEB 2EDFA 5DVMA 4CN1A 1B4JL 1DCLA 4JRXE 4F58H 2ETWA 3IJ7A 2IGFL 3CX5K 4BK5C 3OX8B 4D3CL 1VKXA 4TL5A 3STZA 2OTUA 1XSIA 4CBPA 4AZUA 4N85A 2ARJQ 3UP6A 2EDQA 1A7PH 4UQ9A 4G2AA 3T4AB 5JDSA 1OGAE 1IBFA 5JPMB 3EFOA 2WINA 5IREA 4WEUD 3CDGA 2QR0A 2O93L 4NAJA 1XX9C 5AWNL 1HHIA 4LLDB 1P6AB 4BIKA 2X4TB 1ZSHA 3H9SD 5I1GH 5EPMA 4I77L 4MDJA 1OSZB 2G3ZA 2WBWB 5EA0L 4Y4FB 5C0EB 1U8JA 3OLDA 5JPNA 4BA8A 5IKCB 2O6CA 4HJGB 3WXWL 5IVNA 4GSQA 3OPUA 4JJ5B 3O2WL 5G4NA 3MCYA 2V9QA 5FYJE 4M1CD 4RGOH 4PWEA 1ZT7A 1UD5A 4MB1A 1MUJA 5DQDH 4PS4H 4XMVA 4QY8A 1P84J 3IAQA 3LKPB 1A6TB 4JB9L 2ZXWB 3ZGIA 2AF2A 1KLFA 3GT6A 1JV5B 4Z7NE 5JIIA 4AIOA 4LARL 1JF1A 1XZWA 3QEGL 4F33B 1BQRA 1IGFH 1UA6H 4AZ8B 3IDMB 3WELA 4IBUA 3W9EB 2Z6FA 3VFTA 5BRZA 3VGAC 2KZWA 2D7QA 4KVPA 5D4JA 4CVUA 3X12A 3DGDA 4WGWB 3BLPX 4MNQA 2XWBA 4M4RB 2PYEE 3OXSA 4G8GB 4ZXBA 1AR1B 3REVA 2QQQA 2A6IA 4HZAA 1TTAA 4N90E 2DMCA 4F2MA 1DJZA 2O6EA 1PZCA 4LF3A 4OB5L 2B5IC 4YMPA 5LDUA 4HALA 1JPFA 2DQDH 1HHIB 2IMMA 5IJVB 5CSZA 2XWRA 3WIIL 2VC2B 3RZCA 1T0NB 5EPMB 3V10A 5E03A 1BYOA 1U8JB 2P48B 4YN3A 2P3YA 4K9EC 4A2EA 4ZZKA 3FTZA 3BZ4B 2PO6D 4NQEE 5JPNB 4OD3H 3C75A 5D2LE 5T1KD 4FZEL 5J7CC 1QO3A 1MCIA 1T22A 1NMAH 4G9FB 5CJQL 3WEOA 1BM3L 2WIMA 3RWFA 5JQIB 2OW6A 2CIIA 1NMCB 2DWYA 1ZT7B 2OCCB 1LD9B 3SPGA 6TAAA 2IDTA 1MUJB 3PPEA 1CR9H 4L1BA 1C5DB 1URZA 1TZHA 4S1RL 3RILA 1HCFX 2BOBB 5E51A 3HZKA 2G0LA 2N1TE 3QI9A 3DYMA 1B4TA 2DMKA 3PAYA 4U33A 2WSKA 5D6DA 4GQZA 1AI1L 4EIBA 1V27A 2QQLL 2KMWA 3EH5B 3QHZH 4X6CF 4Y16D 1JP5A 1M6OA 3QEQA 3CZEA 4Y19D 4MB5A 5EULV 4X6BA 5ISZB 2AK4A 3KH4A 2BM3A 2O4EA 4DKDC 4WSJA 3H3PL 5AB0A 3RTQA 3MV9E 2FATL 2BP8B 1NC2A 3ULVF 3OSVA 3VFTB 3FHQA 4PJAA 4O02L 2VW7A 1JZ4A 4YBLC 4NCDA 1N0LA 2H1PL 1WZLA 2QKIB 2DQJH 1D5IH 2A6IB 3GSRA 4P3WA 2O61A 5HJ3B 3D2TA 3WYRA 3TO4D 5DUML 4GRLC 2PR9A 4WRLA 3TJHC 3VXSE 1RUQH 4W9JC 4YDLB 1K5NB 5CSZB 3SBRA 2CCVA 3OAUH 3G6AB 2MQGA 3LB6D 4F5CA 5GS2H 4YE4H 2JV6A 3HLKA 5CS7A 1I9IL 3EO9L 4KX7A 4P5TD 3B9KA 2QVKA 3BGMA 4L9DA 3E6HB 4OZGE 4Z7WA 5GRUH 1XR9B 3MRLA 4KKAD 5EMYA 2YD1A 1OTUC 3HEIB 5H94B 3RWFB 5F93C 1IM3D 2CIIB 3GQFA 4Y9BA 2FYYA 2UXVA 4HK3J 2J12B 1DJSA 1RZKL 3CLEL 1PGRB 1A6ZA 3D3VD 3PGFL 1TZHB 2BNRB 4HIIB 3H4HA 4KI5C 4U1GB 4Q0XH 3HZKB 4N8CL 5DA0B 5FLUA 2HMID 1CPUA 1E4JA 1L9TA 3L4XA 4Z3EA 5CD3B 3APNA 5CEXA 5E70A 1BVOA 1IEAA 4K7PY 2VZSA 4HHAB 3QEQB 3TFBA 4G8FB 2AK4B 5KANI 2A6KB 2EH8H 4HSAC 3GBDA 1IGJA 4HBQA 3QWRD 3U4AA 5KANG 3HB3D 4RAHA 3GMNB 3KYOB 1UOVA 1R9FA 1KXQA 1N0LB 1YECH 2ICWI 4CC4C 1UZ8A 1FJ1B 3GMOB 3RVTC 3DTDA 2EIKB 1D6EA 4JQXA 1PG7H 2O61B 5GZNC 4JBSA 5J57B 4WY7L 3A6CL 4TPRH 1U91A 3WEBA 3PQYD 3WO4C 5JHDE 1NGPL 1ID5I 4TNFA 4CAGA 1Q72L 1ZHBA 3KDPB 3DOIA 2HVJA 3CXFA 2GYSA 4U1NB 3K6SA 1E6JH 3JBG7 5ILTL 1KGUA 2ZX8A 3EGDB 1PX4A 4QRAA 4JMNA 3A6OA 3LZFL 4Y5XB 4XMPL 1PX8A 3IJ8A 2RH0A 5F7AA 1S5IH 1YEHL 3FT3A 3LMJH 4LSUL 4MCYB 1EZSA 5TE4H 5D1QB 4IRJD 4TSBH 2VE6A 4WHTA 3RNKB 2VZ3A 1BZDA 4P2QA 2E59A 4XXWC 4ZUWA 2EUWA 2OQJB 5J8OA 1BOGB 4UQ3B 4JPKH 4ZTOL 2C5DC 3N44F 1QFWI 3FCSB 1J1XH 5HYJA 2AKRA 3V4VH 1RCYA 3V0DA 3LZOA 1IGJB 2LTQC 1Z9OA 2DM2A 4KXCA 5DQJB 3VXUA 3M46A 4Z7WF 3MREB 1UWGH 2ICCA 3D09A 4K5PA 2GHZA 4I0PB 4WU7A 4W9FC 2V0AA 4LLAA 5T8IA 3AQDA 1NBVH 5C0ND 2W0FA 1G1KA 3B4NA 4PB0L 1BV8A 2GY5A 2FQGA 4ZPTA 3L4ZA 1IB5A 1IUZA 1JAEA 4Z9KB 1KELL 1CZ8H 1BFSA 1YO4A 3BWUC 2P5WE 3MRDB 3S3JA 2QQKH 3V0HA 3BAXA 3H1ZA 4ZW7A 4WI8A 3APDA 3I6SA 1IJ9A 4NZJA 1MLCB 4XN2A 4AEIH 3GJFA 2J88H 5LG1A 2FEEI 1I1CA 3OPZH 5IOPA 4DWHA 2XG5B 3H9SB 2RJMA 5CWSA 3TWCH 3TZVA 5H37A 5EEVA 4GT7A 1I1AD 1FORH 2AW2A 5I8EB 4GSXA 5CCKH 3FN3A 2WAQA 1HINH 4LFHD 1ZEAL 2E27L 5I15H 4PLJD 4KC3B 2D03L 3FT3B 1XL6A 2K9FB 1YY9D 1DSYA 3IPFA 5I74C 5CEZH 1RLWA 5KWYC 2A9CA 1X7QB 2XWTB 1XGUA 3A4FA 4KMTL 3FQWB 1S7WB 4Y4KC 2BH0A 3ZHDA 5FW6A 3VYNA 4PRNA 2CO4A 2IBZX 4WHTB 1K8IA 5E0QA 4YSQA 4Z76A 4DUVA 2FGZA 2VDOB 4ZUWB 1BOYA 1ET8A 2PXYC 4O5LH 3CSYB 5B4MC 4KQ4L 3U6RB 5FOBA 3G5YB 5AYQA 4NUMA 5HYJB 2AKRB 4YSOA 1PD1A 4M1GH 3BC9A 2FSEA 1MXGA 1F4WL 3NN8B 2OYLA 5ENWA 4NKQB 3LZQA 3BHBA 4U2ZA 2ERJC 2YAMA 5EU7C 2XKUA 4BWUA 2EE3A 4FG2A 5FUOH 3S34H 1QBML 3D9AL 4K3DH 4PJDF 5ETUA 1N5YL 4IYKA 3BQVA 3JWDC 4UIKH 1X9LA 4MLIA 2GC4C 1G6RH 5CN3A 4FD0A 4NQDA 3EH2A 5DZJA 1S9VB 5EBLA 5EHFA 2P1YA 5AVUB 1AC0A 1I1YB 2X4PA 1L0PA 5T3ZH 1USQA 4FQ2L 2GJJA 4NKMA 1V7NL 1D5MB 4XP5H 4XB3A 3ULVH 4XP1L 1YRKA 4ONGH 3B2UC 1RH8A 3MLWH 2DKSA 3GJFB 4I3GA 2WTRB 4BBWA 1KIUB 3VU1A 3QXUA 5F71A 4M8QA 3TZVB 3S5LG 1PKQE 1RZGB 1SF3A 5AOIA 1OAKH 5JOEA 1LWHA 2PO6B 1WZ1L 2PPEA 3U9UB 1ZGLB 1VADA 4GFTB 4J3OF 4HJ1A 5T1KB 3S4SG 4AY0A 3B3BA 4HX1B 2BP0A 3MLXH 3WGUB 2Z8WC 1QWUA 1M7DA 1NPJA 5DRNA 5HHXL 4IRSC 3W39A 3U4BH 4PRNB 5ESAA 1R3IL 4Z76B 3EYQC 4JFVA 2VQ1B 3QH3A 4FQLH 2C1OB 4P2AA 4PRBA 3O45A 4M6ML 1F1AA 2EVGA 1FLTX 5K39B 5BZXA 3O6FA 3THML 3KM1A 4F9PA 1BZ7A 4A7GA 3ARED 4AYSA 2OMTA 2B1HL 5DT1H 4M03A 3B56A 4Y16B 3GBNL 4QTIH 3FK3A 4Y19B 1K4DA 3DBXA 5EZIL 1ECZA 1P0SE 2FEJA 2HG0A 1UFGA 3WUWB 5IBLC 4OCNC 1IEHA 5T5FA 2XY2A 4DW2L 5C2BH 2MQ0A 1QBAA 4BZ1L 3LXUX 4LCCB 3RWEA 3EJRA 4JFXB 5ETUB 3ME0A 3IBOA 5FW8A 2IDSA 3KJ4B 3ESPA 4LP4A 2C9SA 2ZOKA 1UA3A 3FT4A 5HHMD 2A1WH 2NY0D 3OJ2C 3SD5A 3EJQA 4NQDB 2WNWA 2PWGA 5HYSA 3U1QA 5H4YA 2JCCF 2C3VA 3EBIA 4DOHE 1RU9L 2J2ZB 4WWOA 1N2RA 3F58L 4KKCD 5SWZE 4KDTA 2JIXA 4N0CD 3DKHA 2IWGA 1GGYA 2X38A 2CHZA 4FP8L 2CJSA 2BSBA 3VRIA 3BDYH 4XPTH 4N0RA 1CGSH 2EICA 1SFHA 1EK3A 4GQPH 4EXKA 5KYWA 4P5TB 4MAUL 2WXQA 3ULVC 1IAOA 1TIUA 5KJ7E 2O6DA 4KOBA 3IMBA 4NXSA 3P3YA 5DUPH 2BP0B 1NMCC 4F7CB 1IM3B 5DRNB 1A6VH 4C8XA 4DETA 4LLQB 2UXGA 1OAUL 1EMTL 2HZHA 2K78A 3DUUA 4PRBB 1FE8L 2BSRA 2UXFA 1J9TA 1UFUA 3O6FB 3BT2L 1KGCD 1P1ZA 4MQXC 1IRAY 4IHBA 5D5MA 1CMOA 2D3VA 5H4ZA 1BQKA 4DN3L 1H0DA 2DWDB 5I16B 2WKOA 4Z7QB 5BS0D 5ANME 1A9EA 2WWKT 4LL1A 4ZSOA 1EEZA 1XVSA 5T1DH 1BIHA 5GS3A 1ZAGA 3RWEB 4HAGA 1LE5B 3WI9A 3ME0B 3BP6A 5L2KA 4U6XB 2VCOA 5LGHH 4ZXBC 4G80B 2XIBA 5EF1A 1JGVL 1RFDL 3ESNA 4P23A 1BBJA 3JQOB 3B9AA 1FNSH 2C3VB 4B6ZA 2XFXB 1MCPL 1PQZB 1AJ7L 1X5GA 5D7EA 4M9OA 3ZDZE 5C6WH 1VGEL 3F3HA 1W8NA 4GKNB 3PQYB 3U7YL 3HR5A 1TDQA 4I1NB 3RZCC 2EP6A 4PI0A 1WH0A 1H8LA 2H6PA 2WN3A 5KYWB 1NL0L 4RFNC 3VXME 3G6JA 3SKNA 3BAKA 4AENA 2C7FA 4N9GA 1TJGH 1DVFD 4HIQA 4OV6F 1BXXA 3TA3D 4X7SH 2XKNB 5D1XE 1JZ7A 1QTYT 5D2NE 4DO6A 4X8JA 1GOGA 4Z78A 2W5PA 4IRJB 1PDKA 5LWYH 4XE5B 1KFGA 2X7LB 3EO1A 3QI9C 2G5BB 4FXKB 1KJ2H 4KK5C 5D6DC 2DWEA 4QUOA 4S0TD 2FX9L 3QQ3A 2BHYA 5AW2B 1E9OB 3C5SA 5IVXB 1H3PH 2D31A 1F2XK 4GSDH 3RTQC 4U6TA 5K9OB 5HVWA 1KCSL 3C9NA 2AV7A 4OLUH 4WFEE 1OM3H 1P7QA 3ZKQD 5JQ6H 2ZUWA 4MA1C 4DQAA 4F8PA 3P2BA 3S3CB 1S3KH 2OK0H 3MODH 4Q4EA 2X6BA 3VE0A 4RH4A 5CJBA 4AYMC 3N1FC 4OI8A 3BO8A 4OD2A 4C59B 2FT7A 2CGRL 4OLYH 3QISA 2X12A 4HIJB 4L4TA 3HR5B 4F7EA 2V5MA 1GC1H 1UJTA 1X5JA 3PFUA 4HKBA 4F1ZA 1IGTA 4ZUUA 3LRSA 1LWRA 2D9QB 4K2UH 2ZSVA 4UNUA 3B9KC 4FNRA 2H6PB 3LZRA 5JUEH 1T4WA 2BC4B 2OYMA 4U2YA 4AENB 1ZRUA 3HRZA 4ZPVA 3Q2LA 2CD0A 3US9A 3V6FB 2QL1A 4NOBA 1I1RA 5C0AD 4ZOBA 1JNNH 1KCKA 4GBXC 1UYWH 2IV9A 4PJGA 4QF1A 4F8TA 1YAIA 4H2AA 5CINL 5FO8B 4X8JB 4KNQA 1MJJA 3B2DC 5GS0D 1PDKB 1ZK9A 1R5WA 1S78C 4I18B 1FC2D 1J48A 4N5UA 3S8WA 1BPVA 5CSGA 1B4JH 2DWEB 1BF2A 1EBPA 5CJOL 2WZ6A 3FONA 5HYFA 2IGFH 2BPBA 2W91A 5IK3B 4L4VD 4NDMB 5KS9E 5JA8B 2R0LL 2P5PA 2AQNA 1J9QA 2WK2A 3B37A 4IRZL 5F70A 3L4YA 4AQAB 4HGWA 2R59A 4NT6B 5AWNH 5IV2B 1IC1A 3DTXA 1A2YA 3RL1A 3VH8A 4PJXB 1VFMA 2ZOWA 4OCWL 4I77H 3H85A 1QHPA 1XF5B 4IIQA 1O7VA 4HFWB 5CD5D 4JQXC 2WBXA 5H37H 3WXWH 2XPYA 3ZSSA 3X3GL 3SDXB 3ZDXB 3ASOB 3WDHA 2X87A 4NX0A 4L8SB 2AITA 3MOBL 2JB6B 4L4TB 2APXA 4HKBB 2WGXA 4K07A 3SD2A 2YPVL 1QWNA 4XC3H 3B6SA 1JXKA 4X4MA 2OTWB 1YVLA 1XMWA 4FFWC 2CA4A 1OP5K 4JB9H 3BXNA 3B7SA 5AKSA 4RVBA 4ISVA 5JIQA 1S7RB 5EUOB 4WTXA 4M7JL 2IPUK 4ZPVB 3T09A 1GC1C 4NEHB 5C09D 3QEGH 2WZ5A 4ZW6A 1PF3A 3MRHB 4QF1B 4PIRF 2PCYA 4HXAL 1CFVL 4K5NA 1BYNA 1NEZG 3LRHA 4FFYL 2DQGL 3WLWC 5BQ7A 2A0LD 5B7EA 3ECQA 3QFDA 1TPXB 4JVPA 5CU5A 5LUMA 3ZE0B 1AG0A 1IZKA 2J21A 2APWA 1IQWL 3AREB 4ODUA 5IZ7A 3DROB 3A22A 1MZZA 3SQRA 4KGLA 4OB5H 1MCKA 1WBYA 1VZIA 3VFRA 1CURA 1NWPA 2DQMA 3LN4A 5E4AA 5B3JF 1E28A 2PPDA 3MRRA 1LO4L 3VH8B 4G5AA 1XR8A 3WIIH 2HPTA 3LNHA 2E86A 2JI2A 4UQ2B 2EDTA 4IIQB 5HHMB 4KZEL 3KYKL 1TENA 4XWGL 5SWSD 1BAFH 3MLVL 3IM1A 3WG7B 1RUPL 3ARRA 1LEGA 1E2WA 2Y3AA 4FZEH 4M6OH 5CJQH 3TNNA 2FJGB 1BM3H 3WNLA 5ES4B 3P4NA 2ARJA 1J0ZA 1OSEA 1QR1A 1FYHB 1ZIBA 3HZMA 3PUCA 2H3KA 3PRZA 4PJFA 3AT0A 3GSNA 4S1RH 3ASWA 1B0IA 1P4IL 2J3SA 2K45A 3BP7B 3D5OF 4WFHD 3TZVC 1TQBB 5D96C 3KYNA 4ISVB 2HG5A 4HWNA 1B0GA 5C9JB 1P6WA 5E2JA 1CS6A 2QQLH 3VGFA 1MFUA 2YPLA 4FTVD 3K80A 3KPOA 5DHVH 5FGBA 1E30A 4X83A 4Y9CA 1V05A 2H9GB 1E65A 1EGJL 2NY4B 3GRGA 4JFED 2WO2B 2FATH 3TU6A 1H8SA 1ONQA 3L5HA 5BQ7B 2B4CH 4LCWD 4N3TA 5FHAL 4FE9A 4O02H 4R2GC 5FEBA 2AXHA 3IDIB 5HDBB 3QUZA 2H1PH 5F7FA 3IETA 1HWWA 2WBJD 3EYVB 1IBGL 4I8DA 3U9PL 3C6EA 2L0DA 5CIPA 2WIIB 2H2PD 2K70A 3DMMA 4F9LA 1G7MA 5DUMH 1C7SA 3PWLA 4EQ3A 3VFRB 4PJ7E 3LN4B 2NSMA 3P40A 2OJ1A 3IMTA 1JK9A 3H3KA 3STLB 2VDML 4PI2A 2YHGA 4AVHA 4Z5RB 4I2XB 2EXWC 4UQCA 5TJWK 1I9IH 3C5XA 3EO9H 4JRYD 4DGVL 1CF1A 1QSFA 2YQ3A 2VWEE 2ZXGA 2IH9A 3PABA 5FCSH 3TNNB 3ESMA 1K9TA 3EG9A 2DKMA 3CLEH 3FQRA 3PGFH 2GSIA 4MX7A 1OOAA 1F97A 5FGSA 2ZAHA 3NP3A 4N8CH 5I30L 1JBJA 1OTTD 4QTHA 4U3CA 3PWNB 1KLUA 2HG5B 3R4RA 4LAJH 3QUMA 3HAEG 3RBSA 1DVFB 4LEXL 4WW2B 3TA3B 4FZ8L 1I8KB 5JW5B 3OB8A 3RKDD 2YGQA 3CX5J 3VFGH 1ED3B 1W72A 3O6FC 4KV5E 4G7SB 4F9PC 4W9EC 3ZL1A 3ZJAA 5SX5K 3ARGD 3L5IA 3IETB 2YRBA 4FGMA 4NLHA 4U7MA 4JM0A 1JNJA 3NJNA 4PP1D 4S1SL 1QVOA 4WW1A 2LLLA 2VW4A 2A9BA 2JQZA 2B4CC 3A6CH 4BSJA 3D34A 4IDLA 3QHFL 2DWXA 4OGXL 9PCYA 3JT2A 4LHUA 1WAAF 2QTEA 4OLZL 1O9VA 3HOGA 4DQOH 1Q72H 3LQAL 1OAQL 2C9AA 3BIKA 2CUAA 2AXGA 2G60H 1HHHA 5ILTH 4F15C 1QSFB 3OZ9L 4KVNL 5E9AA 1C8PA 3LZFH 4XMPH 1H9DA 4U6HB 1WT5A 3BE1L 1YEHH 3PJNA 1OE2A 3QDGA 4LSUH 4P3CL 1DQVA 3MRIB 4KDTC 2DQTL 2J8HA 3KPTA 2NY6D 5EEUA 2CK0H 4YS4A 3EG9B 4N2OA 2FBJL 4LCIH 5L88L 4ODHH 4KJYA 3SYOA 3BIAX 4P5MA 4OCYL 3ZR5A 4H25A 4IJ3B 1F6AB 1NDTA 1NUGA 4N2GA 3L7EB 4R4FL 4ZX3A 2AJXL 3T3MF 2XX0A 3CDZB 3QUMB 1WA2X 2YIHA 5C0AB 3QXWA 1D6VL 1FO0A 5KYXA 3MSPA 4M43L 1D5ZB 1KTCA 2BCKB 3RL2B 4M56A 1JERA 3L1OL 3QJTB 1NPNA 2OM5A 3MKKA 4U49A 3WS6A 1KEGL 3HG5A 3PHAA 5D7LD 4PB0H 2X9YA 5DD1L 5IUCA 2JI1A 3KVDD 2CPUA 3WEAA 3ZDWA 1SY6A 1HN1A 1QVOB 4Z95L 1GKEA 2R0ZL 1U8LB 4JW3A 5K93A 1QFWL 4EOWL 4O4YL 4AIEA 6PAZA 1IZJA 4KRNA 4LHUB 2GJPA 1CGUA 1HJBC 1IAII 2ZKHL 3H53A 3FTYA 5B1AB 1K72A 4ZX5A 3WKML 4P23C 1F45A 4QPEA 2WMPA 1WTGT 5M95B 1ZEAH 2E27H 2D03H 4U1SB 3QDGB 3D4CA 1SBSL 3I74A 1VLXA 2BSED 1KCWA 1E8ZA 4KMTH 4LCUA 2GQHA 1RJZA 2AJ3A 2HN7A 2YUZA 4YO0A 4ZUVA 5GRVK 4QRRE 3HS0C 4KJYB 4WENB 4IOSD 2C9VA 4H25B 5CJ8A 4KQ4H 4RMBA 1JD9A 3WIHL 1XEUA 2BIQA 2FEEL 2IBBA 4FNUA 2WVVB 5TF1L 3RWGA 4CL7A 2NX5D 4JFTA 5ID1A 1F4WH 1CGTA 1YPZE 3KWTA 1FO0B 4LQ1A 2WWKO 5C0DA 3WFBL 5KBKA 4RX4A 2QADD 1E4HA 3PCYA 4P57A 4NCC1 1QBMH 3D9AH 3BD3A 4D8OA 3VG9B 2NCMA 4W81A 4PBXA 1AQ8A 4G1EB 3Q1EA 1AIZA 1XEDA 4N68A 5E24E 3ZUCA 5FYKD 2DDQL 4BQCA 2WQWA 2PP8A 4FQ2H 3F7YB 3BN9C 4MTMA 4UT9A 1PD0A 3PP3K 4XP1H 5C1MB 2WVUA 1N19A 2Q0ZX 2WZAA 2V2XA 4WUKH 4BFIA 3NA9L 5AYUL 1E50A 3L3IA 4PJEF 3HG1E 5DHYA 5EEXA 1GJIA 3BPNB 3EF4A 4P59H 1NZRA 1PD6A 4UYPA 1X5KA 2OKMA 4NNXA 2DD8L 2OPCA 4G59C 4JUSA 4J4PA 4M5ZH 4YQXH 1WZ1H 5TE6L 3PWPE 1QRKA 3ARXA 2CJUL 3UXFA 1KENL 4F2EA 2NY3D 1DUZA 3QEUA 4L05A 1KPVB 2OYPA 3OBAA 3UZQA 4AMWA 5HHXH 3JUZA 2AJ3B 4MYPA 5K69A 1CICA 4YO0B 4ZUVB 1G0DA 4ZTPH 2I9TA 5ICXB 4M6MH 4F7PA 3QK0A 1FNGB 4FA6A 3NACL 1GHFL 2YWZA 3THMH 3EFDL 3BFWA 3HRZC 2XVGA 4P5RA 4DP9X 4IQHA 3WNOA 2MHAA 1KTJA 3GBNH 1UXMA 4FTVB 2E8YA 3AT9A 2MKLC 5KSBE 3CAFA 5C0DB 3AY2A 1CDGA 2X09A 5H2BB 4DW2H 2VC2L 4BZ1H 4JFEB 3IMSA 4NERA 4P57B 3EJYC 3MJ8B 5KSAD 1U6AL 2VB5A 4LCWB 1RERA 3NESA 3SDAC 1UC6A 1XGRB 2OCFD 2YKKA 1BQHA 1R34A 3MRKB 1IAKA 1SM3L 1HIMH 3ATFA 3FB6B 1JOIA 5F1NA 1T1ZA 3Q01A 2KQMA 2WBJB 2SODB 4E9RA 5SX4I 3S37X 3F58H 3EUUA 4CILA 3VUAA 1FFPB 1L5GA 1HKFA 1YN6B 4BFIB 1YEJL 2K6ZA 1G0YR 5F8QC 4FP8H 4XNQA 4OJCA 4IIQC 2EYSB 4FRWA 3FU7B 5CLZA 3LJ3A 4JRYB 1Z9PA 2V33A 3Q5OA 3QUGA 3ARBD 3QWOA 2OR9L 4LAQH 2ITCB 1DUZB 1BG9A 1DQLL 5E4EC 3KXFE 3DJRA 5BCAA 1CICB 3RDTA 3FCTB 4XBPA 2J56A 4OI9A 3ATEA