2AQQA

Cu/zn superoxid dismutate from neisseria meningitidis k91e mutant
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
155
structure length
155
Chain Sequence
ASIEVKVQQLDPVNGNKDVGTVTITESNYGLVFTPDLQGLSEGLHGFHIHENPSCEPKEEEGKLTAGLGAGGHWDPKGAKQHGYPWQDDAHLGDLPALTVLHDGTATNPVLAPRLKHLDDVRGHSIMIHTGGDNHSDHPAPLGGGGPRMACGVIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase [Cu-Zn]
publication title CU/ZN superoxid dismutate from neisseria meningitidis K91E mutant
rcsb
source organism Neisseria meningitidis
molecule tags Oxidoreductase
total genus 36
structure length 155
sequence length 155
chains with identical sequence B, C
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2005-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 2aqqA00
3ECUA 3ECVA 1KMGA 3L9YA 2WZ5A 4B3EA 2JLPA 1HL4A 2Z7WA 2K4WA 1L3NA 1IBFA 2SODB 1OEZW 2ZKXA 1F1AA 1YAZA 2XJLA 1E9OB 2AQTA 1PTZA 1Z9NA 1RK7A 4OJAA 2Z7YA 1BA9A 3KM1A 1E9QB 1UXLA 2Z7UA 1PU0A 2Z7ZA 3GZOA 2JCWA 1JCVA 3CQQA 1DO5A 2V0AA 2C9VA 1TO5A 2WKOA 4A7GA 2WYZA 2VR8A 1OAJA 1E9OA 3MKGA 1F18A 4N3TA 2AEOA 3QQDB 2GBTA 1E9QA 2VR7A 3GQFA 1EJ8A 1SRDA 2E47A 1BZOA 1SXAA 5CU9A 2VR6A 4FF9A 3LTVA 1ESOA 1S4IA 1XTMA 1CBJA 2WWNA 2Q2LA 3ECWA 4U4IA 1IB5A 3HW7A 1N18A 1OZTG 1P1VA 3GZQA 1AZVA 3HFFA 1SXSA 2C9UA 1F1GA 1SDYA 3L9EA 3QQDA 1E9PB 1SPDA 1XSOA 2C9SA 3KH3A 3KBFA 1B4LA 2XJKA 2ZKWA 1B4TA 3GTVA 1XTLA 3SODB 1N19A 1COBA 1SXBA 1UXMA 1JK9B 3RE0A 3CE1A 1SXZA 2APSA 3KBEA 2AQNA 1HL5A 2R27A 2NNXA 3MNDA 4A7UA 5KBMA 1E9PA 3KH4A 3S0PA 4BCYA 1SOSA 3CQPA 2AQSA 4MCNA 4A7VA 4BD4A 3K91A 4L05A 3F7LA 1Z9PA 2GBUA 1SDAB 4A7TA 3T5WA 1JK9A 3KM2A 1IBDA 2ZOWA 1EQWA 1F1DA 4A7SA 5KBKA 1YAIA 2WYTA 3GTTA 2AF2A 2E46A 1SXCA 2GBVA 1FUNA 2AQQA 2ZKYA 2WZ0A 1PZSA 2WKOF 4A7GF 1TO4A 3F7KA 1U3NA 4MCMA 4N3UA 2AQRA 4BCZA 1Q0EA 2AQPA 3GZPA 2WZ6A 3HOGA 3H2QA 1OALA 1YSOA 5KBLA 1CB4A 1OZUA 3PU7A 1QUPA 1DSWA 1IBHA 1SXNA 4OH2A 2WWOA 1MFMA 3H2PA 4A7QA 1IBBA 2LU5A
chains in the Genus database with same CATH superfamily
35C8H 1LNUA 2CRZA 3FCUB 1U8OA 5DEGA 3B7SA 2HVKB 4PWGA 2DEXX 4BZ1A 4OQTA 2J43A 3NH7H 1DZBA 3ARBC 3VXNA 3FCTA 3GIVB 4ZUTA 3EDKA 1HXKA 2GAZB 2X2HA 3ARGD 3BP4B 4Y9CA 5ERWB 4LP4A 3R4RA 4U3SA 2FWLB 1SJEA 5C1MB 3NCJH 5FHBL 3WIHA 3LEVH 3MJ9L 3QZWB 2H32A 1G84A 3NJKA 1R5IB 5LGYA 3PABB 3QDME 3BVXA 4PS4L 4G6JL 2N3JA 1QSEB 3X1FA 4JZJB 2JIXA 3NPSB 1KIPA 1NEZG 1TQSA 4L18A 4H88H 4Y1AB 5IVXB 3SDAB 4UQIM 3NAAH 3PGFL 4P23A 1U3ZA 4E41E 5HYSA 4Z0BL 1R3JB 1S5IL 4JQVC 3SOBH 1KJ2L 3VYOA 1CF1A 1XGTB 4LEOA 2JKNA 3KNBA 1KCWA 1CLVA 4KO9A 1M42A 3T4AA 3BAWA 5BV7C 4TVUA 4WU7A 4QTIH 2EH8H 4DCQA 2PR4L 4MXQC 1YHPA 3EOBB 1FC2D 1U91B 2L7EA 1MJ7L 3CZUB 1ZGLB 5B39A 4ES9A 4GAJH 1OCRB 4E5XG 1OAXL 1JZHA 2KZWA 2ZUQC 3RL2B 3MJ7B 2V9RA 2IANA 2MJWA 2OLDA 5I5RA 3K5RA 4OZHF 1P7QD 4HUWB 1FJ1B 5I8EB 5L8JB 4DN4H 3GMNA 3THML 5GIRA 1IKFL 1T21A 3V0WL 4U1KA 3W9DB 2FHFA 4EZLA 5EBLB 4TQEL 2CLZA 1WRFA 2CKBB 4P2QB 1OE3A 3T0AA 5JPMA 1WZKA 4YLCA 3HG2A 3I6KB 3D25A 2WWMD 3GK8H 4X7TB 5IOPA 5DS8B 1T7XA 3CVHA 4R26L 3VFUB 1ZS2A 3HUJB 2EVIA 3NK4A 1OCZB 1XSJA 2A77L 2K1MA 3HB3B 3V8CA 1CG9A 2YK1L 3MLWL 4QXGL 5CN2A 3WDJA 4ELMB 4Y16C 4EVNA 5C9JB 4I0KA 4U6YB 1HX0A 1RIVH 2WUCH 3VFNB 4NP4L 3PHOB 4LQFL 2NXYC 1NEPA 2DI9A 2Y7LA 3CDZB 2HT3C 1S5HB 5J57B 1J0JA 4S2SA 5C9KA 2FEEL 2YXWA 1VFAB 2WWOA 3VMOA 5D2NB 2XV2A 3IF1A 3I6GA 3HZYA 3W5MA 4ENZA 1LK2B 4P46B 4Y19E 1QD0A 1OK8A 1XD0A 2GJPA 2WZ5A 4NXSA 3V52H 4YSUA 3WTTA 4UM8A 1HCYA 2AJZA 1OGSA 4HSQA 3BAIA 3MV7B 3RFZC 1XF4A 3K74B 2F7IA 4MJ5A 1U41A 2EDTA 3TESA 2JFCA 2JI2A 3NJGA 1OD9A 3PWPB 4ZW7A 5A2FA 1QFWL 3KE0A 4TVPL 5F72S 4ZMXA 5K9JH 1E9OB 2RCSH 3FQWB 4UAOB 2X4PB 4XT1C 1J1OH 1PPIA 2JB5L 1R3IL 4ODVH 3T9WA 4X9GA 2OJZH 4DKTA 2ERJB 2EEBA 1KXTA 1HCFX 3C75A 3IXAA 4KKCC 4X6BB 2H3XC 2CO3A 4GXUN 1MNNA 1NGPL 2HUHA 3B6SB 2VMEA 4KFMA 4OCLC 3RZCC 2A1WH 5JA9A 4PJCB 2DEYX 4AW4A 3S37H 2ERJC 3C5ZB 2C3VB 3DX3A 3MNWB 4BQ6A 2CDFA 3MOBH 4H1LA 2G60L 2WWNA 2UWEE 1KN4H 3D4CA 4G70B 5EEUA 5JO5A 2GITA 1KOAA 2GJZA 4JFFB 4PAZA 3BW9B 3KYMA 2BVTA 3PFUA 2ZWKA 4KOCA 4AQEA 4IHOA 3DA0A 3LH9A 1KULA 4P3DA 2I9TB 3TJHC 4TVPE 5GSVA 3EGSB 4AKQA 1QI4A 3G08A 4UOQA 4NM4L 3UBXB 5FO8B 4JO4L 3RPBA 3ZYIA 3QJOA 3LRKA 2M26A 2OL3L 4KDWA 2C3XA 3K6SB 5IEKA 1OY3B 4ZUVA 2OTUB 5TF1H 3GXPA 3SKMB 3WNLA 5IB4A 5DQ9B 3L4UA 1KTDB 1UWXH 4MB1A 5E51A 1SYVB 1NMAH 5I1IL 3HZVB 2R1WB 1HU8A 1G6VK 1ZTXH 4Z7VE 2NNFA 1FVCA 3OKEB 1I1CA 2AVGA 4UDUB 3X11A 2HB0A 4WHYH 2Q10A 4HQQL 5F7EL 1MVUB 4MWFB 5K1VA 3TH3T 3C2AH 5BRPA 2ZPKH 4OY9A 3UYPB 1EBPA 3HG0A 5FFLA 3B3IB 3WFEH 1JOIA 3QCVL 3QNXA 4C57C 3MLZH 2OW6A 3PHQB 1E8ZA 4FABL 4ZOEA 1MIEH 3MRIB 3OAUL 1T83A 4B9JA 1ADQL 5LWYH 3RTQA 3ABKB 4MRBA 1UCTA 5FECB 1U3YA 1XGPB 5ILTH 3ZSSA 4Y4HA 4Z7WA 3GSWB 5M95B 5AW0B 3ZZQA 2VN6A 1EAQA 2ZF8A 1E7VA 1P2CA 2NYZA 3SE9L 4X8CA 1SVBA 3S5LA 1OSYA 3BEWA 1IM3D 3ARFB 1KBGL 2DLFH 4XXWC 1NFDA 5GRUL 3O3BA 3WMQA 3V4PL 3HNTL 1JV5A 5M94B 5CUSL 4IRZA 2Q8AH 2QELA 3FTVA 1BQKA 3RVWC 2W0PA 1NSNL 4JFZL 3N9GH 4AXWA 1D5XA 4UMGA 4XMUA 5BRQA 2O5ZL 3UL4A 1V3LA 3Q9PA 3RBGA 4IU2B 2P5EB 5D7IE 2A0LC 4CAGA 3R18A 4PJFB 2WYIA 4JM2D 3ZO0A 5FGSA 4ELDA 1JPFA 5FYKD 4PJXB 1S46A 1G7JB 3GPEA 1WBZB 3MGTA 2EUVA 1WIOA 2NR6A 1UUNA 5E94B 1B2WH 1DVUA 3S9DB 5D6DC 3IJ9A 4G7VL 1X6NA 4PUBL 4XBPA 2BY1A 3O4OB 4KVNL 3L7FB 2BWDA 1YEEL 2Q2LA 1T04A 3OAYK 1B4JH 4NQVA 2K9UA 3S5ZA 4K15A 1OT2A 2GI7A 4FS0A 3VXSE 1UEYA 1HWGB 4FQ1L 3S4SG 1B4LA 2SEBB 4QIRA 2ENYA 3GLEA 5DGQA 3RY6C 2CZNA 2K6ZA 4GSRA 3SHSA 2DQDH 3SOTA 4YXLH 4OZIB 2VLKD 4NWTL 1AY1L 1EEZA 1OTUC 2PO6B 5MP6L 2UXFA 3UEQA 3RFRA 3P4MA 5JHDE 1QABA 4M93B 3RYMA 4X5WB 4X7CC 1A4KA 3RB5A 2O26U 4A7TA 4XP6L 1JF1B 3H9YA 1RV6X 4Y5XA 4ES8A 2PO6C 4BGDA 3LQMA 1BZ8A 3WXVL 4QTFA 4DKAA 4OLYL 1EDHA 4NZUH 1SJHA 3GBNL 4M93C 4E9TA 2HRLA 3RTQD 1S3KH 1HINL 1C08A 3X3FL 2K78A 4HMDA 4RDQG 4PYGA 3RHWK 1M3JA 2WBXA 2XNAB 1M7UA 4JFSA 3FT4B 1KF9B 1ODUA 3D4GA 5I71C 4JZOA 3LN4A 5CP3A 4YSCA 2D7MA 4HF5L 4KQ3H 4BZ1L 4OQTL 5KSBA 3FO0L 5KANG 1LJMA 4MASA 2PXYC 1EUUA 1Z9SA 1XB6A 1CD1A 4IS6A 4MA8H 3VWJA 5AB1A 1PZUB 4DVRL 5EEVA 3PQYA 1CPUA 4BHUI 4ZMPA 3IFPA 4NXKA 4RRPM 4GAGL 1M7DB 1OCOB 4G80B 1GOGA 1WCBB 1ZT4B 3WIHL 2CNZA 4L37B 3U0PA 4JDVB 1EAPA 4PWKA 4JKPH 5JA8B 3AS1A 2EO7A 3CX5K 1FYHB 1KPVA 2FBJH 4L0ZA 1CLYL 3U6XA 3K2KA 4WHYG 1WBXA 3DX7B 4PRPA 4LBEA 2X6BA 1YY9D 3QISA 2BNQA 5LG6A 3O6FD 3ZOAA 3IDMA 4JMNA 1OIOA 3MRDB 2FQGA 5LNEA 1BZEA 5JR1H 1XCXA 4B3VA 3ARZA 4NM8H 4U4BA 3H7LA 5L9DL 3WKPA 4B9FA 3QDMB 1TQBB 2XIIA 3QZOA 4PRHA 5C0NC 4BXVA 1T20A 3BH9B 4R0LB 3LN9A 2F54D 1AZNA 5CU9A 4AKOA 4XZUA 3BVNA 2WPGA 3ARYA 4QHLA 1BLIA 1TQBC 4AMKL 4K07A 4KK6D 2DWEB 4R0LC 5IUSA 5JW3L 4HIXL 1CFNB 3LMJH 1CXEA 3K71A 2AEQL 4OSUH 5DHMC 4TYUA 3T4YA 4Y5VA 3IJSB 3RNQB 4GMTH 4KK9D 4LCVA 5ELIA 1Q0YL 1IL1A 3GSQA 5KEZA 3MXWL 3CVHL 3ESPA 1BF5A 3CFQA 2I07B 2QVTA 3LH2H 1TSHA 3KH4A 5DI8A 1B4RA 5HJDA 1N59A 2AV1B 3A4EA 1QWNA 2CJ3A 4HIHA 3O4LA 4BD4A 1RZJC 1YNKL 2HT4D 1K4DA 2XN2A 5FW6A 2H3KA 2Q86A 3E6HB 5SWZD 3FQTA 4A67A 5I17B 5KVFH 4C4KT 4ZMWA 5MENA 4MBOA 2V17L 3UGEA 2JJWA 4M7LT 5ESVA 4CN1A 1MJUH 5LCVH 5C86A 4XNXH 2GIYA 1DBAL 2IANE 5GS1C 3ABMB 4UM9A 1A65A 4Z7AA 1WZLA 5IVNA 5EPMA 5AWNH 4ENED 5DMYA 2A83A 5CEZL 1OXYA 1JRHL 4XNZC 2MCPL 4AE0A 5BW7C 4H8VA 2KLRA 1I1AC 1MCPL 3QO0A 3C6SB 1XGRB 3QZLA 4ZO7A 4HULB 3S3BB 3K7UA 1HSBA 2FWUA 3L3IB 3QXDA 5I76B 4AIZA 1GSKA 4PGCB 4N2HA 4WI4A 5L4MA 4A2DA 3EZ8A 3SJVD 1B2YA 3PV6B 2V2WB 1MG3C 5IESH 4LGPB 3RI5F 5EU6A 5ENWA 12E8L 5E2TH 1XZ0B 2NUTB 4WWKC 1EO8L 3SPCA 4WI0A 1ZPLA 3QS2A 4Y19B 1IJNA 4FL4C 1KYFA 5E1AA 1KYDA 3GXNA 2AEPL 5T1LD 1ZPUA 1AQDA 3FSVA 4K3EL 3BKYL 2NCEA 1JYWA 4XO4A 4QRBA 1VF5C 4ZOCA 3T8XB 4YAQA 1QKZH 1F4WL 2X3BA 1BVKB 1ZS8B 5IVXF 2AXHA 5FUOL 3UJJL 1HEHC 5I19L 2FHCA 2FO1A 5IFJA 2UY6A 1AXSB 1QSFB 5CEZE 4FNSA 3QJZA 1MOEA 4WSJA 5E1IA 1FFQA 2XACC 2Z31A 3KPMA 3E9UA 4H8WC 3ARQA 4JFEB 2YGQA 4F33B 3AU1B 1E3XA 3T6XA 1KIRA 4JVPA 3D0LB 4LEXL 1EIBA 4QRSB 1GS6X 2OMVA 3GXUB 3MRRB 4L0YA 4LEBA 3EO0B 4GQPH 3V5HA 4IRJD 4XX1G 2I69A 1FCGA 4KZDL 3HI6L 1NGZB 3DGDA 4TSCL 5AOMA 4DVBA 2RAMA 3ARBA 4ZQKA 4WFED 2FIKA 1YEGH 2DMCA 1TPXC 2WSDA 3O4LD 4UDTA 1R46A 2YSTA 1C5CH 2BM3A 3JZ7A 3PAYA 3KGUA 5SV3A 2UZYA 2Y5TB 3TEUA 4DGWC 3T2OA 3BWAB 5IEHA 2X88A 3HUJF 2HKAA 1BMGA 5CEXA 2YN5A 1D5ZA 4ELMF 3EJSA 4IDLA 5SX4H 1DUZA 1C12B 3RU8L 4K2UL 2NTFA 4IW4C 1NC2D 3ABLB 3L6FB 1ASOA 4YDNA 4ZS6C 1KJVB 4Y2NA 3NFNB 3U4AA 5J6HA 4YOKA 1PG7L 1R24A 1EK3A 1GZQA 3APCA 3CZNA 1WIPA 4BSWB 1RQ5A 1WH0A 1PMYA 2V7NB 3DHUA 4HWBA 4EF3A 2XYBA 1TVBA 3DX4A 1BVLB 3MMEA 2QZ5A 2HLFD 3SYPA 3QIUC 3E3QE 1HSAB 3KGTA 1F6AA 2WVTA 3GLDA 3VRIA 1LP9A 2WO4A 1WTLA 1U95A 4NLAA 3QHZL 5HGAB 2J21A 1CYWA 1V3JA 4FXGC 4XH2A 4IGBB 5IMLB 3C8DA 1C1EH 4OD2A 2NY4B 1OSPL 3DI3B 3ZQ9A 5K39B 5IIEB 4RAUA 3IMWA 2J1XA 1R5VA 2X42A 4DP0X 2ZAHA 3LAFA 4XB8A 1ZHBB 3NK3A 5F7LB 4B9IA 3MOAL 3B9KD 5CD3A 3RWDA 2MQCA 3M7OA 1FNEB 1V7MH 3I9PA 1KWKA 5EC2A 3A5VA 4UV7H 4P2RD 4PJCF 4P9HL 1EXUA 4J3OC 4EUPB 5JOPE 4TKWA 3ELAT 4N68A 2VDRB 2OULB 2R2HA 4HU2A 4NPJA 3QEQB 4DSYA 3BGAA 2FJGB 4LL9A 5KSVB 4P3WA 3PREA 1PSKL 2IWKA 3AVEA 4Z7WE 4Y16A 4GQRA 1MIMH 5C0EA 4R4BA 4KZ0A 4NOFA 2F8OA 3GSVB 2VR5A 1F42A 3NCYS 3CVCA 1WO2A 1RJYB 4Y4FB 1NFDE 1JPEA 1BOYA 2CJUL 3U6RB 1A6TB 1IC5H 7CGTA 3IGUA 3IYLW 1Z1WA 2XV3A 2QHLA 2E47A 1FSKC 1LQSR 1UEMA 3EFDL 3OKNA 5TE7H 3RFZA 2IDFA 2GJRA 1R19A 4APXB 5CSBA 4ADGA 3SPGA 2A9AA 4QXTB 4TRPL 4BM7A 3OF6D 3FOLB 3OPZL 4GUCA 1Y7VA 1RPKA 1KCKA 3N85H 1XSOA 3QUZA 4PLOB 1IGYA 3ARGB 1DDTA 3EKCA 4N8VB 4M61A 1ZGLM 3D18B 3OM3B 2YMOA 1KYOJ 1K3IA 5EUOA 1A6ZA 5DJ2A 1OGAD 4ZNCD 2ZYRA 1NFKA 1FZJA 4QY8B 1GKEA 3LH8A 2VRKA 5IHHA 3SN6N 1NOAA 4UBDC 1P5UB 4J4PD 1O5PA 3RZCA 3MCLH 4N2GA 1E9PA 3CFBA 4LHQB 1N5AB 1IT9L 1A5FL 5J06A 3D33A 2WBKA 2R2EA 1Z9PA 3CFMA 3RDTA 3P0YL 3NCEB 1N0LA 2K4AA 4GLRI 4MA7H 2GY7B 3OQRA 3QXVA 4I88A 1XR8B 3I75A 1HILA 3VJ6B 1CDYA 1XF5B 4XNYL 1MWOA 4P5RA 3DX9B 4BK8A 4LF3A 4ECNA 4N1EA 1TQCB 1NBYA 2X9XA 4MA1B 4W9CC 1DTUA 4L9LB 5EU4B 4I48B 3QRLA 3ZDYE 4H5SB 4HXAL 3MXVL 3I3EA 1OCCB 5IK3A 1KEMH 1KCRL 1O75A 3MRLB 3VXMD 5ETUA 3MNZA 3B2UD 3J07A 4KO7A 4ZI8A 1WFUA 2YAPA 1SFHA 2VO8A 2G9KA 4NP9A 1FG2A 2EDRA 2ZX8A 5EBWB 4NO3B 3HZMA 3QNZA 4P2OC 1P7QB 4XCFL 2OK0H 1K2DA 1A6WH 2UZXB 4CVXB 3FRPB 1MRFL 2UXTA 5KSBE 4PJFF 2J73A 4HGKC 1KTBA 5CILH 3DJRA 4C59B 1F58H 1FGVL 3KPOB 3O2DA 4PJXF 3AGWA 5CGBA 4LOFA 1E5AA 1VCBC 3JQOB 3FUEA 4JVWA 3PQYE 4ZFFB 1F02I 4QRFA 3B56A 2OMXB 1NTDA 2E8ZA 2XWBB 3V2AR 5ICZA 1E40A 4QJ4B 4MNQA 1AXTH 5HXMA 4X6CA 2OBGA 3QPQD 4LASH 2HLAA 5DEGB 4HKXA 1U92A 5EU5B 3ULVH 3GRGA 1ZANL 5I15H 5IW3A 3A23A 3FCTB 4WI6A 4AWJC 5EIVA 1UM6H 3BAJA 3JYCA 5FOBB 2QQNL 3GSUB 4XN5A 1XX9C 1KYOK 4JM4H 1F3DJ 2AKRB 2GK0A 3T0DA 4OZIF 2GBTA 2J8UA 3N43B 5FIEA 2BNQE 2R29A 4NQED 4FJ6A 5IT2L 3L1OL 2V5MA 4UIKH 3PWJA 4YSRA 3QDGD 5IMOA 3IAPA 4JE0A 2GTWA 4NZFA 1G7MB 2VJXA 5CXPA 2YBRB 4LKXA 3DXAD 1KIPB 4YPGB 2XT1B 3KDPB 1XXDC 1YY8A 1LK3H 5F6IC 1I3GL 4TUKH 5DD0L 2CHDA 4NI6A 5AKTA 4OLVH 5AD0B 3ZIYA 4MQ7A 5DZ9A 3GXTA 3I02A 2GFBB 5KVEE 1TZIA 1JZDC 4FX5A 3G5ZA 1KY6A 3Q1SH 3T65B 1PX8A 1CCZA 4POYA 1MI5D 5FC9A 2WB1A 4DCQB 2AQSA 2DWDB 2WJ5A 5D6DA 2XHNA 3FTUA 4HGWB 2VMFA 3COOA 1BFTA 2ZXQA 4KNUA 2ZTBA 5C09A 5J56B 4MRCA 5D7LD 3WLBA 2WNKA 3TWYA 2A9NL 1QHQA 2P43B 5SWQB 2IANB 2DQTH 3QUHA 3A0OA 4D9RD 3GMPB 3L3KA 3OMIB 3S37X 4C47A 4IDJL 4HD9A 2R0WH 3UZEA 5JW5B 3O4LE 4KKNA 5FGCB 4TV3A 3G5XA 1JTTA 2D7OA 1IGMH 1IAII 3RY6A 1OAZH 5E8EA 4YSEA 4U1GB 2D7NA 3VM7A 1KXHA 5MENE 5I0VA 2O61B 3LRSB 2EEFA 4OIFA 3GZPA 2BIIA 3HRZB 4L4TD 3P2TA 4NYLA 4MBRA 1ROCA 2GW5A 1RZFL 3L5XH 3RRQA 4GW1A 3UO8B 3SIKA 1SYSB 4ZNEA 5EOTB 4WRLA 4XB3A 4DEPB 4U1SB 4YHIB 5D6CB 2DJMA 5CSZB 1CGXA 2PP8A 4LHUA 1A9EA 5T33L 2IV9A 3VXUD 2RD0A 5CIPA 4QRQB 1Q4NX 2Z8SA 1FDLL 1D5BB 3CSTA 3U30B 3B2DC 5DHYB 3ZKSD 4FADA 2WQAA 4RNRA 3S3DB 3EDDA 4ZK8A 1UM5L 2DLHA 2LVCA 5EU6E 4LNRA 2CRYA 3HZYB 5E0QA 4ZSOA 2BS71 1M9WA 1FH5L 2IG2L 2QPFA 4TQPA 2PXYA 4NGHL 4WI2A 4ZZFA 1PS3A 3F04A 5IW6B 2BVPA 4PRAA 4P05A 4I3RH 5E8OA 3NTCL 2WVVB 2CUIA 4A55A 4AQ8A 1HNFA 4M5ZH 4MD4B 2BRRL 4MNHB 1A22B 4ONOA 3VGBA 1EEQA 2JQMA 3NRQA 2MQGA 3IJEB 2Y36L 4TSBH 2MSPA 4NNXA 3BZ5A 5G5DB 5TFSL 1LM8V 3T6WA 3BDXA 3OJVC 3OG4B 1IM3B 4PGEA 3U1SH 1DJHA 4M8UA 1NC4A 3STZA 1G7IA 5EU3A 1I7TA 1FFPB 5AW4B 4IBUA 2GKIA 4YGVA 3R06A 2VB5A 5JO5B 1PL3A 4HWBL 4DFIA 2K45A 1OSZB 1WHPA 5BV7L 1NDMB 4BFGA 4M3KB 3VTMA 4QAWA 2EXWC 3D39A 4JM2B 2VYRE 4ZJ9A 2IF7A 2XTJC 2WLIB 2ED9A 2JSFA 4PJHA 5GSVB 4ACTA 2BY3A 4WUUD 5D71L 3G08B 2YEZB 4GRLD 1JK9A 1ZHLA 1JV2B 4FZ8L 4JM2C 1LO3L 4M7JH 5C6WH 1BF2A 3FUHA 2RFXB 3CH8A 1Q0XH 2IAMC 1SBSH 1L7IL 5IB4B 5C6PB 4Z76A 1TU2B 4L8SB 2BH0A 4PRNB 4UT6H 1T5KA 1KGJA 5F97E 4F58H 5KSAC 1F4HA 4Y9BA 4AVKA 4RFOL 1OAKL 5DHEA 4QHNB 3EYFA 1HOCB 2FEDC 2VLKB 4PB0L 3VFRA 1GXEA 4U0RC 4HOZA 4TF4A 2XZCL 3LCYA 5FYJE 3WJJC 4X99B 4EAEA 5ITFB 4ZTPH 5B7MA 4HKJA 5IMKB 4MZIA 5D1XD 2W81C 1AS6A 4HS8H 3ENEA 1EH9A 1LP9E 1NMCC 4PIBA 2YZ8A 3CU7A 2YRBA 2HH0L 5CEYB 4ODXA 1I9RH 2H1XA 3GPSA 3A24A 5C3LD 2VL4A 2PWEA 4XMWA 5EV7A 3V0IA 3RTQB 5GS1A 3FB8A 5GGQH 2VH5H 1T3FA 3JTTB 4LSSL 3VFOA 4ZBJA 5I74B 5BW7A 1A9BA 1QI3A 5DLLA 3EOYG 3LKPB 5T1DH 1I1AA 3HR5B 1XHHA 3FAWA 4HAKA 3O9WA 4YDLB 2X5PA 2R8SH 3IDJB 2KLSA 3TXAA 3SKNB 3D69A 2X6AA 3R4DA 3O3BB 4M62L 1IV8A 4MDIA 3EYSH 3BUTA 1IEAB 3GXIA 4LKCB 1MCWW 3IFLH 2OMTA 4LL1A 2VQUA 5SV4A 1KB5B 3LKSA 5TE4L 1Z3GH 2OR8A 3WJLC 5KG9B 3SDCD 4EZKA 4BH7A 3BLBA 2Y06L 2YPKA 4OCRL 5DMKB 2EIKB 1DBKL 4A6YB 1Y0LB 4X80L 5B1BB 1Z9OA 1DO6A 4XE0A 1XMEB 4AIOA 2Z0UA 1O7DC 5IF0B 4EI6A 2XA8L 3MODL 3IKKA 1EZVY 4XBPB 4G7QB 3O6FB 4ZUSB 5EO9A 3FF8A 3MLPA 4IBYA 3DBSA 3QI9C 4U6HB 1NDTA 2LU7A 1CFSA 4R2GC 2DLGA 5K59F 1E5YA 1FE8H 1YY9C 5H94B 4NT6A 1NEUA 3CVIL 4F80A 3GBLA 5CWSA 1H3PL 3OZLA 1Z5LB 2X1OA 4RMRA 2F54B 2X4OB 5EUOE 1V7NL 2FX9L 1HXMB 4O51A 1EEZB 2OMZB 2ZOKA 5DC9B 5JYMA 2YQ3A 2EEAA 3TX4A 4QXUL 3V6BR 4KQ0A 1MDTA 1MRDL 2JB6A 1IBGL 3F12B 3NZHH 3O2DL 4MVBD 7FABH 4KK6C 2X87A 1BAGA 4TUJA 4U05A 1FL3A 1YC8A 1USZA 1SJHB 3FQUA 4UQCA 5MEPB 5J13B 3IJHA 1EFXA 1BBDL 1GPOL 2VE6A 4NQUA 2OSLB 3SPVB 4O02A 4DPCX 5MI0C 1F56A 3AFLA 3HN5A 4M5TA 5CM1A 1S7RA 5HYQA 4N90D 4UU9A 2DQFA 3PP3H 5D7IF 1NPNA 2FGWL 2HRPL 4ONGH 3O9WD 5SWZB 1CICC 4P8QA 3MC0A 1N6UA 1W8EA 2WLJA 3EDJA 5DR5H 1A4JB 4ZRGA 1FVEB 4ERSL 5J13C 1CL7L 4GKSA 3MLRH 4JK0D 3FO2A 5CZVL 1P4UA 4YDVA 3V0GA 2VDQB 3VXOA 3EOTH 4D9RE 3QIUA 5IG7B 3WY2A 2ZKMX 2BS8A 2R29L 2A6KA 2FWOA 1GS8A 2ZF9A 4OCSH 4LCIL 2GUOA 1TR7A 1R5WB 1DVFC 1J9RA 2A73B 3RWCB 2E7DA 3T0XA 3SKJL 1QA9A 1JTOA 4FXGA 3BGMA 4W6XB 1NCBL 1W72B 1FLRL 4WWOA 5G4NA 4AGOA 1KPVB 3OBAA 2EYSA 4JY4A 5TDPB 1RZ8A 3SJVB 1IC7H 1Q9OB 2ZWLT 3MRGB 5DRNA 1WBXB 5MEQB 3KPSD 3MUHL 1W0WB 3AS3A 4JUTA 1LE5A 4X6CE 1MCDA 4JZNA 4F7PB 3IDMB 5AW3B 2AABH 3VXTB 1I3RA 5J1TC 3IDYB 3HBZA 3GRBA 5F1SA 4N6RB 3B8YA 1J7VR 4IKJA 4YFEA 3QEGH 6CGTA 1B0IA 2X3CA 2QFPA 4BFBD 3WUWB 1U93A 2IWEA 3GMRB 5E9DD 3OKMA 3O2WH 5AW9B 4JJ5A 2J8UE 4Z8FL 4WWNA 5J1AA 32C2A 4IKKA 4S10A 4YN3A 5DZNA 1UXMA 3DX0A 2IOMA 3WSQH 5BZWA 2EQDA 4IOIA 5ICYA 1L3WA 4M6NH 5C6TH 1WEJL 3WEMA 1X9RA 4CKVX 3GMOB 5IGXL 3DUSB 4EDXB 1MH5B 2EDQA 5IMMA 4GXVH 5HDBB 3OZ9H 5KVDE 5HJ3A 3C9NA 3CSPA 4Y5YC 4DUVA 1UD5A 4FCAA 4JB9L 3QNYA 5E5UB 3TIEB 4B53A 4IRJB 4UILL 2IFFL 2J56A 2C9RA 3NZUA 1EFXD 3FTGB 5AUMA 4NNYB 4QNPF 5DI8B 3WFCL 1AMXA 3LQAH 4HV8A 3O4LB 3C5XA 5KN5A 3AMLA 5CKAA 2BHFA 2J1YA 5FXCH 2FYVA 3MGAA 2IFGA 2QVIA 3POHA 4WUKL 1TEFA 1UWEL 5C09E 4JJOA 4MCMA 4N22A 1RIHL 3J7HA 4PB9L 1Q1JL 4HUXA 4F7CA 1IKOP 3HI5L 1XH0A 5I1DA 2JQZA 1QEWB 2C9AA 2X4NB 2FJFB 5GPRA 2W65A 2AZAA 4XP4L 1ZLVK 2KS0A 1NC2B 4XN2A 1WS8A 4WUUE 1J5IA 1P1ZB 2IOOA 3BP7A 3I6LE 3QXDB 5IVZA 3CSFA 3KCWA 3REWB 5E7BA 3N43F 3SY0A 5DMGC 4F91B 4H88L 4U49A 4ZNEE 3EYOA 1EJ6A 3L3GA 4TN9A 1D5MA 5E1AB 1MAML 3VWKC 3QFDB 4OJAA 3QDAA 1AQDB 4PV1C 1K6QL 2EH7H 1C7SA 5DWPA 1BVNT 3Q13A 5JNYB 4PMEA 1VCAA 3V4VA 2HLFC 2XG5A 4Z7QE 5I1HH 3G6JA 2D0FA 4RWYH 4EPSA 4RBPH 2EH8L 4P2OA 3B2XA 2UUDH 2XOTA 5DUPL 1TTGA 3SCMC 5DVLA 3B9KB 4ZSOE 1KPUA 4AYSA 8CGTA 5IFJB 2F0CA 5IJBC 3VFTA 2D4DA 5HVFB 1E9QA 4OCWL 4QDGA 1NPJA 3QPKA 4R5TA 2B4CH 5DJXA 1CIUA 1H0DA 2XQYG 2WIMA 3FS9A 3QG7H 4FF9A 4OKVB 5EMYA 1L9TA 2BK8A 3PXLA 5TJWK 1AQKH 1CBJA 3B9KC 3NGBB 2B7DT 4ZQTA 3L3OA 2XVKA 5C0AD 1DDHA 3OC5A 4YXHL 8PAZA 3QPXL 5T3ZH 5GSRA 3IJYA 1GSMA 2GT9A 5DK2B 4NC1C 2I7SA 3WIAA 2EDXA 2FIKB 1LWRA 2R15A 1CYXA 4WI9A 5EEXA 4OF6A 3MGOA 2VZ1A 1Y6NR 2VDPB 1G6RH 1KCLA 1JK8B 4XE5B 1I7ZB 3DIDA 4Z3TA 1MFAL 2AMGA 3G6DL 2HMID 1R3KB 2RBLA 3HG1D 1VACB 4XPAH 2PCPA 5DZLA 3RZWA 3S34H 4Y7OC 1NGWB 3OD3A 1D5ZB 1RZJL 5F9WC 1MN4A 3FQ1A 5BMFH 1DUZB 2OX5A 3D39E 1FRGL 3J2PA 2EICA 2NTFB 1ULVA 2DKSA 1V54B 4WDIB 2Y3NA 3TCTA 5KAQF 4PJHE 2AF2A 3HN3A 4JKNA 2YAMA 3FBQA 2VDML 1ZVNA 5AZEL 1TVHB 3FFDA 4LLVB 5J6HB 3ZSTA 4RCAA 2PR9A 2GTZB 2RCSL 5DVKA 1OGAB 3IGLA 4TUOA 1CT8A 3STBA 4UOZA 4I7ZC 5DQDH 4LCWA 4DTGH 3EG9A 1XT5A 3PCYA 2FB4H 3FQ4A 3MV8D 3NABH 5DHVB 3EHBD 1F6AB 2G5UA 1U8QB 2PYED 4XC3L 1LP9B 4QHUB 1D9KC 4R7DA 1G7PA 5GJTL 4DO5A 2OMYA 4J2XA 3U36B 1U8JA 4TNVF 5ESQB 5FV2A 1N4XH 1YPZA 2VXTH 2WC7A 3ZW3A 1JWSA 4MGXA 4P5SA 1T03H 4V33A 5KSUA 4IQHA 1VESA 3QC5X 4HYTB 4JE4B 1ASPA 4ZX6A 6PAZA 2LT9A 5L8LB 2NY6D 2EDDA 3D12B 3VE0A 1SEQH 1CZ8H 2JH2A 2F15A 4OCMC 1LEKA 2J5WA 4TPRH 2EXYD 5DD5H 3ARSA 4DWHA 2TSAA 1BLNA 3VXMB 3MLUH 3IDIA 2UVFA 3JTSB 4E9QA 4XWGH 4L1BA 5EBMA 3CFJA 4KNTA 5DSCB 5E6YA 5AQ0A 4LCCC 3RVTC 3EDEA 1VGEH 1CMOA 4YO0B 3LS5H 3BZFA 3CN3A 1DVSA 3B2UC 1OHQA 1JVKA 1A7QL 4R4BB 4H8WL 1MHPL 4G42A 4JM2F 3BPOB 5J11C 2HFGL 5DD1H 1OPGH 3G9AB 3UTZA 4JFWA 4LDOB 1D5RA 1SBBA 5EFIB 1J8HA 4JLRA 3SYCA 3KJ6H 3VG0L 1C5BL 1HHKA 1BXXA 2WTRB 4AQAB 4G3YH 4JFPA 2F8VA 3ILQD 5JORA 9PCYA 4OGXH 4ANUA 4R83A 2P26A 2WO2B 1VKXA 2CO6B 2CRIA 2R0LH 4H44C 1X5KA 2ICWA 2OMNA 3DTXB 3IMBA 4FFVC 3RLSA 1JAEA 1XCTB 4IJ3B 3SO3B 1NBVH 3U4KA 4M61B 1TKWA 4C56A 4OB5H 1MIEL 3ROOA 4WO4C 1XIWC 1VHPA 1G7HA 3GMLA 4NQEB 5LWYL 3RWGA 4FTVA 2IDTA 5LGJA 3MR9B 4O02L 1FZJB 3CCHB 3QDGB 3UAAA 3FB7A 4H2CA 4WK0B 3U2SB 3GSNH 4LT7A 5CO1A 3GI8H 3RX7A 2ADJA 3FSAA 5JW4Q 4LCYA 4MNGA 3NACH 2CR6A 1CFBA 3MBWB 1L0QA 3O6KH 2ITFA 3A6OA 1L9QA 4N8CL 4BUHA 4FG2A 1OPOA 1X7TA 1H6TA 1N6QH 4OBSA 2Z65C 1JF5A 2Q8AL 2OI9B 4RGMB 4KY1L 2DWSA 3BXNB 4NZJA 1NBYB 2DQGH 3LIZH 4W6WB 1MI5B 4O4YH 2F9BT 4ZODA 3PDDA 3GKWH 4KKLD 2E7LC 4GUPB 4IRSD 4H40A 5D7LB 1Q90A 2FQFA 2FD6H 3E1F1 4G59C 3WEXB 4CU6A 1RP9A 3II3A 4HEPA 4I2XA 1YMMA 4IMLA 1PLCA 4NUMA 3VXPB 1VERA 1NEZB 2IAMA 3HZMB 5CBEA 5KTEL 1B2WL 3M8OH 4B27A 2SODB 3ILPB 2NOYA 4KXDA 1DQMH 3UFIA 1IAOB 3PXJA 2Z35B 2UV3A 2BCKB 5JHAA 1A7OH 5KSAA 1B4JL 4CBPA 5CFAA 1JHTB 3SDXA 1KELH 1PZ2A 5IVOA 4M7ZC 5T5NG 4ANKA 3WTYA 3JVGC 2JJUA 3BIKA 3NJVA 3IKCA 5DFVD 2IH3A 5I8CB 3M07A 4FFZL 4L4TB 5IJVA 1NCDL 1I8IA 3A67L 3HMXA 3DRQB 2H26B 1AQ8A 1FFOA 4AOFA 4E5XB 3U9UB 5F71A 5EIQA 3VXUB 4PGDA 2ADIB 3OGOE 1TQVA 5DMJB 2FIRT 4LHJB 3QFJD 4PCTA 1A02N 2OTWB 2RHEA 2EZ0C 4GKZA 2F68X 2QVKA 1MVFA 2GK0B 3O3EA 3QDJD 5JPNA 1T89A 3D2UA 1NGYB 4NZUL 1BQRA 4UQEA 3U2JA 1QLEB 1WZMA 3PFQA 1S3KL 3F5WA 2KDGA 2BDNL 2R1XA 5IMOB 3P9WB 2P8PA 3LDBB 1IC0A 2FLRT 4U2ZA 5HHPB 3H3PH 3HFML 5AAWC 5IB1A 2BFVL 1QFWI 3VSQA 3NSXA 2AAVA 1IILE 3QQ3A 4KQ3L 1OF2A 2YAQA 4LKXB 4NN5B 7PAZA 4HS3A 3HC0A 4HJ0D 5KBMA 2EJ1A 4ZYKA 3WJLA 3ASOB 4JS7A 4WW2B 4TL4A 1FNSH 1P4LB 5JDSB 5A3IC 3QUGA 4J5VA 2DDQL 2QMKA 2X4RB 1IQDA 1UA6L 2YIHA 3C8HA 3CZFB 3FFCA 1CD9B 1SFDA 3G5ZB 2MCAA 2ICWJ 4HCFA 1YG9A 5KSBF 1ZLEA 4PP1D 1ODAA 3PJLA 1GW6A 3UJIH 1NDGA 1XR9A 3RTLA 4DK3A 4DGIH 2E9BA 2VDKB 1L9SA 3BGFC 3ULUH 2VAAB 2B15A 5C09B 3UMNA 4NI3A 3WE6A 1UATA 3QI9A 4PU2A 15C8L 4JUSA 1JPGA 4Z3JA 1AGBB 5E6IC 2LU4A 2YZ1A 3CFDA 2ZD0A 1JGLL 4P5TC 2AQ2A 4M1GL 4WCYH 2AANA 2BJMH 1HHJA 1DBJL 1UCBL 1DSWA 3PL6D 3IU3B 4WUUB 2IJ0C 3CVDA 3HZKB 3M6DA 1WBYB 3V4VL 3FN9A 5IBTH 4DUWA 1LE9A 1OTSC 4GRLB 5I9QC 5L6YH 5TH2A 3TASA 2Y5QA 1BAWA 4XI5D 1BZ7A 3TBYA 2RTTA 3GUFA 4H20L 4NYLB 1J5DA 1G1KA 3X13B 5KJRH 3DVNB 4HWEH 3MFGB 5DEFB 4GEJA 5BQ7B 1BG9A 2OXGB 2D3VA 3O6MH 5DZVA 3ZE2E 3MRMA 3QO1A 5D7EA 5F89A 5DVPA 3U82B 4NZRH 3HAEA 4XX1E 4I4WB 1QLRB 5A6IA 2AQTA 3ES6B 4DKDC 2ZNXA 3FDWA 2DOCA 3S2CA 3LMJL 2CUHA 4U1MA 3AXLA 4HALA 4OSUL 3FSWA 4HS6A 4X9FA 2V7HA 1T2QL 4ZSOB 3H9HA 3UDWA 3KG5A 4ZDHA 4OF3A 2VDNB 4Q6YA 5D1XB 5GRWA 4K5PA 5BVJB 3NRFA 2ZSVA 5KYNA 5E5LA 5L0QB 2APWA 1QFHA 2B39A 5LGHH 3OMNB 3VCLA 3TYGH 3WFDH 1YEHL 3G6JE 3MRNA 5HDBF 3CUPA 4YK4B 2WGNB 1CFQA 5EZOH 4Q9CA 2FLMA 3ARUA 4MJJA 1DVFA 2GJ6A 3G04B 4O2FB 3SDDD 5GZOC 5L0QC 5E7FA 1YEDB 4XNXL 4GRWE 5E00B 3K8LA 2HKFH 1T5WA 3F2LA 3OLIA 4LB8A 3S36H 1YDPB 2XJKA 4F9LC 5A16B 1NKRA 2Q9OA 2DD8L 3GF8A 3BE1H 2HJLB 4FLHA 2BOBA 4QRUA 3CSYA 1JIBA 1V8HA 3TN0C 1UTDA 1ES0A 2P3YA 2P5PA 4TNVK 5EU3B 4AGLA 4LPXA 1HL9A 4QOKA 3SGDI 4XCNA 4BDVA 4PI0A 3FU7A 1E4HA 3SDCB 5K9KA 1A4CA 2H41A 2OQJA 2Y69B 5GHWH 4Q6IB 1NFIA 1BFVH 1PIGA 3B9AA 3GSXB 1YJDC 3F84A 2AGJL 2CDGA 5DUJA 2Y07H 2EYRB 1IGIH 1QATA 4K71C 2B1HL 3FUMA 5GS0C 1QFUH 4LFHG 5KVFE 4ZFZB 5AKVA 3TV3L 4U6VH 5JZ7D 1W8OA 3V9EA 3MLYL 3HHSA 4P5KA 2FNWA 1PZSA 3TBBA 4S0HA 4YSOA 1ZHKB 2V2TB 2ESVD 4HZLA 1FORL 2CK0H 4Y89A 1E5BA 1N70A 3DDGA 4OT1H 1QYGH 4PR5B 4YX2L 4Z76B 3GMQB 4DZBB 5CFHA 1XEUA 4G9FA 5KS9A 1RIUL 2CO7B 2D73A 2Q1EA 5F2FA 5FWQA 1FN4B 1CTOA 4JFHD 1MXDA 4PGJA 3ULVD 1MEXL 2W0KA 1OD7A 1C16B 3N0PB 5HHVH 3SKOA 4NJ9L 4ZAKD 4YDKH 2XI9A 3T1WA 4LCWE 1YMHA 2QTEA 3QJFA 4HKJB 2Q2EB 3QP3A 3DK0A 1MPAH 1GGIH 1ZIAA 2X2YA 2XZQL 4MXWH 5EZJB 3LPGA 4PWFA 5AYTA 2OJ1A 4MJID 2JWYA 1YPZE 4ZFOA 2PW1B 3S4SB 4N0CC 2KT6A 2G9HA 3IXTB 2DM4A 1T3FB 3KS0J 5IQNA 4MVBC 1ZWIA 3RVVD 2VW6A 2R56H 1TEYA 1ACYL 5HYQB 5F21B 4JMXA 3O9WB 2YD0A 3ARPA 3WXWL 1KPRB 3T71A 4K3DL 2QMJA 3L13A 3RIFF 4ALAH 3DIVA 3BQUD 4MJ6A 5BCAA 3BAYA 4PW4A 2WM0A 4AGMA 2K8QA 1E65A 2X89D 3CMOH 2HUEA 5IQOA 1JYNA 2HX9A 5GGVL 2EIMB 4WFFE 1QBBA 4QOKD 1HK6A 1SEBA 1OLZA 5DYOB 3CPLB 5DJ8B 3RJDA 3VWKA 7TAAA 3MZTA 4OJFH 3EJQA 5LO7A 1J8HE 5D70H 4KHXH 3MLXL 4L3CA 4R3SA 3SCMA 1Y18A 3KPSB 2QQLL 3TGXA 4FN0A 1ZSDB 3W39B 4AM0A 1T0NA 2Z4TA 3JV4B 2Q6WB 3VD1A 1HAWA 3QUMA 2WAHA 4PLKC 4YS4A 2LAGB 5SWSD 4G8GA 3NSFA 4GINA 2EVGA 1LP9F 3I9GL 4G7YL 5KBKA 5CWSB 2OS7A 3Q2NA 5E9DB 3SE3C 4G2AA 2P8LB 1MFEH 4KDTC 3FYIB 4C56E 2APFA 3QDJE 1YN6A 1MLCA 2VL5B 3GJFH 2G5BB 4H0IA 4L3FA 3SKUD 1ZHNB 4FTVE 4G6MH 4R4ND 1NAMH 4K94C 4UB0H 1CDJA 2NUPA 5LXGH 4PV8B 1DANT 3ATFA 5LAXA 2VLRD 2BOCA 2DIBA 5ISZA 1RFDL 4CSTA 4KKQA 4FKHA 4MNGE 1VB9A 2BMKB 3B2MA 1EHLL 3PS6A 2BNRD 2CHXA 2DYPA 5DUBB 3T0BA 1YEWA 4LE8A 4LESA 3MZGB 5CMAA 3QIWC 3HMXL 4X0NA 3QQ9C 3IJHB 1EFXB 2NY7L 3PGDA 1MHHA 1QBAA 2VE6B 3QS3A 3ZRSA 2XTJE 2AVFA 1MUJB 4FQXA 4YHKL 4JPVH 4NQSA 5DO8A 4DUXA 3TBWB 3NJIA 2P49B 2MKLC 3AY4A 1DZ0A 1OP9A 5DFWH 4I2XE 1YMME 2BZ7A 3GB7A 3GZOA 4FXKC 4FP8L 2OXHA 1IVLA 5I1CL 5FYJU 4I18C 5I0YA 3UP1A 1JDCA 4JFOA 3L95A 1BD2D 4OFPA 2L8AA 1HI6A 1MJ8H 1QP1A 4UT9L 1D9KA 1VRSA 3DPBB 3IFOA 4XOBA 3SDXE 2WLMA 4M1CD 2WKGA 4NENA 4RMSA 2NY0D 5JLZB 2EDKA 2D3NA 2RQ8A 5DJDA 3P77A 4JY4B 3HIZA 1E8YA 2G2RB 5C0CD 4Q14A 1ESOA 4N2CA 1BW8A 5T1KD 1YEKH 3AUVA 1M71A 3OB0K 4FNLL 1GJIA 4BKLB 4JY5H 4Z7OE 5ID1B 1S78C 3BSZH 2JK5B 4NHUA 4NZTL 4QMEA 2VZSA 1B0RA 4OZ4B 3TV8A 1FZOB 5DD6B 2X0VA 1EGJH 4YDIH 4MMYB 1NGXB 5I73C 1U8LB 4XVSL 2VDOH 3F3HA 4HHAB 4LCCA 2FEJA 4N6QA 4DGUA 1U93B 5ICXB 2N0MA 3FMGH 1KEML 1OK0A 3QG6A 4CU8A 4L4JA 3AUWB 1HDMA 4ODUB 3U0TB 2GPZA 3CC5A 1J48A 5EIIG 4KI1A 5J1AB 3BP6A 1RJLB 3CH1B 2F53D 4WFGE 2OZ4H 1BWWA 3HNSH 2WINA 5ICYB 1A6WL 5DD3L 1E5CA 3PAUA 4ZUUB 1SMOA 5FWRA 2XN9A 2DTSA 2YAOA 1DHKA 2X40A 5C0AB 4ODHH 5E2VH 2VITA 4D0DB 2VN3A 3KWTA 3X14A 2NLJA 1E6OL 2Z93B 4N2NA 3HKZA 3LEXA 3TCLA 1MXGA 1FAIL 1T4KA 4XBGB 4P9ML 2HJFA 1G7LA 2VOTA 3MUJA 5I8KL 3U79A 2IMNA 2ZUUA 3GD1C 2Y1AA 3ROLA 4HV8B 4UINH 4AGQA 1O7DE 4OTXH 1HH9B 1SLXA 3NRPA 3MCKB 1O6TA 3K5SA 4AE1A 1KCBA 1U2YA 2BZDA 4MAYD 2ILLA 4HP5A 1BX2A 2WNWA 5H37H 3APMA 4XBEL 4WO4A 1XIWA 4KX9A 5DC0A 1TYEB 2HJKB 3HG1B 1A3RL 3UADA 1MQKL 1MSPA 2R23A 1NCAH 3MA9H 1IFHH 3GFUA 1M1SA 1OM3L 4F2FA 2LU5A 3N50A 4XPTL 5CJQL 4JM4L 2B59B 5C08D 3TEWA 2W65B 4EOWH 2H9GB 2LLLA 2EE6A 3PWNA 2YOAA 5DJ0B 2VLLA 4L2YA 2BP0B 1DQKA 4WEUD 4ICXA 3MTRA 3GKZA 5IHUL 4Z95H 2IDSA 3OQ3B 4CC1A 1XWVA 2MKWA 4X0KB 4XAKD 4Y2DC 4ICWA 5GISH 1UXSA 1U21A 3PWLA 3V5DB 3OR7A 1RI8A 4AZ8A 1AIFB 1NM4A 2EYTB 1I1RA 4HU8A 4AJWA 5D4QA 3DGGA 2AXJA 1EVUA 4IEFA 4CN6A 1RZ7L 3MV8B 1AD0A 4YMPA 3L3GB 3EHBB 5BXFB 5I75B 2PYEB 2E7LA 3UYRH 4JR9H 1U8NA 2JTYA 3S3CB 4Y8DC 3QXAB 1TYJA 4OZFH 1VFUA 1EAOA 4JFHE 3ULVE 3G6JB 2F8XC 3DC0A 3SYQA 2RH0A 4CMHB 4LDCA 4KO5A 1AOHA 4WW2F 5F0JB 2G75A 2NY6B 2UYLA 3FB5B 2G4GA 1K4CA 2ZQKA 3OKDA 4HUVA 2YPVH 4NWUH 1XH3A 1L4IA 3VFTB 3IE9A 4LPYA 4XWOD 4J27A 5K9QG 2BP3A 4QJ3B 4AEIL 2GEQA 1D6EA 5AVXB 5DJCB 3B5HA 3ZX1A 3JVGA 4K9JA 4MS8D 3TH4T 3IEAA 3LEYH 4WHCA 3LNIA 4FQCL 4K8RH 4KTDL 4N1HB 4I1PA 1WQVT 3BH4A 4LOVA 4RMBA 3WN5B 2CMRH 2AI0L 2EXYC 3MBXH 2APSA 2W60A 3M1CA 3ZL4H 1SHXA 5ADPH 4GRMB 4XNMA 1N10A 4P07A 5DVOA 4H25B 1HZHH 3FQRA 3AADB 3VGFA 5B3JE 3EJZD 2HSIA 1A2YA 3BESR 1PJWA 3KM2A 1BCIA 3PGCA 2MHAB 2XPGA 2PPDA 2NW3B 1UB5A 3KPQA 2WLLB 3DMMD 1A1MB 5EO0A 1HQRA 2ZX7A 3ZHNA 3U7WH 2QKSA 3W0WA 3LB6D 4QOKE 1RD6A 4NKMA 2VSDA 4PS7A 4YDZA 1SDDA 1VGKA 5DT1L 3L2LA 5ITBH 2X1XR 4J1UA 1G9NH 3CN2A 4W4OC 2ENPA 4X9HA 1Y07A 4KRNA 1I3UA 3H9SA 4PLJD 4H8UA 4J8RB 1Q0EA 3ILQC 4OGYH 3VB9A 4JFDD 1QBLL 3RIFK 1CK0H 4XPHH 3NQIA 4QRTA 4Z7QF 4FE9A 2ATKA 1QUPA 3EO1B 3FFDB 1HYRC 4ZFOL 2D8KA 1T2XA 3QULB 2E7CA 2WXHA 2GSIA 2R4SH 1ET5A 4HDIB 4CSPA 4HEMA 2EDLA 4RGND 2P5WA 4JN2A 3B9DA 5BZZA 4WV1B 4TSBL 1QUNB 4G9FE 5CJ5A 5KS9E 3WKYA 4G8EB 2J6EA 4MSWA 1DP0A 4NKDB 3RUGB 3ZMEA 4Z77A 4Q52A 3ZQXA 1KCVH 2FL5A 2AS5M 3BN9D 3V0VA 1JVLA 1JWSB 2IPKA 4BRVA 5E6IA 2Z9TA 4M5SA 2H2SC 4P5TA 4HK3J 5AW6B 2VLRE 1N26A 2L7QA 2X7LB 5FEBA 1V55B 3VE0B 1TTFA 4KO6A 1RK1A 5FHBH 4OGAD 4A7GA 4FXTA 1E4XL 4K4KA 3HEIB 3MJ9H 1LO0L 1FL6A 4IRSB 1XF1A 3W9EB 2A2QT 5H37G 3BH8B 5F88A 4X4XB 2IQAB 2JCCA 3FL7A 4PS4H 4G6JH 3I9IA 4FRWA 3MV9D 4KKLC 4B5ZA 4LLUB 2XVGA 3PGFH 1UJ3A 1IEBA 1U3HA 1FBIL 3OWEA 3GT6A 3F00A 3QUML 4KI5C 4M7JL 4OR1A 3EJYC 4ZW8A 1S5IH 3H8NA 3JSSA 4G42B 3EH5B 1KJ2H 5DQJB 1OAQH 4K5MA 4G1MA 3CFNA 4ONFL 1TTBA 4J3BA 1Q0XL 2WWKO 3A6CH 3DOSB 5I26A 1O6SA 2YPLD 2NQDA 4JLRB 4HK0A 3FT2A 2HVJA 4L1DA 1QFPA 1DVZA 2PR4H 3P0GB 3SE6A 3BHBB 1T5XB 4CADA 2H45A 4JFPB 1AHWB 1MJ7H 4WI7A 5EUKB 1B0GA 2VNCA 3A6BL 1R3HB 1OAXH 5AALA 2KERA 1OCWL 1PZDA 1TF4A 4JRWA 2B9BA 3IDGA 3HE6C 3DJ9A 4CGUB 1VKXB 2DLTA 3QFJB 3QJHB 1RJZA 3CQFA 1AHWC 4OZFG 3THMH 4O58L 1IKFH 2XTLA 3V0WH 4FNPA 3R7RA 5JIKA 2QV4A 1CGVA 3C6LD 5GZOA 1OB1B 3QDJB 4GSQA 4TQEH 3ZUNC 4JANA 1NANH 2YAFA 3TT3L 4GSDH 2LE9A 1PLBA 1U8HB 3JVFC 3IETB 4NRXA 4R26H 3WS6C 3KD4A 3FT1A 2A77H 3SBQA 1HESA 4MCZA 3CBRA 3AB0B 1ET8A 2P5WD 4PP2A 4QXGH 1IQWL 4BZ2H 3C87A 1SLWA 3TN0A 3O3DB 5EU7E 5HYJD 2JE8A 4NP4H 2XBTA 4LQFH 2R8SL 4FHBD 2E4FA 2VUYA 4O9HL 1NIEA 2FQDA 3S96A 2APXA 1YQ2A 2O1AA 4I77L 4BELD 3QIBC 1TTAA 5F9JA 3TOPA 3EYSL 1ZT1B 4M43L 4P49A 1AO7A 1UJTA 4KUZL 2PWFA 5ISZE 3CC1A 4JO1L 4RA3A 5K9OB 2Y1YA 4I9WD 1F3JA 2B3RA 2VC2L 4LNVA 5IQ9A 2BSBA 5E5RB 3P4NB 2X4SA 1KTJA 5D7JC 2DBJA 4OCYL 4YHZL 1R0AL 3NCYP 4NO0A 3TFKC 4OJYA 4PP1C 3P02A 4TVPH 5CINL 2WTPA 3S3PA 3V10A 1JGEB 4OBRA 3H6AA 4B96A 3HLKA 3QUYD 2JB5H 4DP8X 4U1JB 1R3IH 3PIQB 4LVOC 3VW3L 2YD8A 2A7BA 3CQQA 4WKXA 4HKBA 4R97C 2Z1PA 4RDQF 1CDUA 1RSYA 1VADB 1S6NA 4K73A 1BYPA 3PL6B 2QGCA 5T3ZD 3MREA 3ISRA 2DF3A 3LZLA 4N0UB 4Q9BA 1G1YA 3BIKB 3MUUA 4QRPA 1PY4A 2BSTA 3CN0A 1L5GA 4OCNC 3RWJB 2N7SA 4MB5A 3PL6C 3LQZA 4LDLB 4ORZC 3DV6B 4NUJA 3FC8A 1REIA 3F7QA 4Z7OB 3L9BA 2X28A 4G9DA 5D1QA 1L7TL 2G3MA 5AW7B 5FR3A 4XI5C 4PGDB 3NUKA 4PRDB 3EGXA 3P9LB 4XZ4A 5DJAA 3ZE1B 1ROWA 5LNGA 3MRJA 3W11D 3QH3A 1XB3A 1ILUA 1KN2L 4J3UA 5KOVC 1PD0A 3TO4C 2BVUA 4NM4H 3OKOB 4HWZB 4YR6A 3ZTNH 4JO4H 2NYYD 4LSDA 2VWEE 2OL3H 4R84A 3F5WB 3DNKA 3TVMD 3VGGA 2NQ3A 4GBXD 3LX9A 3UXFA 3MX0A 3LRLA 4ZOAA 5CP7A 5HVHC 3GSNA 1L9RA 4WI3A 4JFXB 2NTSP 1KJMB 5ALBL 4XCYA 3HC0B 2VXVL 1NKOA 3QR0A 4LVEA 2ADGA 4HUKB 4L3AA 3TBSA 3QUXD 2DWYA 3EOTL 5F7EH 4DHLA 2P24A 3NESA 4JEGB 1F6LL 2QPDB 2H6PA 4LPUA 3SDDC 4GMSL 2XN9E 3QCVH 2J88L 3NN8A 3H1ZA 3VI4B 3VD7A 1HQ4A 1SQMA 1EJOL 2PCFA 1FYTA 3CZJA 1ADQH 2O6EA 1H3WM 4KRPD 2HTLD 3WFBL 3D50A 2P44B 2CALA 2FQEA 3SE3A 1IGJB 1INQB 2AABL 2YKKA 3FHQA 4HISA 4KDTA 4NS0A 3SE9H 4URTB 1H3UA 4HCRH 3DPDA 5DJZA 4A2EA 5HHQB 3ZKQD 2KH2B 4F2MA 5KZCD 1KBGH 1KIUB 4PV9A 1QZ1A 5GRUH 3V4PH 3ZPDA 3EYVA 1RK0B 3D3VA 3NIGE 4F93B 1BZ7B 1OL0A 3HNTH 5CUSH 2NZ9C 2NPLX 2ESVB 3VB8A 3WHXA 2P46B 3O2WL 4H26A 4JFZH 1KC5L 4TNFA 1N3NB 4IJTA 4EO5A 3T8VA 2O5ZH 5LBVA 4RX4D 5A2AA 3KPLB 2VR4A 4PS3A 5D4JA 5I0XA 5HDLA 2R39A 3QIWA 3CIAA 1M1XA 4AH2B 1KBVA 1V27A 3SGJC 4M8QB 4ZAKB 2ZP0T 4G7SB 5KYWB 4NSKA 3I3DA 3BKCL 3KPNB 2CXKA 3APDA 4G7VH 4L5FL 3ABGA 4UQDA 4P2CG 5AENA 1YYML 1YEEH 1N18A 1DL7L 3FB6A 2B0SL 4ZAKC 5F7DB 3ZYOA 3UG3A 4LDEB 5HPMB 1IGCL 3QWRA 1ZJAA 1WPCA 3O3AB 3DROA 4MJIB 1KGIA 3FUFA 4FQ1H 4FA8A 4FXKA 2VW7A 4AEFA 2J1ZA 4I18A 4JGNA 4NQQA 3DURB 3UTPE 1BPVA 2QLYA 3AAZB 3IRZA 3WEBA 1Y1DA 4NWTH 3VD5A 1AY1H 3DHJA 3QWOA 5MP6H 3ZR5A 5EORH 4LARH 5HD8D 5HJGA 1HCVA 3BQUB 1S2EA 2AJ3A 1OKEA 1DEEA 2L3BA 2YXFA 3CSYB 1KLGA 4OLEA 1ZLSL 1UVQA 1YEIL 3BDYL 3H7BA 2ZSWB 3QW9A 1DUYB 3T6ZA 4WO0A 3WXVH 5DTFB 2H0PA 4QOKB 2ZJSL 1DQJB 4OLYH 4YJZL 2C8NA 1A7BA 1EMTL 3JWOC 1UZ8A 1E90A 3GBNH 4L5FE 4O2EB 3SE8L 5K9KB 1HINH 3X3FH 2Z4QA 1Z32X 5E4EB 1ZKAA 3FONA 3QEHA 4NO5B 3W3BA 3KWUA 2J6EL 3IMTA 3LKOB 3CZEA 5F3BA 4HF5H 5I2IB 4BZ1H 4OQTH 1CFTB 3FO0H 5DA4A 1LWHA 2IXQB 2A9ML 4K9EC 4GG8A 3GTNA 4PGBB 3TNNA 4LVHB 4PIRF 4PVMA 4DVRH 4OFIA 3HHSB 2YUXA 3PDOA 2EEDA 5CN3A 3UJTH 3BKML 3GBDA 1GR7A 2BVEA 4GAGH 4X5RA 1F8TH 5GZNC 2O6PA 4V1DD 4O5LH 1AKJA 5IHBA 5TGBB 3H9SE 3TJPA 1LEGA 4JHWL 5CKGA 1KZQA 3WIHH 2H32H 5IV2B 4R7XA 2PW2A 3VO0A 4GIOA 5FO9B 1S8DB 3G6JF 5LVEA 3L5JA 2N1TE 1F2QA 4NUPA 1TZHB 1W0VA 4KROB 3NFSL 1JG9A 1WK0A 2AJXL 2V6HA 1CLYH 1EUTA 2OMWB 1RK7A 1TCMA 4NRYB 3VRJA 4HEME 2EP6A 2VLRB 3RGVD 2DEWX 2LLGA 2P5WE 4LFHD 1WFJA 2WNXA 3AABA 4WTQA 2BNRB 1E50A 3F7VB 1E27A 4P59H 2IMMA 5LKNA 4R4NC 3KLHC 4N8UA 1KG0A 2NY3C 3OAYH 5L9DH 1IO4C 1HXYA 2Q3XA 4D8OA 2EUWA 3TO2B 3DECA 1X5YA 3PE9A 5GGUA 2M1KA 1R75A 4EI5D 2Y6SD 1BIHA 2FJSA 2FUTA 2I24N 5F3HB 4AEHL 3L08A 4XPAL 4IKLA 3ZHLA 3VD2A 2I60L 2VZ3A 3IM1A 3S2AA 4KK8C 4AMKH 4V11A 3V6OC 1OQXA 4FFWC 2PN5A 4Y2DA 5BMFL 1CL7I 4GIAA 1CO1A 5C0IB 4MHHI 2JKRM 2ZUWA 3MO1B 4QF1A 1BDYA 1J9QA 3BMWA 3GXDA 1KT2A 4HIXH 3H54A 5JW3H 2JCCE 2AEQH 1A3ZA 1I53A 1LGVA 4KQ4L 1A47A 5IZ7A 1F90L 3ATEA 5CAYB 4XPGH 3E6FA 3ULUD 1Q0YH 1BD2B 2GCYA 3MXWH 3CVHH 4PJ6A 4N4YB 5FM4A 5T3ZE 4QO1A 5AYUL 5AVZB 3RGBA 2VLJD 2NY0B 3P4OA 4DTGL 4MA3B 2NNAB 1YNKH 1BYOA 3ETBF 3Q8CA 4Y4KD 1U8MB 4L8CB 2D2OA 2DQEL 4R3SB 4XP1L 5T1KB 4ZW6A 3V0AC 3GJEB 1VLXA 3KJ4B 4AM0B 3ZTDC 4FQQB 2V17H 4PTTB 3I85A 2Z91B 1N8ZB 3L81A 1YJDL 1X4XA 4IOSD 4Q58C 1DBAH 5FYLL 4JAMB 3MRHA 4HOXA 3UYOD 3QQ4A 5CEZH 4JL1A 5GS0L 1JRHH 4ZMTA 2MCPH 1DQVA 4TPRL 1U3NA 5I18H 1MCPH 1TTRA 5CGYD 1CXLA 3N91A 1CDHA 2J1WA 2JJSC 4HJGA 4FZEL 2GHWB 3TZVD 1PZCA 2PCYA 1JN6A 1FFTB 2OMBA 4JFQB 5A40E 2AC0A 2OMUA 2NUPB 3RAJL 1YYLL 5DC4B 3LS5L 2BOCB 3A3YB 4A7QA 3WGUB 1IUZA 1EO8H 4X6EA 4DO4A 4F8TA 4PJBA 1QW9A 5H2BA 4CGTA 4LU5L 3O41A 1IE5A 3CFKB 3DYMA 4E9WA 4UTBA 2AEPH 3ATBA 1BQHG 1ADWA 4YNYB 1OPGL 3BKYH 4K3EH 3ZDZE 1UWXK 3MNVB 1LILA 1F4WH 5EZPA 5HHOD 1AE6L 5CMAB 5F1IB 2KBGA 3KJ6L 2XJLA 4YZWA 5FUOH 3UJJH 4W4OA 4H1LH 1IVTA 1MHHB 5FYLE 1AO7E 3UTQB 5I5JA 2X6VA 5J12C 2H3NA 4LXFA 2Y1VA 1JHKL 2FO8A 4MAYB 3GSRA 1HHHB 4NQSB 1AI1L 1D2PA 4OGXL 4KITB 1JUFB 3DSNA 3QC6X 4N0YL 5F7WC 1NLBL 3IPEA 5FCSH 4PEEA 2CHNA 4M1DH 3US9A 2R0LL 2WQXA 3QORD 1IKNC 3NIFE 2NX5D 4FAAB 1UG9A 5C07A 3X3GH 4MAYC 5C08B 5CD5D 4HSAC 4LEXH 3KGRA 4PJ8D 4X2UA 4OB5L 1CYGA 3L95B 4X9YA 3VNZA 2DPKA 2WK2A 4EN2A 1ND0A 3LKQB 1DN0A 2XN1A 4KZDH 3HI6H 3O45A 3FO1A 3GSNL 4F3FA 4BA8A 5DJDB 2Y72A 3NG5A 4QRPE 3PNWB 4CW1A 5B1JC 4K7FA 3RWEB 1YN7B 2L04A 3BVDB 4PGZA 5FM5M 5HGBA 4WWPA 1JGUL 1I8KA 1NQBA 2CNYA 3CG8A 3ZKND 5HYSG 5D1QE 2YSSB 3T3MB 2XWXA 1SHSA 4P57B 4C83A 5MEOA 4LLDA 1NZRA 3US1A 4UUJA 2C4XA 2ZXEB 3EYUL 4R7NA 3FH8A 1Q72L 4K2UH 4DP6X 2G3XA 3NA4A 3VFPA 1X5ZA 1GMIA 4RH4A 5AVSB 4AI7A 3O11B 3MRBB 5LG1A 4C4KO 2JJVA 3KVPA 3BYYA 5B39G 5E8DH 4DZ8A 4ZW5A 3GSOB 4LSTL 1PG7H 2BC4A 2NXZD 1JGVL 3ECBB 2FH6A 4TS6A 1HZLA 1RZGB 3GJFA 4JGMA 5FDWA 4GP4B 3C5JA 2EUXA 5LLIC 2NSQA 2WOYA 2A99A 3I3BA 1FZKA 4XN4A 1KLUA 2HPOA 5C0FA 1PYWA 1MY5A 3QXWA 1KELL 4BFOA 4MS8C 3D9AL 4K94L 4ADIA 3CBJB 3TCLB 3UZQB 1OSPH 1D3CA 5FW8A 3HE6A 3ZT6A 5B38G 2QL1A 4S1QL 5I16A 2RJMA 4CN4A 3MOAH 5IW1A 5D8JL 2B3IA 4LVNC 2TSBA 3VRLE 3OV6A 4BGLA 3LV3B 1RUAH 3DMMB 3MVSA 5CR1A 5B8CC 3SGKC 1DLHB 2C34A 2GK2A 4NFBA 4P9HH 4G5ZH 8FABA 4NQCA 3UAEA 4IIQB 1FYTE 4HVBA 3DYPA 3WS6A 1F1AA 3OJDA 2ZKHL 1GYCA 3HVNA 1TJHL 5FGRA 1YQVL 4Z7OF 4MJ4A 1PSKH 1ZMYA 1KCUH 3H0TB 4GKNB 1BWMA 4KXZH 4OLZL 1LHZA 3TURA 4NNPH 3PWNB 5DHDA 3ZE1F 4IIQC 5J9PB 1W9XA 2YS4A 4JFDB 3I74A 4LOEA 1EHNA 1R3LA 5EEZA 2XZAL 3Q8FA 3H3PL 1ZVHA 4F2ME 2ZG3A 4PD4J 2FSEB 2B20A 3P9MA 3PWLB 4TNWF 5AW1B 1YUHA 4Z0XA 2XG4A 3E9TA 3D3VE 3KPRD 3OR7B 4LLQB 3KEDA 4JREB 2XX0A 5E6ZA 4AZ8B 3KLAA 2NZ1A 2WXKA 3IFNL 4RGNB 1WZAA 5T5FH 4BFFA 1PY9A 2JKXA 1L6ZA 3EFDH 4MYPA 4AYFB 2H1PH 5FO7A 1N2RB 2VO5A 4LLWA 1QAWA 4JREC 1FNGA 4M9OA 5FLVA 3FCSB 4TRPH 1VFBA 5AKSA 5DK3A 4RGNC 4P46D 3UJIL 5C97A 2ZUTA 3MYZA 2IQ9L 3C5SA 4J7RA 4N28A 4JFYA 1KSRA 2V5YA 2B08A 4H1LG 3ML9A 4HUVB 3OKDB 1O7SA 2XU9A 3G5YB 2Y7NA 4BFKA 3RKDC 3JUYA 2ZX6A 3EFFA 4K7PL 1D6EB 4ABUA 4AJ0A 5E1GA 3TA3D 4EIGB 4Q6KA 1ZE3H 5CP3H 4YHLL 3TEYA 3VI4F 2OZ4A 4ZX3A 5KANI 3GNML 1WSST 3MV9B 3P0YH 2F7OA 3BUYA 4YHNB 2E4TA 1M7IB 4CNIA 4ZXBA 1A8ZA 2BP8B 4N2FA 1ETZA 3DBXA 1TMQA 3BP5A 4DGYL 3AMKA 4XNYH 1KIQA 3ISWA 1VEPA 5F0MB 2VQ1B 2A6DA 2CM6A 4ABQA 2YPLB 3O6ML 3O8XD 2ZYHA 4HXAH 4D94A 1ID2A 3TO4A 2AERT 2YAEA 4HUUB 3WLWD 1KCRH 4PREA 4L4VD 1UT9A 4WJG3 3R8BB 3NCBB 5IY5B 4JBSA 4NKMB 3VFWB 1SDDB 4L3EA 4AJVA 3LRMA 3WTWA 3S8GB 3Q2LA 3PU7A 3FYEB 3ORJA 4QTHA 1X7QB 1XD1A 4XCFH 4KUCD 1EZSA 5D5MA 3KL3A 1MRFH 2ITEA 4HJSA 1EZUA 4BSVB 1I9JL 2Q76A 3MQIA 4PD4K 3VUAA 3RWFA 3C6LB 2YQ2A 3ULVF 1S7VB 5FLUA 5IKCA 3QA3B 4Z6AT 2XXGA 5I1LA 1G7QA 1YAZA 3QJTB 1M4KA 2F74A 4ZOBA 2B16A 3BVTA 4PRBB 4R8WL 2P5WB 3L4VA 3CDGA 5DURD 3TJEL 1J9SA 5HYJB 3ZHKA 4A39A 4DO6A 2HKFL 1UD8A 4MSWB 3S5LG 4X98A 2OFQA 4BQCA 2ARJQ 4M4RA 3VSUA 1D5IH 2XY2A 1ZANH 4Z77B 5F93C 4TNEA 2FL5B 2Y4SA 1UKTA 2FRGP 1ZV9A 2UX7A 2WYHA 5BZDA 2QQNH 1FV1A 4F5CA 5HGHA 3QQDB 4TOYL 2WBJD 3VFSA 5ID0B 3BVWA 2OP4L 3ZKMD 2R69L 1R47A 4TQIA 1J87A 4KV5E 4U1LA 4NFCA 3RPIB 2YPVA 2JKWA 3L1OH 5GHWL 5IT2H 4B9CA 1E4KC 2LV4A 4PJGB 4RFEA 1MCSA 3INUL 1BIIB 1N64L 2LOEA 2Z92B 4O2CA 2N7BA 2YD4A 3L9EA 3GHPA 2Y07L 4DFHA 2ARWA 4NO2A 4MQTB 3EO9L 3QUYB 4I89A 3BO8B 4BFIA 4AYEC 1A3LL 3WIIL 4LIQL 4PG2C 1XH2A 3V4UH 1T66C 1EXHA 1J86A 1I3GH 5DD0H 4DP5X 1COBA 3QJXA 43C9A 1CDBA 4PLNC 1XL6A 1UC6A 4J23A 1IM9A 4ZPVB 3C60D 4PG9B 4RRPG 5ACZB 4HPHA 4HUCA 3SGJA 4OZHB 1JI1A 2OSXA 1P4BL 4PRID 4XX5A 5FF6A 4I5BA 4RETB 1PKQA 4QRRA 3T5WA 1FZMB 1UM4L 1G6RB 1KBWA 3U7AA 2A9NH 1QVOA 3CLFL 4EQ3A 4MD5B 1RL1A 2XLLA 4PJ5D 4J3VA 2D2CC 1VPOL 4CMMB 1RJZB 1MLBB 4IDJH 2IADA 5FHAL 4UTBL 1N6VA 2ZUYA 3C8KB 3OKLA 1G5AA 4E9YA 2WKOF 2MOQA 4ZTOH 2K3TA 3N06B 1MVYA 4MXWL 3SPIA 5IBUG 4JANB 1JP5A 5JOFA 2BIMA 3T0VA 2EDBA 4LIQE 3HOGA 4KVCL 1JGDB 1I8LA 1OALA 1YNTA 4PJEE 1I7UB 3TVMB 5IR1A 4GBXB 1ZVSA 3AJ7A 1RZFH 5ADOH 4P4KD 3U83A 2Q20A 3ME0A 4HC1A 5DWUL 5I6XB 3VH8A 2OAAA 4JPKL 5HVGB 5T33H 2KC0A 2ADFH 5C0DA 2Y9RT 3ZDZB 4UIMA 3U7YL 2CO1A 1FDLH 1UWGL 1Q94A 2H7WA 2EVJA 4PBWD 3W37A 1UM5H 4I0PC 2LW3A 2WXMA 1CIDA 3HHMA 1AO7B 1O9ZA 4WHDA 3T04D 4Q0XL 4URKA 4JRXD 3MLVL 2VIRA 1FH5H 1JWMB 3QJQB 4PJBE 2YXMA 3RG1C 4OJFL 4Q9QL 3QUXC 4NGHH 1BBJA 2PYFB 4W9LC 3AT8A 5I5MA 3AQYA 3NTCH 3RIAK 2VABB 4NLHA 4UQAA 4NEHB 1YEFL 4K8RD 4KHXL 4KRPB 5GZNA 4FYQA 5TTRA 4JY6B 4S1DD 2LVEA 2YLHA 3FTZA 3L3HB 1UT1A 2FT7A 4NOBA 1QWHA 2Y36H 4FQHB 2NT0A 1PZ5A 1NOFA 4K5OA 1DBBL 5TFSH 1ORSB 3OR6B 4MQSB 1BGXL 1GZPB 4KRPC 2HTLC 2JMRA 2X3AA 4U3CA 3T2NL 5IHWA 5KZCB 2YAHA 3BKJL 5AB2A 3HFFA 3DVGB 4OQ1A 4EKJA 3CPUA 2YC1A 1S7XA 5C07E 4YHYB 1J05A 2RGSA 4DNLA 2ENJA 1MHCB 2QADD 3SODB 4FI8A 2FECI 4HWBH 5JMOC 2BNUB 4XVJH 5BV7H 3ESOA 4MXVE 1SMAA 3QYCA 3KPPB 4NN7C 5JYLA 1I3VA 5LXGL 1XCQB 3C08L 4FYSA 2I27N 1C8PA 4AQ1C 4P4RB 2VXQH 2XQ0A 5EZIH 4X4YA 1ZJBA 2ZAIA 3TBTA 1NCTA 4FZ8H 1LO3H 2CPCA 5EZLB 3LNHA 5KYXA 2DJUA 3NJXA 3IGAA 2AV7B 1L7IH 5CP7B 5IFAL 4E41D 2XX1A 4HZ1A 4BZ2A 3UTTA 3C2SA 4MDJB 1UACL 1MJJA 4PTUB 5HI3C 4KI5E 1A1OB 2XUWA 4RFOH 1OAKH 3VQ2C 5E9NA 2WSPA 1ZXQA 1HEZA 4AITA 1E4JA 3QEUA 3QR2A 1UURA 4JO2L 3PHAA 2XZCH 2AXGB 5D2LA 3QWNA 1QPKA 1F3DH 3GEFA 2GTQA 5IROA 2CDEB 1E0OB 4JG5A 3IVKA 4JKKA 3UABA 1OP5K 3QZNA 1XSIA 4NPYA 3IDUA 4GP8B 3V6ZB 4B0MB 1DQLL 2NW2A 3S35X 4LSSH 1INEL 2ZWYA 4YVNA 3LHPL 3AS0A 1UXLA 1GA2A 2JJSA 4ZT1A 2P7TB 4QHKJ 3R7QA 4PV9B 4H0HB 4NQCE 1CU4L 4M62H 1EEUA 5DZAA 3EYVB 2VDOL 3RL1B 4RMWA 2NY1C 4U1HA 3BAEL 1S7WB 1G43A 2V2XA 2QR0A 5TE4H 4CKQA 3SZ6A 3T3MF 1KEGL 4OCXH 5INCA 4HH9A 2HAZA 2BVQA 4OGZA 3UTSA 2L4OA 3KLDA 3RWHB 4OCRH 5C0JA 1DBKH 4S0TD 3FQXA 2OZ4L 4X80H 3U4EA 2D3LA 4AX3A 4HCGA 1M1XB 4Y19D 2XA8H 1LVEA 5FK9B 3RGVB 3W81A 1AGDA 1FCCA 5JDJA 4YLBA 3WNJA 2DMHA 2DB8A 3FO9B 2IEPA 4PW9A 5ANMA 2OL3A 2X1WL 4W6YB 5CJOL 1FVDA 3A47A 1IKNA 4OIAA 4WNQB 1OAYL 4A7UA 4UNTA 3CVIH 5D4HA 3OX8B 2R1YB 2V5RA 1H3PH 1L9OA 3SYOA 4BFJA 4LLAA 1A9VA 4EI5B 2GBUA 1YO4A 4UQBA 5F1NA 4ZS7L 3UPRB 1PDKA 2CKNA 1VZIA 1V7NH 1UHVA 2FX9H 5DLML 2WZPA 3HS9A 4NZDA 4L29A 4F7KA 1FO0L 3A21A 2D7TL 3QWOB 3L3JB 4ZPTA 1HTYA 4D2NA 3ARTA 5T1JA 2IVFC 5B1JA 4QXUH 1T1WA 4B41A 1K5WA 4JFTA 4P5MB 1DEEB 1MRDH 2GBVA 3PLYA 4Q2ZB 2ICEB 3O2DH 4JCMA 2R0ZH 3TBVA 2XQBH 1MCRA 4RAVA 3IAQA 4NKOA 4AUYA 3K72B 1EJFA 2PTUA 4TVPD 1BBDH 1CB4A 1GPOH 2ICEC 2VLJB 1QQDA 5FFGA 2W94A 2YHGA 1Z5YD 1HNYA 4GEIA 3B34A 3TNMB 4Y4KB 3MA7A 2FGWH 2HRPH 5DRZB 4JR9L 2A6JA 3ARDC 4ERSH 5K5YA 1CL7H 4GG8B 4HCRA 5C7ZA 3QXTA 2JJTA 4L3EE 5CZVH 4FNUA 1AG6A 3PDOB 5FA4A 2ALWA 3KVDD 2FJHA 4Y4KC 3V4PA 3F01A 1HWHB 2XIDA 3M1BB 2YFOA 1AP2B 1F4YH 2R29H 3EH1A 1MHEA 4XAWL 3I6SA 1AKJB 4LLMB 4A2LA 4LCIH 4KRMB 2YPVL 5D5ME 2PW2B 5TQ0L 1QR1A 1NJ9B 1XGUB 4F8PA 3KMDA 1KTLA 3SKJH 4XMKH 2P47B 1CI3M 1HE8A 3DI2B 4ACPA 1NCBH 1W0VB 2FZ3B 1FLRH 5DRXA 3CFCL 2FGZA 4R7VA 4JX0A 3ZVVA 3N42B 1M2OA 2X4UB 4P99A 3RVUC 3ZL4L 5ADPL 2CO4A 4IU3B 2I9LA 3TZVC 2YGVA 2YD7A 1HE7A 5B8CA 5CHNA 4WIQA 3SGKA 2EDJA 2A74C 1U9KA 5F7NC 1XTMA 2J7LA 3I9AA 5HHOB 2ROYA 1Z0NA 3HW7A 4NQDA 5CBAA 1OQOA 1PY0A 3T3PE 6FABL 5FS5A 2CXGA 3ARED 4OW6A 4F5CE 3LXCA 4JNXA 4YDMA 2H47C 1JSYA 3CJJA 4Z8FH 4F57H 1P84J 3CFUA 4PYHA 4F8NA 4F27A 1QI5A 3ARWA 3K1KC 3MCG1 3KYOB 4MMZA 4OAWA 2YOCA 4MB4A 4XN8A 2CSPA 4KXCA 4BE6A 3OGCB 2VMDA 1HYSC 2HFFB 3QORB 5TK4A 1WEJH 1CE6B 3BJ91 2NX5B 3ZBMA 5J6GA 2C1OB 3B9VA 4TTDD 2E9IA 1BQHA 2DKUA 4LSVL 2C1PB 4LBAA 4PJ8B 3MLSL 5GRXG 5FA3A 3LKRA 1JWUA 4KJWC 3AS2A 4APQA 3MHZA 2ENQA 4UILH 2D3JA 2IFFH 3C09C 4MQXD 4Z3EA 2J5LB 4HC1L 1ICTA 3WFCH 3OKKA 2I5YL 3V79C 5AOIA 5C71A 3VD3A 2WXGA 3G3LA 4XNDA 5CIPH 4B9ZA 1E67A 4NKIL 3JWOL 1PKQE 4QRRE 5FM8A 4WUKH 3VX0A 5KBPA 1UWEH 3EGDA 3VFVB 2A4CA 3DK2A 1KCVL 4RZCB 3VXSD 4QCIA 4PJEB 1RIHH 4PB9H 1Q1JH 1HKLL 3PJSB 1TCRB 3HI5H 1ZT7A 3VDBA 5FB8B 1GRWA 4GQ9L 1I9IL 4EN3D 4XP4H 1Q9KA 4X6DE 1YUKB 1JD9A 2QZQA 4JDZB 3HS0B 4J3SA 2CH8A 3ECVA 4A1RA 5JHDD 3OLGA 4B3EA 2NXZB 3LSOB 4OV5B 1E3ZA 4A66A 1JN6B 1EZVX 4XHQA 2D0HA 1ECYA 1P7KA 2HX8A 3M88A 5JXED 4YHPA 3X1NA 4LRNL 5BRZA 4QLWA 3AWGA 4X6EB 1J5OH 2BHYA 4ISVA 4PJGF 5H2BB 1AOZA 3BWUF 1MAMH 3N41B 1S7QA 1OAQL 4U6XB 1K6QH 4WI8A 4N0FB 4JZJC 3NPSC 2EECA 4G8IB 3A6CL 4CVZB 3SDAC 3WIFA 3FZUD 4FKEA 4Q9RL 4HGMA 3WS3B 5E6UB 1P84K 5DUPH 2W1NA 4Z78A 2WIIB 5BUAA 2AEOA 3ZE0E 5EIIB 5KOMC 1P53A 3HG5A 4R4FL 4OCWH 3CHXA 1TEGA 4AV0A 1OVZA 3EUUA 1MWAA 1RSFA 4YUEL 3F7YB 3HPLA 3FJTA 4LPTA 1HH6B 2L7JA 4MHHG 4ZG1A 2CLRB 3D1MC 1BFOB 2ARJA 3L4CA 4RMVA 1WVZA 3DRTA 4YXHH 3QPXH 1Z5HA 3M17B 2FVNA 4GSDL 2OJEA 5B38A 5I82A 4GAFB 3PWVA 4ODTL 1B9ZA 3M7FB 1CLOL 5FUZL 3IMSA 5E2JA 4BZ2L 2J2ZB 3KPRB 4K7FB 2CIKA 5T5NF 2C5DC 3HE7A 3Q05A 3EOAA 4DQOL 3MAWA 3D2TA 1SOSA 1MFAH 2O6DA 2ZG2A 3G6DH 4FI7A 4E68A 5KYUA 3STLA 2NNRA 1D7FA 3HB3C 1CTMA 1U8PB 1Z0MA 5AOKA 1E4KA 3LN5A 4FNRA 1RZJH 4MMXB 1GGUA 2ORBL 1FRGH 4U3XA 2A5UA 2PABA 5IJKC 4FDWA 3ZDZF 3WDHA 4X7EC 2EACA 5K1NA 1ITCA 5D93B 3OKYA 3F58L 5D2NC 1ZLVH 4UOJA 4P48A 1DANU 2VDMH 2NSXA 5AZEH 3UIZA 4MMXC 2CAKA 3DHMA 1XO8A 4FQJL 4P46C 3D52A 3GJFB 2ZIDA 2JIXD 1OGTA 3TA3B 2D31A 1DVXA 4XC1L 1NAMB 3FUDA 2XBDA 2BSEA 4P23D 4NRZA 4LL4A 2P8MA 2FHBA 3UTTE 1AYOA 3NQKA 3SBWC 1U58B 4XC3H 5DJ6B 3BZEB 4UAOC 1KLFA 3L9RB 5GJTH 2XWJB 5ESAA 5CCKL 1IRAY 2QQKL 4PHZA 4RIRB 4Z7UB 1PZAA 4R6UA 4DESA 4EBQL 3KWWA 3ZRCC 3WUZA 4GW5A 3B7UX 1BVZA 5D2LE 2L7UA 2UXVA 4X8GA 2AK4A 3QYMA 3BEVA 2PKDA 1P5VB 2W0LA 1ZLWK 1QMUA 2X12A 3O8XB 4LHUG 4E9VA 2G30A 3TIDB 2IAND 2ZCLH 1FGNL 4FFYA 4L4VB 4XN1A 3C5ZC 3WJMB 2IBZX 5I1AA 2XKNA 3CLEH 1C7TA 2DQHH 1G9MC 2YGNA 4WW1B 2O5XL 5B22A 3X12A 4B9KC 3GIZL