2AQQA

Cu/zn superoxid dismutate from neisseria meningitidis k91e mutant
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
155
structure length
155
Chain Sequence
ASIEVKVQQLDPVNGNKDVGTVTITESNYGLVFTPDLQGLSEGLHGFHIHENPSCEPKEEEGKLTAGLGAGGHWDPKGAKQHGYPWQDDAHLGDLPALTVLHDGTATNPVLAPRLKHLDDVRGHSIMIHTGGDNHSDHPAPLGGGGPRMACGVIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title CU/ZN superoxid dismutate from neisseria meningitidis K91E mutant
rcsb
source organism Neisseria meningitidis
molecule tags Oxidoreductase
molecule keywords Superoxide dismutase [Cu-Zn]
total genus 36
structure length 155
sequence length 155
chains with identical sequence B, C
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2005-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 2aqqA00
1P1VA 1OEZW 1DSWA 3F7KA 2GBUA 2ZOWA 1E9OB 1SPDA 2AEOA 4MCMA 1MFMA 1BA9A 1IBFA 2VR8A 2WZ6A 1S4IA 2WKOF 2AQQA 4BCZA 2WYTA 1YAZA 4OJAA 2ZKYA 4A7UA 1XSOA 2AQRA 3MKGA 1DO5A 1OZTG 1RK7A 4A7VA 1IBHA 3KBFA 3ECVA 2C9UA 5CU9A 1F18A 3S0PA 1N19A 5KBKA 2R27A 1PZSA 1YSOA 3GTTA 1HL4A 1FUNA 2WZ0A 3MNDA 1CBJA 2XJLA 1F1DA 1Z9NA 1OALA 1YAIA 3CQPA 1SDAB 4BD4A 2C9VA 1JK9B 2XJKA 3T5WA 1TO5A 3LTVA 2AQNA 2ZKXA 3F7LA 3HW7A 1UXMA 4U4IA 3GZOA 3HFFA 3L9YA 2AF2A 1SXNA 3RE0A 2SODB 3PU7A 3CE1A 1CB4A 1QUPA 2Z7WA 5KBLA 3HOGA 4A7GF 1SRDA 4A7TA 3GZQA 1SOSA 1U3NA 2WWNA 4MCNA 2AQPA 3GZPA 3ECWA 3H2QA 4BCYA 1SXCA 1SXBA 1N18A 4A7GA 1F1GA 1L3NA 1EQWA 3CQQA 1TO4A 1IBDA 1OAJA 5KBMA 2VR7A 2VR6A 3GQFA 4B3EA 1KMGA 4A7SA 1E9QA 2GBTA 1Q0EA 2K4WA 2JLPA 3KBEA 1E9PA 1COBA 1IBBA 1SDYA 2LU5A 3GTVA 2WYZA 3KH3A 1B4TA 1B4LA 1OZUA 4A7QA 2NNXA 2Z7ZA 1E9OA 3SODB 2APSA 2E46A 4OH2A 4N3TA 2AQSA 3K91A 1PU0A 2GBVA 2Z7YA 2C9SA 3H2PA 1F1AA 4FF9A 1XTLA 2WWOA 2JCWA 1HL5A 1E9PB 3KM2A 3KH4A 4N3UA 3QQDB 1SXSA 1E9QB 1SXZA 2Q2LA 1AZVA 1Z9PA 1SXAA 1ESOA 2E47A 1PTZA 3QQDA 1IB5A 2WZ5A 1EJ8A 4L05A 1JK9A 2V0AA 1XTMA 3KM1A 3ECUA 2AQTA 2WKOA 1UXLA 3L9EA 1BZOA 2Z7UA 2ZKWA 1JCVA
chains in the Genus database with same CATH superfamily
4KKBD 3WIHH 2Z8WC 5JO5B 1BXVA 2PWHA 1H6FA 4GKLA 4FQ2H 2O5ZH 1YYMH 3Q44A 3U6RB 2MTPA 3O6FB 2IANE 1S7SA 2R69A 4X6EB 2J1YA 1FL5A 4Q4EA 4BUGA 4YL4A 1KBGL 2ILLA 1GH7A 3NAAH 4B9PA 5EA0L 3GIVB 1KCUH 3ULUH 1P6FA 2EUXA 3EDEA 4MNHB 3I3DA 1S5IH 5BUPA 5CP3A 1K6QH 3G5VB 4I85A 4UDTB 4HUUA 3PWNB 5C6TH 5DHVB 4CU6A 4OM1L 1MI5A 3WBDA 1K2DB 4RQQB 1JAEA 1J0JA 3REWA 4Y9GA 2NW3A 2R29H 3BSGA 1OHQA 2Q86A 5TQ0H 5HYJD 3IDJB 1WBXB 1OTSD 1FZJA 1QFUH 4P46C 4XRCB 3QNZB 1TQCB 2ZP8A 4PLOB 2W92A 1GZPB 3ARED 2G5RA 4OZFB 2OQJA 2OZNA 3NCCB 3NTCL 2CO2A 4FXLA 3S36L 5CD5C 4JFDD 1I4FA 3UBHA 4OGZA 1H3XA 1RHHB 3FTGA 4WF7A 5JLZB 4GS7B 3CCHB 4HD9A 4WZ9A 1BFTA 4L4TD 4GXVL 4KUCF 1FG2B 1I7TB 2QV2A 3FTSA 4M7LT 2VXTL 4OFQA 3ZXAC 4AUUA 1VADA 2KHAA 1U6AL 2DQ6A 2FQDA 4XE0A 2GJZB 2XFXA 3I9GL 4NJAL 1F4XL 1A4KB 4U05A 4AM0B 3KG5A 5BVPL 8CGTA 2VR7A 4IHBA 4DFIA 6PAZA 4B3VA 5ECJE 4FQXA 4ETYA 3FBQA 1BPLB 4NQXB 2AK4D 3PV6B 3U6XA 2EEAA 3WDIA 2PWFA 1CZ8H 3FT3A 4UV4H 4XPFL 1GS6X 1ET8A 4LL1A 1KGYE 4UIMB 3VRLE 4ZXBB 3HZMA 3LMJL 2BNQE 4M7KL 1MCHA 5KS9E 4NNXB 4L1LA 4DFHA 4IIQA 5JHDD 4JO4L 1U92B 3NJXA 4ACTA 1IZKA 2X09A 1UHVA 5L2KD 3LN4B 2EH7L 3TTYA 4PMFA 5KVFH 4EUPG 4OI8A 2EKSA 1JVLA 1JF5A 1JTPA 1AGCB 5DC2A 2WTRB 4OLEA 1EGJA 3MA7A 2YD9A 4GY4A 1PTZA 1ML0A 3NFNB 3QWNA 5BXFA 4L05A 2HJLA 3T4YB 3V4PA 2YMXH 3AABA 1JFHA 2F18A 5FFOA 1EJ8A 2F5BL 2G9HA 2VMCA 1UGKA 5T1DH 3S37H 1YEJL 5IB3A 4IIQB 5L88H 5F3HA 4GINA 4W70A 3WNIA 5KAQF 3QSKB 3WL9A 1BVKA 4PY7B 3MJ8A 1AY1H 4HJ0C 1E4WL 2PR4L 4JMNA 1KACB 4UIMA 4HMEA 5CKGA 3C5JB 5LGYA 1HQ4B 3BH8A 3K3QA 3P02A 4C54A 3WFCL 1YAZA 1IO4C 3KLHD 2AVGA 3LQAC 4LIQL 4GKNA 4NIKB 4NQCA 4OT1L 1BMZA 3HC4L 1GJWA 3QZWA 4HIEA 3Q8CA 3QQ9C 1G7IB 2C7UA 2CKNA 4S2SA 2CXGA 4FQJL 2E4TA 1P7BA 4FXGB 4M3KB 5CZVH 2XG5B 2DWDA 2R83A 3PHOA 4XAWL 4P04A 1MHPH 2CGRH 3ET9F 5EC1A 2ZG3A 1P2CB 1MREH 1YVLA 4GEJA 3WHXB 4AGPA 2YKLH 2JTYA 1WTLA 4AMXA 3EFOA 3LEVL 3P4OA 5HGAA 1EHKB 1K9TA 1UQSA 2F8VA 3TBWB 1L6ZA 4LASL 4QHUB 2QHRL 5CP7A 1BQHA 2H0EA 4QRAA 3BP4B 4AE0A 5GRUH 4FHKA 5CEXA 5IZ7A 3EJYD 5FUCC 4IDLA 1CLVA 4W9KC 4Y9BA 2VABA 1RZFL 1RZIB 2FBOJ 3N43B 2XETA 3SJVA 5CFHA 15C8H 2XN1A 4HS8H 4LF3A 4XBEH 3NZSA 4W9FC 1BXUA 1CLZH 2BHUA 1P7KA 4NXSA 4ELKB 2V5SA 5E5UB 1IAKB 3ARWA 3AUVA 1IC7H 4Y89A 3VTMA 1SN2A 1A9BB 2J3SA 2Z93A 3FUDA 1EBAA 4OZIF 5JQHC 4KQ0A 4XP1L 2ZWSA 3N1MC 4X50A 5L4MA 5JHAA 2V17H 1KLUB 2F74B 1W9XA 4LAQL 4ONOA 3VFMB 1MRFH 5IB1A 2CDFB 4H13C 2P8PA 5EBMB 2H0FA 1M7UA 1TJGL 2AJUL 2UZPA 3HG2A 5HI4C 4NP4L 4NUJA 3AVEA 4JGUA 4HPYH 3BHBB 4KGLA 4OCYL 4NWTL 3BDYL 4WY7L 2PO6A 4ZW3A 1LEIB 4WTXA 4NFDA 4OJCA 4YAQB 2E9JA 1WO2A 1BEXA 3LXBA 1IJ9A 2P7TB 4HCIA 3VFTA 5KJ7E 4G82A 2GUOB 3MDJA 1GZHC 2DIAA 4YDJA 2R0WL 3H42L 2DQEL 4HH9B 1R3HB 5EIVA 5LAXA 2VXUL 5D1ZI 5HJDA 4NKMA 3D0LB 1S7UA 3BUDA 4L48A 2GKIA 2Q8BH 3ZHFA 1JIBA 1TKWA 2ED6A 3A4AA 4CU8A 4FTDA 1YA5A 3FFCB 1U8IA 4QTIL 5I6MA 4LFHG 4TVSa 3SE3A 1JNHA 3QHZL 3PXHA 3F6LA 3WOVA 4TUUA 1J88A 5EUOE 5CFAA 3L2MA 1DCEA 3L7EA 4XWGL 1NBVL 4HAFA 2ZKYA 3HMXA 4K15A 1F02I 3ARBA 4NENB 3CSFA 4IOSD 3F12A 2OZ4L 2YAHA 4G7YL 3CSYA 1IAII 1E5BA 1SYVB 4P2AA 3VI4F 2ZCHH 3RY4A 1R4XA 1H15B 1W8NA 3DURA 1R75A 3DBXA 1CLOH 4NHUA 4F7EB 1CGSL 2VRQA 3II1A 3KPOA 2C7FA 2VXQA 3X12A 4FHJA 4AOFA 3MLPA 2FEJA 1KEGL 4YS4A 1AG0A 2RACA 4PBXA 4WEUD 2P43B 1ETZB 5F9OL 3TJEL 4G8AC 4NKMB 3QEGL 4LLUA 1YDPA 3QEQE 3ZTNL 4PRPE 1KN2L 5DMGD 3WIHL 3B83A 5ELIA 1HCYA 2ALAA 2V3EA 2OS7A 2X0WA 4XOAA 3CDFA 3EJJX 2VC2B 4ZUTA 5INDA 3GHBH 2D0GA 3NVQA 1DBJL 4LGSB 4ZOBA 3HS0B 4HIHB 5F7MC 1OP3K 3W82A 2KPNA 3QUZD 3AM8C 4KKZA 4GRWH 2K3TA 2ZSVB 4O9HL 5IW6B 1B4RA 1O7VA 1QBMH 3UTTE 2V7NA 5I19H 4P9MH 4DCQA 1MIEH 9PCYA 1HIML 1CT8A 3DX8B 5KJ4A 3K2MC 2A6IA 4G72B 1J8HB 4NQSA 4CSPA 2Y7LA 4FJYA 2EE3A 3HJEA 1GOFA 1L0PA 2JI2A 5EF3A 3LZLA 1QA9B 1CGYA 1LO5B 4G8EA 1X5LA 4JKPH 2AV7B 2OR7A 4V2BA 1DN0B 1J9TA 5F7EH 1Q94B 4Y1AA 3I50H 1QLFB 3EFDH 3FAXA 1FZMA 1KFAL 2VM9A 5CJXC 4E36A 1OE1A 5EU6D 2EDBA 3GLZA 4K8RH 4OLYH 4ELMF 4WEMB 1OF0A 4PWKA 1WFTA 4JHAL 5HVWA 2YQBA 3KDMA 3CDZA 2V3FA 4ANUA 1JNJA 1BZEA 3BH4A 4ATTA 1R5IA 1IB5A 2VDQB 3HS0C 2O61B 3F62A 2P5WD 1WBYB 2UZXA 2WLYA 2BK8A 3O4LA 4LCWB 1KELL 1U8QB 2CJSA 5ES4B 1CFTB 1U3ZA 3FUKA 3UBXI 3TCTA 4HKBA 1OE3A 1EHAA 4FDWA 4G6JL 1JK8A 1P5UA 2P8MA 2Q3XA 5FA4A 1IL1B 3MRHA 4IU2A 3B2XA 1O75A 4Y16A 4Q14A 1ZT1B 3GI9L 3HMWL 1VB9A 4A7UA 1OCWH 5JW4R 3RKDC 1Z9MA 2XTJE 2H2SC 2WQSA 2VZVA 2Y36L 1YC8A 4M8UA 3K80A 2H0PA 2YAPA 4HOXA 4KZDH 3DX6A 1FJ1B 4N5UA 3MV7D 3QIWD 1SN5A 2VO8A 3C6LD 4HAGA 3D4ZA 3I6KA 2EO7A 5DI8A 5FF6A 2OZ4H 1HL4A 1QW8A 3KCPA 4G59C 1B0RB 5ACMA 1XIWD 4POUB 3DIVA 5IB3B 1CF1A 3ESMA 4ZFFA 1QPKA 3W9EA 2YUXA 1O6TA 4JM2A 3KJ6H 4HW6A 1NGPH 2I7SA 3CZGA 3O2DL 4G3YH 4P06A 3MJ9A 2YA0A 1B88A 4TSAL 1IBGL 1IT9H 3BN9D 1UA6L 1UOWA 4K7FB 3UTSD 3EXJA 4BUHA 3BX7C 4A66A 1UCTA 4DSYA 2OL3L 3KVPA 5C0RL 2QQNH 5D7IB 4OKVA 2J5WA 1G1OA 5GRWA 2NY1D 1JGEA 3D69B 4IDJL 3UCQA 1BF5A 3VFVA 5SWZD 2VSCA 4PVLA 1G7PB 4PJEE 4XO5A 3IRCA 3BESR 2PWEA 1YNTB 2PETA 4PJ5B 3QYMA 4JPSA 2EILB 5HYSA 1MN4A 1VSCA 2J88L 1UACH 1VFUA 3FW6A 3ATFA 5CZXC 4N2LA 4KDVA 3F8UB 4M62L 3SN6N 5IFJB 1ULVA 4KUZL 1BWMA 5F6IB 2XZZA 4QXGL 4UM9D 3TJHD 1GGCH 1F4WL 3WKQA 1K8IA 4K3EL 3VCLA 2KQNA 4YDIL 3KH3A 2HN7A 3KJ6L 3NABH 3WELA 1I1FA 4D0DA 1KT2B 1FL6A 1OARH 2V2WA 3QHFH 1UWYA 2HRPH 3IU3B 1DSFH 4YZWA 1FF5A 5KVDL 4OZ4B 5FO9B 4G2AA 4NO3A 1NFDF 3G04B 5F21B 2HLEB 1D5BB 1F11B 2WWOA 3PP3H 3BD5A 2CZNA 4Q9QL 5HI5C 4LEXL 3UC2A 3QO1B 2QSVA 4GLRI 4YC2C 1RZPA 3IGAA 3AWFA 4E41E 1GPOL 2IADB 4LSPL 3UYRL 3NZHL 4MMZA 3ARVA 1WAAE 2V9RA 3ECUA 4JY5L 1WBXA 2MNWA 1HQ4A 4PGDB 4Q89A 4KNSA 5GRUL 1PKQB 1J9RA 2JJSC 5MP6L 3AQDA 3U4BH 1OGAD 1X9UA 3A24A 3L5IA 4EQ3A 3ZYJA 3GJFK 3TWCL 1H6TA 3BD3A 5GGQH 3REVB 5E8NB 4PRPA 3IE4A 4GRWF 4PREB 3NGBB 2IH9A 4Q6IC 1PS3A 2FATL 3FQRA 1EHLH 5I9QB 3FU5A 1EZUA 3CLEL 4I0KA 2DYRB 3V10A 1KJ2A 1PJWA 4HKZB 4M3JA 3JBG7 5GS2H 2NNCA 3D50A 3HUJA 1I82A 5B3SB 1YRKA 3NGBC 3BWSA 1E4XI 4UINL 5HHNB 3BCFA 2X4RA 4L29B 4RFOL 3FT3B 1OOAA 5DYOA 1UASA 4I0PC 2V2TB 1TETL 4NRZB 5AAPA 1KLFB 1FNSL 3FB6A 4NS0A 5D7KD 2XWBA 3VXMD 1D9KD 3KCWA 3X14B 1LO2L 1MVUA 3QUKB 3QC5X 3TIDB 5C6WH 2SEBA 2ERJC 3TU6A 3QUYB 4LLDA 4AIOA 3KPMB 3IKCB 1ZAGA 5LWYL 3N9GL 3LEYL 2BNRB 3MJ9H 3MRLB 4ANWA 1PDKA 3EGXA 1TTRA 2AMUA 2X0UA 2FD6L 1ZMYA 1OP3H 4QLRA 4JHZA 4NO0A 4CVZB 2VLJE 4IJTA 1RUQH 3LH2H 5FM8A 4PBVC 3OR7B 4OM0H 2IAMA 1NAMH 4R96A 4DGIL 3D09A 2F53D 1MG2C 2KLSA 3MYJA 4L9LC 3QPXL 4I3RH 1ZA3A 3TO4B 3WNNA 3HE6D 1XFPA 3PP4H 3BC9A 3ESOA 4XR8C 5LGJB 4HMCA 5HJBA 2HA1A 3ARTA 3B9AA 1KLFA 5EPMA 1EZVY 2QQNL 3ZIYA 5JPMB 4YHNA 2FIRT 1E2WA 3IDJA 3V0DA 1GY1A 5LG6A 3QEGH 2BCKA 2K9FB 2Q86B 2D2CC 2IH3A 2CLZA 2D7TL 4NQCD 5TPWH 4GBXC 3I6LD 4OFKA 3TO4C 5J1SC 1MZYA 2OK0H 1G6VK 2HZHA 4HAKA 2C9RA 3FO9B 1LVEA 3VGFA 4N6RB 2L8AA 2YIHA 2ZCHL 4JUSA 4K4KA 4D9RE 5LN4A 3AY2A 2Z35A 1A1MB 3PNRB 2CBQA 1EJFA 2YD7A 2Q2LA 3QDGA 3GRWA 5FDWB 3DOSA 3RKPA 4JZOA 4X8GA 3IYLW 2B4CH 4NI3A 2P5ED 5DVOA 1S7XA 3FO9A 5K5YA 1G0DA 2CH8A 5BZZA 3HE6A 5FM4A 5B1JA 3C9NA 2BCKB 4KK9C 4CADA 1B4JH 2YD1A 3IEAA 4Q74A 4HIXL 1NBZB 2J1ZA 3SKMA 4L4VA 3UMTA 1XMWA 4O58H 3ULVE 1F58H 5I1EH 3ZJAA 1S3KL 1QACA 3LPWA 5CD3B 1EAOA 2CRMA 5ACZB 5HDBF 5BRQA 4UDUB 4OZHE 2Y7QB 4WHYH 4FFWD 3UTSA 3H53A 3NFSH 3HLAB 2WLHA 2Z8RA 1FORH 3OZLA 1CD8A 3PABB 1KGCE 2IALB 4NWUH 1X7TA 4RFNC 4KJYA 1DQQA 4JRXE 2Q3ZA 2RHEA 4HULB 2PPAA 1A64A 2X6BA 4L0PB 2V4LA 2HFEA 1VERA 2KS0A 2VSMB 3CPLA 1X44A 3OHXC 4O2FA 5CZVL 3AU1A 2AFNA 4MQ7A 2W60B 4PU2A 5EZPA 5HY9A 2O26U 4F20A 1KBBA 3TO4D 2E8YA 1N4XL 3ZUNC 1MHCB 2VDPL 3DIDA 4JFDA 3T0VA 5I2IB 3JWDH 2PW1B 2QEJA 1HHHB 1QLEL 2DJUA 3DSFL 2X4RB 4H2CA 4K55A 5HDQL 4Z7NF 3M1OA 2Q7NA 1C5BH 3B7UX 1MCJA 4EN3C 4L4TA 1ERNA 3EOTH 1SLVA 5D7IA 1F6FB 2X3BA 5BQ7A 5LWYH 5C1MB 1Y07A 2PYFA 2WBXA 4CUCA 4K3GA 4OF8A 5LNEA 4JFQB 5LO7A 1VA9A 3D1MC 1JPFB 4GAJH 4OTXL 5JXAL 2O6DA 4GIPD 5A2JH 5FKAA 1CPUA 3D4CA 4YPGB 1PMYA 1Z32X 2WVSA 4PRAB 4ZUVB 3QUGA 4QYAA 4WSJA 2OFQA 3REVA 3K0YA 3CFEA 1XWVA 1JFQL 4ZFZB 1I8LC 4BFEA 3LZQA 3SDDC 5FKPB 5ISZA 3QI9D 2TSBA 4EZMA 4MS8D 2Y7OA 5D2LB 3L95B 3RVVD 1QAWA 2ADIA 1DEEA 2HB0A 2JXMB 5DI8B 1CU4H 2DYPB 3EJZD 4MA8L 3GKWL 1IC5H 3EF7A 3VFOB 1DQTA 4JHWH 2GCYB 2R69L 4XPTL 3SGDH 1SY6H 2WQVA 1D7CA 3HI6L 1YJDC 4KI5C 5DT1L 1NMBL 3EBHA 4DOHB 3G6JE 2GT9B 2QVMA 4S0SD 3GIZH 3FCTB 2CIKA 1JVOA 2X6MA 5CCHE 3ZY7A 2BDNL 1EAQA 2B1AH 4JFYA 3DMMD 3MUY1 1CGSH 5F7AA 1OSZA 1A3QA 2ZYRA 4NQVA 4IU2B 3KS0J 4J3OF 3CN2A 4IRJB 2LT9A 3L3KB 1E5CA 2QMKA 1CD1B 1T1XA 1T03L 2BVQB 3WFDH 2ZOWA 3K71B 3DK0A 2DLHA 3H55A 4D0DB 1J5OL 4U7MA 2HN7B 1WWWX 1T83A 5CGTA 3WAJA 1S4IA 4OU3A 2GITB 3MTRA 5J89A 5E8OA 4WFFD 4PEEA 1J8RA 2ZNXA 2HX9A 1BFOB 4J2QA 1DO5A 5KVFL 2YAQA 1J11A 2KUTA 2WTPA 7FABL 3LQZA 1DUYB 2B1HH 3SBWC 1JGIA 1JPTL 4PRDB 3UYPA 3I85A 2P5WE 4HEPG 4B0MM 3C8KB 5KYYB 1A66A 3IXTA 3ZTJG 2F68X 2XYCA 5F88A 4PS3A 4YXHH 5JZ7C 2YD5A 3MCYA 3P0YL 4NQUA 4KQ4H 3CFBA 2ORBL 2BY0A 3T08A 1CD1A 4A1RA 3ZUCA 3KYMA 1MCFA 3V95A 3FQ4A 4X6BB 4DWHA 4W4NA 1CXFA 1UT2A 5D1ZB 4DGWC 5FYLL 5F1KC 5DHMC 4WI5A 3QPQC 3AG1B 5GZND 5A43C 1PVHA 3BVWA 3FXIC 2K1MA 3HHSA 5ID1A 3KYNA 1FORL 1KCLA 3MAWA 2GVYA 3W9EB 5JDSB 3ARFC 2R15A 5BW7A 3MCG1 1VEOA 4AV4A 4NLHA 4NT6B 2IFFL 2RB8A 3TZVC 1ILSA 1MEXH 1PZ3A 2B1HL 4ONHB 2WQUA 2HG5A 3DVGB 2HRHA 1IEHA 1TO4A 2OSWA 2BIIA 3HJ0A 4NQDD 2OMXA 3QDGB 5EFIB 4YPGA 5HGDB 3ES6A 1NCAL 1U30A 3HZVA 3GSRB 4FA8A 4FS0A 3KWTA 1N64H 2DTML 3QZNA 4DO4A 3FQ1A 3GSWA 7PCYA 2XLLA 4JM4L 4B53A 1AGDB 1EHXA 5JHDE 1O7SA 4HWZA 3QXDA 4E9QA 4O51B 4CN1A 4PJBA 3BUTA 4L9DA 4EUPH 2HJFB 1JMZA 4YHNB 3TNMB 4U6YB 3UJTL 1KGIA 2BY2A 4LSRH 4LRNL 3G5XA 5A3IC 5ILTH 1P6WA 3V4UL 1EJOL 2WYIA 3WNKA 3ARFB 2NY4D 1KCUL 4H1LG 3EOBB 5JPNC 4ZTPH 5C0CA 4G1EA 4TLSA 5G4OA 1VIWA 1WFIA 1INQA 1QBAA 1TR7A 2K6WA 3AQZA 5DJDB 5K9QG 1Q94A 1Y1UA 3ULSA 3VXSA 1JRHL 3PP4L 1CF8H 4YSDA 2Z34A 1G7JB 4FLOA 4TNFA 3C5ZB 5ID0A 3PWLA 1RZJC 2NT0A 5KSBE 5CINH 4ZNEA 1C7TA 2COQA 1J8HA 1S7WA 1NQBA 3W0WA 4PJGE 2CRIA 4AITA 1BREA 2BZDA 2Y9RT 5FFGA 3F84A 3BWAB 3D51A 4YNYB 3H4FA 3MXWL 1U95A 2B3RA 3OLIA 2WVTA 5E8PA 4J3OD 3H9YA 3T0EC 3LN5A 2LFGA 2ZAIA 5JOFB 1NCWL 3WFBH 5L4FA 1EDYA 2I69A 2O5YL 2IAAC 4UNTA 4QAWA 3IT8D 3OAUH 3B9KC 1G6RL 4AEHH 3BLPX 2BFVL 4YUEL 1KLUA 2F74A 4Q58C 4B9IA 4M61B 3BJLA 2PPDA 2VAAA 1ZOXA 1IAIM 2WIIB 2O72A 5HHMB 1MEXL 4ODWB 2D0HA 2RJMA 2Y1YA 5JXED 4GAGL 4JAMB 1Y7VA 3D07A 3NABL 2PN5A 1A2YB 4GKZB 4KAQH 4RAHA 1JTOA 1DVUA 3VRLF 3LNFA 4R97C 2YO3A 5SWSB 3CVHH 5TDPB 1HXMA 3TL5A 1ZHKB 5FO7B 2XXCB 1A6WL 3ARXA 2NY4C 4YDLB 2QR0B 1SFHA 3MGAA 4IKKA 4WUUE 2IADA 4N22A 2FEEL 4QIRA 4R2GD 1RLBA 2YEVB 1ORSA 3MROA 1YHPA 2B8OT 2WSPA 2OMBA 3HC3H 1IBZA 3G5ZB 4JN1L 4PWFA 4E41A 3K6SB 4Q9RH 3MX0A 1MCKA 1T21B 5HGAB 3FQYA 2JB5H 3LIUA 4R96B 4A2LA 4XNBA 3C2SA 4MAUH 5CMAB 3ESUF 3SKOA 4UIKL 4AKQA 4N28A 3UYRH 1URZA 2GC7C 4GBXD 4LSRL 4Z5RB 1H3VA 1J1PH 5IHZA 5JUEH 1UZ6E 4YEFA 1BXAA 1YMMA 2FWLB 1S5HB 3R4DA 4XCCH 2QVTA 3CZFA 1YO4A 2NX5B 2AJZA 4PGBB 1KCBA 2NUTB 5BJTB 5I1LA 1X5HA 3DVIA 5D2NA 3WG7B 5EO9A 2SEBB 5T33L 2ZWKA 3LKSA 2K70A 1CE6B 5KUMA 2F7RA 1O7DC 1CL7H 1RZKC 1XR9B 3RGVB 3HBGA 3BN3B 5JA8B 1HJCA 2W80C 3T1FB 1BZQK 4HMDA 4XO3A 3N3EA 3WS6A 2XZCH 5EEYA 2JMRA 3DX3A 3ZTEA 4Z0BH 1DVTA 4DP1X 1LEGB 1W80A 5DUBB 4LCVA 4X8JA 4WIQA 1UA3A 2XTJD 3KLAB 3MV7B 3OZKA 3QIWB 5KANG 3S5YA 3GO1H 1NCJA 3ZR6A 5BCAA 4DVRH 4S0TD 2BP0B 4Y4KA 1JWSB 1BPVA 1IC5L 3OGOE 3QW9A 4J3BA 1XSOA 5E4EB 4NCC1 4GBXB 3UAJD 5FB8B 5C97A 1JYWA 4UILL 1XSIA 2WBKA 5AL0A 4PQXA 2EIDA 3ZDZF 2HRGA 2XKUA 2XV6B 3MODL 1MXDA 3QUML 4TUKH 2OV0A 4CMMA 4MXQC 3D34A 1LE5B 4Q2ZB 3MBED 1CDUA 3SCMC 5BRZD 3W38A 1UKQA 5GIRB 2IIJA 3MZGB 3ARFD 1P53A 2Z92A 1CE1L 3M1CA 3FRUB 1KPUB 4N85A 2EYTB 3W56A 4NQXA 5DLML 3DX6B 5IR1B 2YN5A 3IGAB 2OXGB 4HFWA 1SHXA 2BMKB 3U4KA 1RUAH 4NX0A 1BQLH 1JGDA 5CILH 1NAMA 1SOQA 1UJTA 2G5UA 3LIZL 4PH8A 4APXB 1UQSB 3TBWA 4Z6AT 1Z3GL 1JZFA 1DJXA 4XBGA 2B9AA 4FKHA 3TFKC 1T20B 2J1KA 3UP1A 1G6RH 3WCYA 3MFFA 5DHVH 3P4NB 4G1MB 1TEGA 2WQWA 2K45A 3EYVA 4HKBB 1VEMA 3PF2A 4DUVA 1KT2A 4JO3H 3ZDYB 5HHXH 2Y36H 1F42A 4EN2A 4P4KD 1IMHC 3A4EA 1CFTA 1B0WA 3A21A 3L08A 4XN5A 4BWTA 1GA2A 3VE0A 2YEZB 1U8QA 1QPXA 2CNZA 3CX2A 3N06B 3QXUA 5AKTA 3HCVB 2R8SH 4U0QB 3O9WC 2WZPD 1KYOJ 1DJSA 2CHDA 1OWWA 1GOGA 1PZDA 3VRIA 1NFDA 1TTFA 4M6OH 3BH8B 1E50A 1KN4L 4Z3JA 3MLUH 2DF3A 4N0CD 2VNCA 4OFYA 1NEZB 3WS6C 3TESA 1BVKB 5E70A 1ITCA 3O9WB 2G0KA 2D3VA 3TBYA 2XICA 1BD2D 4BXSV 3DTXA 5C92A 4O58L 2B16A 2VSDA 1PIFA 2Y72A 3WY3A 4QRBA 3T77A 3NACL 2ICEA 1WZ1H 3LRGA 4P99A 3CZEA 1XDTT 4LEEA 4AQAA 2E0PA 4DP6X 1OT1A 4Z18A 2JCCF 3GHEL 3R06B 2FHFA 3EHBD 5DVPA 1QTPA 3KPRE 1A3ZA 5CJQH 3N0PB 4K0OA 3SDAD 2IDSA 3CVDA 3GBLA 4GMTL 3O6FA 4L1HA 2XKNB 4L8CB 3MRDA 4PRBA 4TQPA 4WV1B 5F1NB 3QQNA 1EMTH 4R4FH 5GSRB 2GEQA 3EYOB 3FO2A 4JFFB 2C9PA 1B0GB 4L37B 3Q05A 1MFVA 4J1UB 2CCVA 5DJZA 3L5HA 4BCZA 3ARUA 1N64L 1XR9A 2VUOA 2QKSA 4DK6A 4OJAA 5F0MB 1YEHL 5IT2L 2YK1H 3SYQA 3FUNA 5ICZB 2NSXA 5B1CA 3WJJA 1E8XA 1YEGH 2HKHL 3QRGL 4PJIE 3TPUA 5KN5B 1SJMA 1ZT4B 4Y16B 2FRGP 1J8KA 5ID0B 3EJCA 2WWMD 1Q1JH 1OAKL 1ETZA 5GZNA 3V0AC 4UNVA 1UXSA 3MNDA 3LHAA 4WWNA 3W39B 1R0AH 5DJDA 4UQ2A 3M45A 3BKMH 5F9WC 3AITA 3UTPD 1KBPA 5D71H 5D1XE 5FGCE 1EXUB 1Z7JA 2KDYA 3NA9L 5DJ8B 4NWUL 1RUML 1WZMA 5I1AA 3RNQA 4JO2H 3L9YA 4R0LA 1J18A 4EI5D 4LARH 2AXFB 5J6GB 3I9GH 5MENE 4G6KH 3GI8L 2DZEA 3GMPB 1NBYB 3FQTB 5D7EA 1RL1A 1U8LA 5CM1A 2E75C 1KSRA 3TCLA 3ECBB 5B4MD 3DRTA 1SOSA 2DMHA 1O9ZA 2KT6A 1WWCA 3II3A 1QRND 2QKIC 4RBPH 3QI9B 1E5YA 5DHDA 3RWEA 5T1LB 1P7HL 4Q6IA 1GSMA 5DFTA 5F44A 5DQDH 1U8IB 5TDNB 2CXKA 4G7YH 3UTZA 3ZN6A 2FBJL 3BAWA 2KPWA 3UACA 2GB2A 2WV3A 5CD5D 1EH9A 1T1YB 3ZYZA 1F2QA 3DDGA 4OCWL 2PPCA 5EU3A 5EFIA 1QSFE 3MNWA 1PD1A 2B59B 3IF1A 4JPVL 4DKEL 2ZT9C 4OD1H 2WN2A 4MZ2A 5LBVA 4HP5A 2D7MA 3R0MA 5HDBB 3O6FC 3RP1A 2HRLA 4PJAE 5LGHH 1ZV5A 2BC4B 2ZCKH 3OZ9H 4LLMA 3RHWK 3PHQB 5EOTB 3T0ED 3RWCA 1BDYA 1AMYA 2JIXB 5D70L 4ZFOL 3F7VB 3ASNB 1DBAL 3H2PA 5F0LB 2X2IA 2F8OA 1HL5A 2B59A 5I1DB 1NFIB 2YJQA 3CDGB 2A6KB 3TV3H 4N25A 3UZVA 4ALAL 3BH9A 4CDGC 3OD3A 2Z4QA 3GFUA 3QP3A 3CVHL 3IAQA 3NCMA 4JFWA 2D03H 3HR5B 3TEXA 2OCCB 1JHTA 3PWLB 3L1EA 4ZZFA 1VPOH 1WCQA 3N04A 1HWHB 1UM6H 1QQDB 4ZFQA 2HLFC 3WIAA 4EI5C 4HKJB 2C26A 3ZKSD 3C6LC 1DZ0A 3MUUA 1AJ7H 1E67A 4N2HA 4TVPD 1P0SE 1PX3A 3ULVD 4QKTA 4AQEA 1XIWC 2HKFH 1G9NL 2WLJA 1N5YL 3BSHA 4G8FB 4GO8A 4MSWB 5KYWB 1E4WH 1CLZL 3O6ML 3KPQA 2XQYA 1BYPA 2GSGA 3P3TA 4QHUA 1BD2B 1B3JA 1AQHA 2NY3C 2IMNA 5F3BB 3FFDA 3VYNA 2MKWA 3QDJD 3ZKQD 4KJQD 4HJJH 2KKQA 5L4JA 2LAGB 3UJJL 1A7PL 4F33B 1WIPA 1AKJD 2YFOA 3WY4A 2VKWA 1IM9D 3PHOB 2WUCL 5I75C 4M5YH 3Q43A 2BY3A 4OQTH 3B37A 1J8SA 4WI7A 1P69B 5L7XH 3L9RA 4MD0B 3ILQD 3ARQA 1MREL 5MERB 5C2BH 4DH2A 4GG6E 4PJCF 2WVVB 5D6CA 3U0TB 2B2XL 5H8DA 5IMLB 1TVDA 2DIJA 3ULUF 2X2HA 2BSRA 3LEXA 1D5IL 1LMIA 4L1BA 4NUPA 4R26H 3P9MB 3BDBA 3RIFF 1X9RA 4R83A 1KENL 2VQ1A 3VFSB 3ATAA 3SDXB 1DQJB 2BNQB 4M43L 5BXFB 1TTUA 3BQUB 5IIEA 3NK3A 1IGCL 2X70A 4Y4FB 3TT1L 3ML8A 4J7RA 1CL7L 1H0DA 4OAWB 4EQ2A 4QEGA 1A7PH 1N6QH 3T8XB 4AG4L 3THML 3FT9A 2Z93B 1GGIH 1G1KA 1YC7A 2J55A 4LSVL 3KYMB 3ZKNC 2BRRH 1U8NB 4GKOA 4OCWH 2A0LC 1CFNB 4BFIA 3TFBA 1NOLA 1OVZA 5INCB 2VISB 3DARA 4HCRL 4M5ZL 1UEYA 3QQDB 4GRWE 2Y6TE 3AREB 2OX5A 2R2EB 3D2UA 1BVNP 4PRHE 4AKPA 4Y5YC 5D93C 3S48A 3EDKA 1BQHB 5DYFA 1I8UA 1ZTXL 3EHBB 3JQOB 4BZ2A 1LK2B 4G9FE 4LKCA 3MZTA 3SDAB 4Y5VC 4FG6C 4G7RB 1NIAA 3HRPA 3VWJA 3O2VL 1ADQL 2IXQA 4D0CB 3QZWG 1URIA 1MFMA 2H3XC 3VM7A 4ZDHB 4FCHA 3VMOA 2AW2A 3VJ6B 1YECH 3LKNA 3IM1A 2EDOA 5KVGE 4WK0B 3TA3A 4GB9A 3TURA 5DO2D 4EUPB 2X40A 3QZWB 4HIEB 1QR1A 4ABUA 4N9GB 1H9DA 3LZRA 2J25A 4UT6H 4XI5D 2VGLM 5FV1L 2OP4L 4I1PA 3LZNA 4OI9A 4FFZL 5C3LD 5I24A 4JZJA 1ECZA 4YOKA 4QJ3B 4CADB 2R27A 2ARWA 4TSCL 5JW5B 1J05A 1IAMA 3J27A 2RA1A 3CK0L 2BOBB 2BSED 5FFLA 4Q2ZA 4NIYE 2PYED 4MMYA 4AENA 4S1SH 4Z7OB 1N0LB 4JFEB 3O3EB 3CNKA 3N9GH 3TA3C 1RV6X 4UDTA 4PJAF 4U4IA 4H0LC 3DC0A 3BAEL 2KLTA 3PDOB 2EVHA 4Y9FA 4GH7B 4POZC 3WTVA 2NY0B 3BT2H 1QUPA 3UZEA 2DKSA 1N3NB 4X6EA 4PJEF 3ZR5A 4W81A 1SOKA 3QIBC 4LU5L 1U3NA 3SDCB 2KMWA 1WFNA 3S5ZA 2MJWA 3QEUB 4AYBA 2TRYA 4RDQG 2R0KH 1P9MA 2LE9A 4P2OB 2BX5A 2ZTBA 5IJDC 3NA9H 1L3NA 1YYLH 4NC2B 4KKLD 3RA7H 1XD1A 5JPMA 4EZJA 4XN1A 1RU9H 1YEFH 4FQXB 1LO0H 1I85C 1NMAL 1B0IA 3QQ9D 4ODHL 2VR6A 4HSQA 4AIZB 3S35H 2EDLA 5EUKB 1KELH 2OW7A 3FJTA 3GXFA 2W60A 5F1OB 1VGKA 5FECB 5MEND 3DJSA 2LU5A 3GTVA 3Q2VA 3CVIH 1UD5A 4OVUA 4KZEL 5DWUH 2UWEA 2AABL 4ZI8A 3M7OA 1AXIB 2X9YA 1YEGL 3QRGH 2BY1A 5SWZA 4I3SH 1PYWB 2QFRA 1USZA 2WP3T 2X89A 2DMGA 1S3RA 3FFCE 4FF9A 4JBSA 3TYFA 2KLRA 3CMOL 4NUQA 5GS2D 4JB9H 3MX0B 4ENED 1H3TA 3U2SA 4MA3B 3L5JA 2J4WL 3V52H 4NRXB 1MSPA 1A0QH 2HVKB 1NFIA 4H4NA 3EDDA 2VITB 3BAXA 3SY0A 3P0VL 1YJDL 2BVUA 2GIYA 3ARGA 3VSQA 2B1OA 3LX9A 3EH3B 5IM7B 4QRRB 1SPDA 1RIUL 4MAYB 3S35L 5EO1A 2FYYA 4EI6A 3FB7B 3DNKA 3V5DB 4L3FA 3BKYL 3G9VA 1U8HA 1FIEA 1DFXA 4BKSC 3MCKA 4FC3E 4ZNEE 2DBLL 4XGZA 3MNMA 3SKNA 2MKLC 2WLLA 2NT1A 4PRPB 3V4UH 1MHHB 2DMCA 1NDMB 4PRID 1S7SB 2BHYA 1F18A 4PYHA 2ED8A 3VFRA 4HGWB 2AXWA 4UILH 3ZTNH 1XBRA 3QIUD 4XBPA 3CSGA 4BJLA 2CLZB 3D85D 2BPBA 2W8CA 3U9WA 3I02A 2DTSA 3SE9L 2ESVD 2VITA 5FLUA 2HSIA 4OCSL 2LTQB 2OI9C 4K9EH 4MJ4A 4NKQB 3WE6A 1JPGA 2EIJB 3Q2LA 5BZWA 5I1CL 2SODB 2PCYA 1NIBA 1MH5B 2HFGH 3OMIB 4IIQC 3S3CB 4YJZL 3NPZB 3UADA 2ROXA 4PWHA 2W0FB 1LE9A 3AS3A 4TSCH 2D4FA 5E0QA 5B4MC 3E2HC 5CEZH 1ZT7B 5FUZL 5FX3A 5C0FA 2D31B 2ZP0T 1BYOA 5FLVA 4JG5A 4QRTB 4M1GL 3VXUA 3BZ4A 3LXAA 4WUKH 4Q97A 1DBKL 3BO8B 1HN1A 3QJTB 1MJ8L 3ZKND 4RNRB 1AI1L 5JMOC 1ES0A 1TZHA 3FMGL 4OJFH 4U2YA 3SQOH 5EN2B 4EPSA 4YVUA 5EUKA 5T3ZH 3TIDA 3VI3B 2HWZL 3RTLA 3UTTD 4AIZA 4ZMAT 5IFJA 5DRZB 3QZPA 1TQCC 1J0HA 2NY1C 1BGXH 3TVMA 1FNLA 4PRHD 2EYSA 1AMXA 4I18C 1MWAB 4EI0A 4TS6A 4W9GC 4LQFH 4HUCA 1EGJH 1MLCB 3NJJA 4DPRA 2ATAA 4LCWE 4UF7C 2FWOA 2FJFA 2MNJB 1QSVA 2KZWA 2RQ8A 3QZLA 4ZUSB 1AHWA 2GJPA 2PCPA 3GMOB 4LVOC 3DYPA 3PIQA 4KXDA 3FHQA 4QOKD 3KM2A 2VN3A 2VDOL 3BLBA 4K5OA 2GJ6E 4PD4J 5FOBB 1AQDA 4FLHA 4XVTH 3NESA 1AY1L 3T04D 4PJFA 4LKXA 5I76B 2HG5B 5IVOA 4LCWD 3RUGF 1JCKA 1T2XA 1O9VA 2VZUA 5ITFA 4LVOB 2XWCA 1RMFL 3OKDA 1YNLL 1D7BA 5SX5H 1KTJA 3F01A 4NJ9L 4UQBA 3GTNA 4XPHH 3GSQB 5DRNB 5GS0C 3VFNA 4PFEA 5H94A 3SGJC 1FGVL 2IPKB 3IDNB 1AIZA 4PPTA 2CA3A 2WJ5A 5EU5B 3KLDA 2ARJQ 1FHGA 2J8UF 4XCEB 2HFGL 4JG1L 1A8ZA 2Y25A 3HN8A 5E6ID 4XMXA 3VWKB 2N7BA 1JN6A 1FV1B 5L6YH 4FFZA 5IB4A 1UOLA 2DYPD 4KJPC 5EZJB 3L3HA 3WD5H 3S9DB 1PZCA 5GZOD 4JHWL 5T1KD 1P5UB 3GSOB 3LSOB 2Y69B 4OBRA 4QRQB 4UAOB 2K9UA 7CGTA 4B9CA 4Q9RL 4TL5A 5IF0B 5D1XC 2GBAA 1HTYA 2FECL 1I1FB 3T8MA 5D7IE 5GGQL 3BVXA 1ID5I 4FULA 4EKJA 3TBBA 5I73C 2YAOA 5L9DL 5DQJA 1JYXA 2IOIA 1DUYA 5DUML 4PJEB 3HS8A 3SDDA 1A6WH 3WO4B 4PJHE 1CN4A 2QGCA 1LEKA 3WJMB 3CVHB 4CU7A 1WQVT 4PJ5E 1EUTA 2PABA 3WN5B 5AW7B 4FQJH 4JPQA 2X4OA 3ZU8A 4JFVA 4EZLA 4EDXA 2EEDA 3TBCA 3E8UH 5D7HA 2YBRA 3I50L 4P5KA 3G08B 5D1ZD 2Y6SD 2XPGB 3WFZA 4KKBC 4GG6A 3FQ2A 3DO4A 1EEYA 5TE6L 2P24B 4NQVB 2TRHA 1JHTB 4HWBH 4QXUH 1HHKB 2WQRA 1FHNA 2A77H 4KRMB 2O30A 4M6MH 2NY6D 1HOCA 5AW0B 4YK4B 4NO2B 5DLMH 1E6JH 5F6HI 3LRMA 3OBAA 3QQXA 5BS0B 3FQWB 5T3XD 3K6DA 3HG0A 4NFBA 3K8LA 2BNQA 2QBWA 4AYMC 4ABQA 4UBDD 5JIHA 3SO3B 2E76C 2IQ9H 2X4TB 5E6YA 3LPPA 4I2XE 4F1ZA 1FCGA 2J88H 2EVFA 5JR1H 3BQUC 4RZCB 2QV4A 5TE7H 3U9UA 4HHAA 4BFKA 4PJDA 1DO6A 1KYUA 2GIXA 3MNWB 5DUJA 1DVYA 4UTAH 1M4KA 3CZNA 5EU3B 2HMID 4DVRL 1IC1A 2FK9A 4IMLA 3BKJH 3U1SH 1P1ZA 1UFUA 4XNZB 4QXWA 1S5HA 2DL2A 4PI0A 3U30B 4NBXB 3ZHLA 4OD1L 1XF1A 4OZHA 1JPST 2WO3B 3VD4A 4F91B 2I85A 5PCYA 1XF4B 3H9HA 1ZLUK 4LDLB 4XP4H 3WKNA 1T83C 4I77L 5KVDE 3MUJA 1C16B 2IDCA 4EXPX 5DZVA 2P28B 1SLXA 3GRBA 1IIIA 2O61A 2JKJA 1OTTD 5EN3A 4TQEL 4Y8DC 1A6VL 1YLBB 5DJ8A 3BEVB 4AGOA 4JQXA 4M8QA 3M17B 2XACC 4R84A 5FO7A 1WA1X 1A4AA 3HNSL 3RL1B 5C0AD 4K9EL 5F96L 5GPRA 5HDOA 2BNRE 1G94A 5E4EC 4F57L 1LO5A 4G8EB 3HLAA 4QTIH 1OALA 4IGBA 3VA2C 1BJMA 1GS7A 1NSNL 4PWJA 2ENQA 3DV6B 3QR2A 1JPEA 1U4FA 1ASPA 1CXKA 1MWAL 2VLJB 4KY1H 3IDMB 4UCFA 5CWSA 3UTPE 5AFAA 2CE6A 2ICWB 5AOIA 1N6QL 4XCFH 1ZLWK 1XGQA 4ZTEA 1CT8B 3DX8A 1MCBA 5FOJA 2Z0BA 4U3XA 5CLXA 1CLYL 4P2RD 1RLWA 3ALWA 4F7PB 3QDMA 5DZ9A 3BDXA 4DVBA 5I8CA 1MCPH 1IILE 5K1VA 4PCSA 1SLWA 2CIIA 4PW4A 1ZVHA 2YD4A 3SYCA 4HSCX 4FFVD 5HSFA 4WV1A 5F1NA 4XNYL 5C07E 1XF5A 3TN0B 2IQ9L 3SDCC 4IOFD 2PO6C 2BWIA 3ZZ1A 4XAKD 1HSAB 5DC0A 5I26A 3LKRA 4ES9A 2EEFA 1EO5A 5HHXL 3UO8B 3MGOA 4A7SA 3QORC 2HG0A 1T1YA 4C56D 5GGVH 1DDTA 1LO2H 2C3WA 1KIQA 3KXFA 1QR4A 3EUDA 3ETSA 4HWBL 4PBWD 4W6XB 3WNOA 4TMPA 1M42A 3BIAX 2E8ZA 4IRZA 5EIIB 5JW3H 4PHZA 4YQXH 5F0JB 1ONQA 3HNTH 1R3LA 3IMRA 4LK4A 3KLLA 1L7TH 5CSGA 3UZEC 2DLTA 4KKCC 4XXDA 3LNHA 5E2WH 2H1PH 4AG4H 2DMBA 5A3ID 5IVXF 1WGVA 3IRPX 2WW8A 3N55A 2DEWX 3BP4A 1BZDA 4B7LA 1LNUA 2ZUUA 3TP4A 2HJKB 1QOKA 3QI9C 3RU8H 2OSYA 4QCIA 1G9MH 3GGWB 2AJXL 3EJZC 4AQ1B 3HI5H 1BG1A 2YKLL 4UYPA 4NAMA 4OZHB 3RILA 1UXSB 1YZZA 5MEQA 2WLZA 3C8HA 4L4VD 4FNLH 4GUPB 2H5UA 3HVDA 1NKRA 1SY6L 3T9WA 1QABA 5HJGA 4MVBC 3VM5A 3LRLA 1QFWH 3KXFD 4JRXB 5FYJU 1P1ZB 4JFPB 4P3DA 5CS7A 1HAWA 3DGCR 3IKKA 2XZQL 2ADGA 12E8H 2NY6B 3G6DH 2EC9U 1HSBB 1WA0X 3CZJA 3L1GA 3O2DH 5FW8A 5B3JE 3GK8L 5GRJH 4NQEE 4Y19A 4E9YA 5HHOE 4KNTA 5KBKA 1LEIA 2GAZA 4GUCA 4V1DB 1X5KA 1IKNC 1KJ2L 1BCIA 1HFUA 4N9OB 2P8PB 5EBMA 3S34L 2X4PA 3BT2L 2ETWA 2FAUA 4YSTA 4HIIA 1SBSL 2IPUG 3E38A 3NSCA 4HIXH 4P49A 3SYOA 35C8H 2YOAA 4Y16C 2C5DC 4M56A 5ID1B 5CBAB 1HKLL 5F96H 5DD0H 5JW3L 3FOMB 4NO2A 1GGCL 4K5MA 3QG6B 4NYLB 2HKFL 1BWWA 2Y06H 1L6XA 4YLQT 4PIBA 4LVNC 4XP5H 1QPPA 1AJ7L 5GRVL 2ZX5A 5GGVL 4DN3H 4Y4KC 1MJ7L 2AAAA 2FBRA 5EMYA 1V27A 1ZLDA 1BLNA 4WNQB 5CJOL 3ZZQA 3BZ5A 5MI0C 5D7KE 4DF9A 5HPMA 1VZHA 1KGWA 4LHQB 1DLFL 1UA7A 5AB1A 3P9LA 3MV8E 4FG4A 4MJIE 4ODBD 4L23A 2FQFA 4QO1B 4WCYL 4EIZC 1MDAA 3GUFA 2YWZA 2JJSA 1IM3D 2XA8H 3GF8A 6FABL 5E6IB 5H37A 3VWKD 3CVHA 4PJFF 3TV3L 5F9DC 3V5HA 4AW7A 1XIWB 2F19H 1KCWA 1MAJA 4JO5A 4YE4H 3G6JB 4DAGH 2EDYA 5E8OB 1XCQB 3BQVA 3L3OA 4G6FB 2GJJA 3AROA 1G9NC 4WHDA 2CDGB 2AEIT 5A2BA 2J8UE 2DN7A 3CXDH 3H9HB 4HDIA 4XNDA 4YXKH 5A2IH 3QH3A 5L8LB 4CL7A 4PLJC 4HG4K 5GZOC 1C5DA 4U1HA 2MSPA 1WUZA 3FULA 5D7LA 2A6DA 4IRZH 1GYCA 1K8IB 5E9NA 3WTYA 3V55A 1RJYB 3V5HB 2PCFB 3G5ZA 1XHHA 3RIAK 1BQSA 2OJZL 2QDWA 5I23A 1NZRA 1YEHH 1E4XL 5DD6B 4E41D 5JMRA 5IT2H 1DJZA 3NH7L 1UWGH 3Q7JA 4TQIA 1QFUL 2VUYA 3P0GB 4ALAC 1QBML 1AS7A 2DYPA 1L9PA 2WANA 4HZAA 3BEWB 4JPIB 1SBSH 2FSEA 2GSIB 5IW1A 4JFOA 3TBVA 1NGZA 2P5WB 1MI5B 2CR6A 5E94B 2VR8A 1KJ2H 2ZWNA 3CHXA 3EO0A 1TJIL 4ZFZA 4MA1C 3OR6B 2XWEA 5I73B 2L7UA 3PREA 3MREB 4R26L 4RLDA 2EP6A 3ZHKA 2HH0L 3BE1H 2YPLD 5GS1B 1QLRA 2C1OA 4ONFH 4ZX5A 3VXUD 3AAZB 2F1EA 1L0XA 1RUMH 2NY7H 5DD5H 5AYTA 1S8DA 2WLMA 3QULB 2VAAB 3QJQB 5CEYA 5C2BL 5D71L 3NZ8B 3RVUD 3LD8B 5L4IA 1LEGA 2QADC 4NPYB 4C57C 5BRZB 5E7FA 5GS1C 4IBUA 5DJ0A 3WFCH 3OJVC 4FXKB 2PYEE 4XXCC 4KRPC 1FAKT 2X4UB 2NY1B 3DETD 4Z7UF 5DMJB 2VW6A 4PWGA 5IBTH 4H40A 1CO1A 1J0IA 3RE0A 1J1XH 1ZGLM 3A4FA 1HILB 5D6DA 4NSKB 1VRSA 1ND0A 1ES0B 3HIZA 3QDGE 5DQJB 5B1BB 2K8QA 2VB5A 4QDGA 2Q76A 5FGRA 2UUDH 4W9ZA 3B9VA 3FUHA 4V11A 3VQ2C 1AQMA 1TCRB 4R6UA 3MPCA 3D08A 1KGJA 4MXWH 3EOBA 2NXZC 3FTUA 1NCOA 4JY6A 3S2AA 5I9QC 1FV1A 4FEMA 4HXBL 1C08A 4M7JL 3TOPA 1NUFA 3Q5OA 3MROB 1MCQA 3EJPA 4LCYB 3D7PA 2E7BA 4MMXA 4H25B 2X44D 3I02B 4MXVE 4O5LH 4OIIH 4PV9A 2QVFB 3C9NB 3GSQA 5DRNA 4ALAH 6FABH 4PP2B 3GUTA 3ELQA 4QRRD 4CKVX 3A67L 5CZRA 2FIKB 5TF1L 5IMMA 1DYZA 3BP7A 2NNFA 1KXTA 5ITFB 3KLKA 1KIQB 2JCWA 1F58L 5CGYD 2A6IB 3VG9B 2YC1A 5F89A 4HFUL 4ZNCD 1SXAA 2Y5TA 3NRPA 4U1GC 2A9AA 2E47A 3PJLA 4NBYB 4I4WA 4PJGB 1A1MA 1YMHB 3DYMA 4MMXC 2H2PC 3PG2A 4YSPA 2NY2C 3OB0K 3BKCL 4PJ9D 4DKTA 4NQED 3BI9X 4GI6A 3QE5A 4OV5B 4KJQC 1IFHH 5FO2A 1MLCA 5JOFA 1KBWA 2E6QA 1NGPL 4N2GA 2FEDD 1CGUA 2WZ6A 2GK2A 3ZKXB 4DKFH 5B1AB 4LCYA 5HVFB 2HVKA 2RIKA 2GTQA 2XUWA 5HJ3A 1AZBA 4YDKL 4JNXA 3DO3A 2XTSA 3FSOA 2NNAB 4QRUB 1CIDA 1G1CA 1XH0A 2APWA 5HHME 1CUOA 1WRFA 2BH0A 3JV4B 4LLUB 3TYFB 3V0IA 1ZK9A 2VJ0A 2FEEI 3HR6A 4Z7WE 5DHEA 2ZZUT 3VH8A 3L2NA 3ULUL 4B9ZA 4OIBA 2YPLB 3L7FA 4H8WL 1BYNA 4XP6L 2P8LB 1RZJL 4M7LH 4ZQKB 4HUWB 4BD4A 5DZPA 2BNRA 5C0CB 1NC2B 4W6YB 5AW5B 5LBSL 1SOXA 3LQZB 2IEPA 2PXYA 4NOBA 4ONGH 5E99H 5I17A 4MS8C 3RVVC 4XXWC 3U6XS 4HHGA 2NDGA 3MLSH 5J9PB 4HWBA 2FZ3A 3DRQA 4MD5B 3ESPA 1Q9LB 2DWYA 3U48A 3HPJB 2G30A 2XKSA 3ULVC 4F2FA 3IWVA 4FMKA 2XZAL 1DQMH 4TSBH 2FR4B 3ZQXA 2V37A 4TSAH 2L7EA 3S5LA 4O5LL 3VYOA 2BVQA 3ARYA 5EEVA 2BIMA 4PRPD 2F54D 3MGTB 5T1DL 3FUEA 3S37L 4ZD3H 1MFNA 4GSRA 1RAMA 3VYPA 3GSRA 2ZUVA 4QJ5B 1VFMA 2J20A 4XAKE 4P5TD 2NX5E 1MCIA 4LSTH 2EAEA 1BECA 5EU6A 1QKZL 5AZ2H 3GHEH 1XSJA 1E8YA 3QNYA 2P9RA 2EH7H 3ZMRA 2WQAA 2VDPH 3NACH 12E8L 4JFOB 2QZ5A 5IM7A 1DQLH 5AB0A 2BOCA 3WXVL 1X7SA 5FHBL 1HYSD 4BSVA 1ACYL 2ISDA 3CFEB 1OGAA 1AE6H 2NLJA 3MJ6A 1H3UA 3C87A 3BUBA 5IK3B 3POCA 3MI6A 3LIZA 2BHFA 4B0MB 1WISA 3UG5A 1DVXA 3I9IA 4N0CC 3O8XB 3ULVL 5BOPA 3CLWA 3JSSA 5B7MA 3ABMB 3ORJA 1X5JA 4X4XB 2Z7UA 3D9AH 3MRCB 4XCNB 2RGSA 1NUGA 3BPLB 2NZ9D 5ABAA 5F88B 2X9WA 3DGGA 2O93L 4RA0C 2ZF8A 4Y4KD 4KY1L 4LSPH 4P2CG 5DURD 1MAML 4PG2A 1YPZB 3GJEA 1S7TA 4HK3J 3RB5A 5IJVA 3EFDL 3IDYC 3VX1A 1BIHA 2EIBA 4H1LA 5E51A 5E6IA 1OIOA 1XF3A 4JGJA 1OZTG 4FABL 3T0XA 3UAAA 5KG9B 4NHCH 5ABZA 2VLKE 3W5MA 5AVVB 2APVA 2CM5A 4P2OA 3TX4A 1L0YA 5KVEH 3MRPB 4BSWB 5HHOD 1U3HC 5IF0A 5K33A 4HD5A 1MF2L 2H4EA 3GYRA 1BQLL 4OKVB 4MJ5A 5GGSY 1A3RH 4EKXA 4IGBC 1DJIA 1FFPB 1IGFL 1KXHA 4XMZA 4YSOA 4H5SB 1N3NA 2OMNA 2XV3A 3ZDYE 2XN9E 1VJSA 1T5XA 3KJ4C 4JVWA 3TJPA 1IGMH 1HQRA 1EV2E 1M7DA 5IQMA 5KTEL 5CBAA 1KIUB 3C5SB 4K23L 3V6BR 5FV2A 5EU5A 4FG0A 2ITCB 3MRIB 3NDZE 3KD4A 5CIPB 3MFGB 1GL4B 3DO7A 1RUPL 1XVSA 3GZPA 5F0PB 3T0EE 4BK5C 1HDMA 2R39A 1TEFA 3AFLA 4PY7A 1WWBX 1J10A 1AZNA 4LFHD 4QHPA 3S35X 5FKPA 3GBML 1HC1A 4BQ6A 3AGVA 4Z1PA 1BV8A 3C5SA 4BBWA 3ZGHA 1NM4A 2FGWL 3ZL4H 1BG9A 4UV7L 5I0DA 5JORA 4PJ7A 5IP4A 1P5UC 1UWEL 2K4WA 4GO9A 1UEMA 2X1WL 1D5MB 5C9JA 2VR3A 1A6PA 2I26N 1M6UA 4RESB 4YXLL 1ZS8A 3JV6A 4OZFG 3CFMA 3KPRB 3RWJB 4D0CA 4JDEB 1SF3A 3ZTCC 1JPSH 1NFAA 8PAZA 3CH1A 1T1WA 4QRPD 1A9EB 3HBZA 4FQ1L 2WO4A 2QMJA 4OD2B 3BGFC 2F5AL 3CV5A 4GXFA 4PLKC 5CJQL 2OYPA 4J3OC 3IJSA 5I8EA 3CK0H 2UXGA 1W0YT 2IWEA 4I9WE 1HXYB 1X4ZA 4LGRB 5HY9B 1KJVA 3O6FD 4HC1H 4AQEB 3KPPB 2QQQA 1MZZA 5I5JA 3RPIB 1LO4H 1QWUA 3T71A 2ADFL 3OR7A 1OQOA 1QLFA 1UCBH 4A04A 4RAUA 3QNXA 4GSQA 1A7QL 4P4KC 5IWLC 3OB0H 3TT1H 4WI2A 2OMWA 4GLRH 4MB5A 4HQQL 1QFWM 1GMIA 2YA1A 1DJYA 3RGHA 1DR9A 4Z7QF 4WLCA 1EK3A 4PGCB 5AZEH 3KGUA 4X5RA 2IH8A 3QIBA 4FLQA 4DO6A 3AXHA 3TBSA 3IJ7A 1A7RH 1LWRA 2PWGA 4IU3B 5D1XB 2Z0UA 4XBMA 5BZWB 4PJXB 3AU0A 3FB6B 1G7QB 2FO4B 4XRCA 1MOEA 3VXMA 2V2TA 4DGUA 1GOHA 4U1IB 3F6IA 3RIFK 2YGVA 3H3KA 2CJTA 4KX8A 5SX4H 1E6JL 3VGAB 3WNJA 5L7XL 1UT1A 4JPWH 4QTFA 1EHNA 3J2PA 2X42A 3IFNL 3RX9A 1MHHA 2LFEA 2WN3A 3UJJH 2V5TA 4EI5B 3HAEG 4UINH 4P9ML 4AH2B 3AZUA 4TTDC 4KI5D 5JHLA 1FL5B 4C4BA 1GXEA 2BVOA 4WHCA 1AKPA 3S34H 5A40E 1TZGH 1XB8A 1KPVB 3QQ3B 1BVOA 1F00I 5EOCL 4AL8H 1XH2A 5AKSA 5KYNA 4M9PA 1T4WA 4CNIB 5HYJB 2WXKA 1MFUA 4PJAB 5BOJA 2NUPA 1CI5A 3IGLA 5F8QC 1JD7A 1OM9A 4TLTA 5I0YA 3GSNH 3MV9A 2FWSA 4ODXA 2B1AL 1MRDL 5F7WC 5JQ6H 5SX5K 2B0SL 3TYGL 2J44A 3U4BL 4X7EC 1AZZC 4X99B 3HLKA 1DBMH 2VDMH 2Q87A 3WTTA 2WC7A 2WSKA 2PTUA 3LCYA 4I9WD 4M7LL 4XVOA 3CSBA 2FWUA 1UM4L 4F15C 2YRBA 2P8LA 3INOA 2ZUQC 5EH1A 2JE8A 2ZUYA 5A2KH 3ARDA 4XVUC 1DJGA 3K91A 3SQOL 3EGXB 4B5EA 3NCWA 4PUBL 3FSWA 1P4IH 3VCLB 2FECI 4XVSH 1U2CA 2IVFC 3STZA 1XZWA 5D2NC 5BZDB 3B1UA 4N2AA 3AM8A 3GHPA 5AKRA 1AZVA 2WXHA 2XWBB 4AJWA 4F8QA 4WO0A 3S96B 2F7QA 2CG9X 1D6VL 3RNKA 4WU7B 1AZUA 3T0EA 1B0GA 4JVUA 1S7QB 1BD2E 3QYCA 4HC1A 4U4BA 2DTMH 1IKFL 3WNPA 4RZKA 1E4XH 1MFEL 4E42B 1NLDH 4XC3H 2CDFA 4P23B 1CGTA 3H3PL 4FNPA 1NINA 3ZDWA 3WGVB 4FZ8H 4UUJA 4FFZH 1VHPA 1IQDB 1N5AB 2JKLA 1MELA 3CU1A 4TVPL 2AS5M 2XXFA 3KNBB 5JNYB 3GT6A 3N42B 1EEZB 2W9LA 1P84J 4Y2DD 4Z7UB 2ICEB 5C7XH 3EH1A 5B8CC 2BIHA 4P59L 4HX1B 3S3JA 4NWTH 5CJXA 4E9SA 4WI8A 1ROCA 2LABA 1AFVH 4JFEA 4WEBH 3PFUA 4GG6B 4YIQB 2FIKA 4YHML 4GMSL 3QIUC 1S9WA 4LL9A 1V7NH 3RBSA 5T1LA 1UB5A 3L6FB 4F8OA 3TF4A 3B2UC 5DO2C 5I8OL 5KTEH 4NJAH 2QQKH 3D18A 4MMZB 1AOHA 1TLKA 1TO5A 1ZSHA 3LTVA 2EDNA 4XP1H 2VXTH 3FQTA 5FGBA 1MCCA 3SDXE 2ZCKL 3HZKA 3OZ9L 4G42A 2VW4A 3NP4A 5IG7B 4JFTA 4M8VA 4N8VG 4JKNA 3V0WL 2X10A 4B9KC 4MCZB 4UOJA 4ABVA 1WEJL 2JQMA 3ZKMC 1YY8B 1EFXA 1QTYT 2CAKA 1CICB 1DBBH 3BD4A 4QHMA 4MCNA 3UBXA 5JHLH 3FSAA 4JO1H 4Q0XL 1Q90A 4XPAL 5FO9A 3P73B 4BHUA 1FO0A 1RJCA 5ICXA 3RG1C 5C0GB 1N7ML 4WK2B 1FFOB 1U58A 2OSXA 3QCTL 3QZBA 4K7PH 5BO1H 3SDAA 4R90H 4XBGB 2ADJB 5D7SH 4CVXB 2DQTL 4GW1B 3NCYS 3ARGC 1B2WH 2P5PA 5IFHH 3R7QA 1AZRA 4UMSA 4RSVA 1OK8A 3GRWL 3HE6C 3RJDA 4QO1A 3S5LG 4GRWB 3MUZ1 1ZEAL 1INDL 4I2XA 5K69A 4AEIH 1UM5H 4FQHA 4GP5B 4PRHB 5IOKA 4IRSD 4PUBH 1HL9A 4WW2C 2G2RA 4KXZH 1CFNA 1WZ1L 2G3XA 4G9FB 3DJRA 3G6DL 1BAWA 3E8UL 4YBHA 4PRBB 4GKSA 3WJJC 1E8WA 4Q7DA 3HEIB 4FI7A 5EU6E 1RU9L 4JK0D 3B7RL 2ICWJ 2C9SA 4QHNA 5E5MA 5C08A 4CVUA 5DZJA 4KUCD 3RGVC 1JI1A 2X6UA 4MJ6B 3NFNA 2ALWA 5E1HB 1E9QB 1M1XA 4Y2NA 1J8HD 3OWEA 5DMGC 1PNDA 2KDGA 3Q6GH 2D9QB 2DW5A 5IHBA 4RGMC 1I3UA 2ZOKB 3TN0C 2IPTL 1JFQH 4JUTA 3IMSA 2C1PB 1B2WL 1NCIA 5D4QA 3WHE0 3WIIL 4JPIA 5E9AA 3NN8B 1VKXB 5AVSB 1NCWH 3WFBL 1KB5A 3WU1A 3L3DB 4DJMA 4LL4A 2UVEA 4H44C 3DJZA 4KXCA 3OQ3B 3V0EA 3MRMB 4BA8A 1HXKA 4BA0A 1NTDA 3ASWA 3UEQA 4RGND 4Z7OE 4QYOB 5FGBC 4NN7B 4JFEE 3AB0C 2IWFA 5MERA 4A6YH 1V7MH 5D8JL 3PQYD 1BIIB 2OXHB 1IAIL 4NUGL 3L9RB 4MD0A 5TGBB 5B39A 2IGLA 3W57A 3R18A 3DA0A 1D2OA 1T5WB 2F54A 5EWIL 4TSBL 1UD8A 2C9UA 3PNWA 3MRHB 1N67A 3FT2B 3V0WH 4Z7IA 3B2MA 1N9PA 3V0GA 1GMEA 1T7YA 2P8MB 1K3ZA 3JTTA 1NFKA 5FPIA 4MB1A 3X17A 3PUUA 3FOLA 5DVNA 1A21A 1X9LA 3EW3B 4NZFA 2G2NA 1YY8A 3WUWA 3RDTC 2B9BA 2CA4A 4M93B 5AW1B 1BBDL 2AF2A 3O2VH 1KXVA 3WE6B 1E7VA 3HC2A 2V5MA 1NKGA 3L7EB 3SPIA 3UC0H 4KK8D 3ABZA 4QY8B 1JNHB 1AD0A 1E5AA 5MEOA 4GRMA 3LNGA 1BZ9B 4BFOA 1FSKB 5E8EB 1YN7A 4XP5L 5DSCA 1RKRA 1LO4L 5DHVA 4ZMTA 1Z0NA 2W0LA 1CXEA 2JKTM 3HR5A 3VDBA 4HYTB 3NCEB 3UZQA 2Z4QB 2XPYA 4R5VA 3SIKA 1MW1A 1QFPA 1DBBL 4N0UB 2ZWLT 1ZXQA 3VACA 3KLAA 3LIZH 4X0KA 5GGSA 5FR3A 3JXAA 4X8JB 4F92B 3BHBA 2HYMA 5DQ9A 5B3NA 4Q52A 4E42A 1X5YA 4Z7VB 2AJ3A 4LBEB 4F58H 3MV8D 3WFHA 4S1QH 3VG0L 4X6DB 4QRRE 2CLVA 2AI0L 3WMPA 2E27H 4GQ9L 4BK5A 2JFCA 1KBGH 4WV1C 3MRJB 4BDVB 2JK5B 2ZXAA 3PXLA 3W0WD 4HZLB 4ORGB 4PJ8C 3UL4A 2JV6A 1DANU 4EBQH 5DK3A 2A3TA 4IGBB 1MPAL 2YUVA 1I1RA 2IFGA 5A7EA 3CG8A 1YEDA 1ODAA 3ZIMA 3VXSB 4TVPH 4LF3B 1URLA 4PTUB 5A16A 1BA9A 3QNXB 1AXTL 4KO5A 4MGXA 3F7RA 4X6CB 5E6UB 2YXFA 4XN2A 5EORL 3FO0H 2ZXQA 4KK8C 1VESA 4O00A 3GMPA 1SYVA 1LXMA 1IT9L 3ARRA 4AL8L 3QAQA 1A6TA 2FH8A 3F12B 5G55A 1UKSA 3G6AB 3VDAA 1L4IA 2IG2H 5E95B 1MAKA 4TTGA 3UFIA 1RY7B 1EXUA 2EECA 1THCA 2OR9H 4X6CA 2ZUXA 4XZUB 4PTUA 2J57A 4JN2A 4WK4B 5C71A 3H2WA 1F3JA 1ZHNA 4PS8A 3IFPA 3BW9B 4FJ6A 2VERA 1JJUA 4H0IA 3E80A 3FB5A 3OC5A 4NHCL 3ZT6A 1Z9LA 3KXFB 1NDGB 3JWDL 2P47B 1YMMD 3EZJB 2JWYA 3MGOB 1MIEL 4J3OG 2RTTA 1AD9B 1QSZA 4RISH 3MLZH 2IQAA 4ZBJA 2OMYB 3VI3E 43CAB 1GTNA 1SRDA 2EADA 2G3ZA 4EF3A 1PZ5B 1DQDH 4ERSL 3CHSA 3EYOA 5FUOL 4R7XA 3LYRA 4XTRD 4L8CA 5DJ2A 5JW5A 5AOLA 2XG4A 5E2JA 2C3HA 2WXFA 3LRHA 4JLRB 1UYWL 2NY5H 2JELL 5KSBB 3ARDD 3HHSB 1GGBH 4WWID 5I0WA 2NR6C 5K9KA 4RMQA 3HFML 4NM8H 1IM3A 4GXVH 1INEL 4JDZB 3UZQB 3N44B 1DVFB 4JY5H 4XNMB 4QLWA 3IDMA 4L8BA 2GJ6B 4JANB 4MD4A 3K72B 4LESA 4D8PA 2MTAA 1NSNH 2VL5A 4YHPA 3RJOA 4CBZA 4ODSH 1RIUH 2PXYC 1KG0B 3DVNB 2YD3A 3DPBB 4E5XA 5TDOB 2GIMA 4M9OA 3KPSE 4L3EE 5C8JB 2FO8A 5HD8C 4LP8A 3JV0A 2X4NA 2VABB 2VLRA 4DUWA 2HTLD 3OKMB 3VRIB 4YHLL 2J71A 1I1AD 1CFQA 2FBJH 3PV6A 3L3IB 4DP4X 1QUNB 4HF5H 3FYIB 4S10A 2W9EH 2X2YA 4KROD 1EERB 4Z8FH 2J2ZA 1EWHA 3OGCA 4H1LB 4HXAH 1L9MA 3L4CA 1A4KA 1Q8MA 1H3PH 1RPQA 2R4RH 2VMJA 4GW1A 2Z8SA 2FLRT 3KGSA 1UXLA 3BVVA 2CM6A 5KOVC 3VFGL 3O45A 3TEYA 2IWGA 5C0GA 1UH4A 4FG2A 4LOUC 2RBLA 3DX4A 4XCNA 4HWUA 3GSOA 2D7NA 3FCGA 3LSOA 4YBLB 2WSDA 2A1WL 4L1SA 1PZ2A 3EJUA 3ISYA 1I1YA 1U3JA 2VZ1A 3WLWD 1CYGA 1I4FB 5DA0B 4NQDB 1N8ZB 3QXVA 1O0VA 1O6SB 1IX2A 2A0LD 2AJSL 5C08E 5GZOA 4A7VA 5IR1A 4JW3A 1OCOB 1YECL 4PJHB 1CFVH 1KPUA 3D18B 1IBGH 3NJHA 3GPEA 3H56A 4NQQA 1MNUL 3TEUA 4YHIB 3VWJC 5LN8A 4P23C 1I85A 2ZYIA 1ED3B 1HDMB 1TJIH 4BQ9A 2OSLB 1ZDSA 4QXTA 2NPLX 4Z95H 3ELAT 3KYNB 4CC0A 2WAQA 2FJSA 4KHTL 1YEEL 1SLUA 4PRAA 4ZUVA 1D5ZA 2VXVL 1LHZA 2G3NA 4K5PA 3ME0A 3T3PF 2VXSL 3CE1A 3GJFB 4JM4H 3IDIA 1ACCA 2N3JA 3CFTA 3OSKA 4FABH 4PJHF 2ZKMX 2MQGA 5CSZB 1AHKA 3AS1A 4MJ5B 5BS0E 3U6RA 4P23A 5HHQB 1CYXA 3DROA 2C3GA 1IC0A 3Q9QA 1SMAA 1X6NA 3AS2A 3TN0D 4APQA 3T1FA 1F1GA 3R19A 3A0OA 4OGAC 5IUSA 4WU7A 5T5FL 5I2IA 2WUBH 2IV9A 1QATA 4I2XB 2VDRL 1MHCA 3GBNL 4PSRA 5IHWA 1OP5H 1T1ZA 3SCMB 3HNVH 5DWPA 4EE2A 4LOEA 3PXJA 2YKKA 3I84A 3O2WH 3GS0A 1OTSC 1YPZA 3GJEB 4J4PD 5IJVB 3ZYOA 3PJSA 1GGBL 1MJJA 5I82A 1IV8A 3BMVA 3GB7B 1NL0L 1RQ5A 2XVGA 3DX9B 3D4YA 3NJGA 2J56A 5E2VH 4UYQA 2ICES 1PQZA 3PWVB 1H3PL 5CZKA 1LILA 1SDDA 4R5XA 1J12A 4N2EA 1KJ3L 1AC0A 4MJ2A 3IFOB 3UXFA 3VWKA 4U6XA 4JRYE 3QYNA 1EAPA 1CDGA 4N8VB 5KAQG 4OGXH 1JL8A 1G87A 3GMRB 4FQCL 4Y0GA 1IEBA 3UX9B 3UROR 1CL7I 5K59E 4DP7X 3L6FA 4AEHL 4KMLB 4NQEA 4Y19E 3WEOA 3I9AA 1AS6A 2WD0A 1ORQB 2R0ZL 3APDA 4U3HA 4ZPTA 3MLRL 3UERA 1KYDA 4RGMB 5F7DB 1G5AA 3QXAB 4JB9L 1SMOA 4KK6D 3BVNB 2XTJC 2E7LC 3VXPB 3IF1B 1HHGB 4BELD 3VNYA 5KSAB 4MRCA 3WHE1 3DOSB 4QUOA 4MNHA 1G4MA 1XCTA 1F90H 2CBPA 4P4RA 5D4IA 3ZZLA 4ZMWA 4CC1A 3VNZA 5EBWB 1D7DA 4OZIB 5AG9A 1J7VR 3PGDA 2Z35B 4M61A 3PIQB 5F7KC 1U8HB 3KEDA 5F7DA 1W15A 2GSMB 4ZPTB 3CPUA 5FC9A 1PY0A 2YXWA 5E99L 3MBEC 2MEJB 1A9VA 3ARGB 1VFOA 4XMKL 1F13A 1HZHH 3RWEB 4PD4K 1EANA 3CQPA 3PFQA 1JBJA 2BNRD 2PW1A 3KPLB 1IEBB 5CO1A 1G6RA 4ZAKB 2XQ0A 4E0RB 4IRSA 5C07B 4C8XA 4AYDC 3B9EA 3U7YH 4B97A 4ANKA 1S7WB 1CDJA 3JTBA 2FH6A 3L54A 1AI1H 3BVTA 3QO0A 2DQIH 4I9XA 1W6LA 4P2QE 1QBBA 1LO3L 4E9RA 1JGUL 4FI8A 1PD6A 1ZHBA 4AEFA 4S1QL 2VXSH 5LKNA 4YGAB 4RMSA 3F58H 1A6VH 3GJFH 3II2A 2JIXD 2Q76B 4TNEA 5AWNH 4AT6B 4J27A 1YEEH 4Z23A 4MNGE 3VAEA 2CLRA 3DX1A 1SJVA 1NC4A 4XCCL 5ACZA 5I5IA 5FECA 4LLDB 4R4ND 3UO1H 2EJ1A 4PJDE 4G5ZL 4P9HH 4RGOH 2W88A 4XP4L 3B3IA 1FH5H 2R2BA 1QSFD 3BGFB 3R1GL 5DJCB 3ULAB 1DHKA 2R0WH 3H42H 2N0MA 1JZDC 5F71A 5HXMA 1MCOH 3BFWA 3KR3L 1Y0LA 1GIGL 4N0YL 1II4E 4Q6KA 3SEPA 4ONGL 4WSGA 4IDJH 1EAJA 1OCZB 2HX7A 4HKZA 2BVOB 2DM3A 4X4YA 4KXBA 2XWDA 1Z5LB 2XNAA 2V2XA 4Y2LA 1XAKA 5CR8A 2UWEF 3DKHA 1I9IL 5C9KA 2MQ3A 4HPYL 4OCYH 4PREA 3VB9A 4J3UA 2MHAB 1DBAH 3CN1A 4EVNB 5ESQB 4P2YA 4KHXH 3VD0A 4JRWA 3SZKC 4JG0H 4ZO7A 2FYYB 4N6RA 3GLAA 4Q8BA 3HG1A 4NQEB 4PP2A 4BQCA 2EICA 3GUTB 5HHOB 1ZSDA 4XMTA 2X38A 3L4TA 4ZXBC 4V1DE 3S3DB 1L7IH 3W9DB 3HZ3A 3L4VA 4AVIA 4HIPA 4HS8L 4XBEL 4CSZA 4I5BA 4OZHF 3H7BB 7TAAA 3HB3D 1H8SA 3ARDC 2KI6A 3TO4A 2HLAB 2BP5M 5TK4A 4F15B 3TBTB 1N8ZA 5K9JH 5AW4B 3BIKB 5B7FA 1I1YB 1ZVNA 35C8L 2ID5A 3B9DA 3DXAE 3K6FA 4KMTL 2JKIS 1U8MB 2YPVH 1HHJB 4DZBB 4NO0B 5AW2B 3HE7A 1LO3H 1PSKH 4HDIB 1F1DA 4RAUB 1JZHA 4LDCA 3A23A 4HT1L 4ANXA 1SEBA 5DDHA 3L3OB 3OF6A 2Z64C 4M4RB 1QG3A 3KPMA 5E00A 3L3GB 1ZIBA 3OGCB 4U1KA 3U0WL 3L48A 3MRFA 5B21A 4MJIB 1UM4H 3CHRA 3MV8B 1JD9A 4J8RA 2XWXA 3D48R 2FDBP 3BKYH 3OKNB 4A7TA 5I6KA 1UURA 2Q0ZX 5IFAH 1ZD6A 3MMEB 1XEUA 2BS9A 4BWUA 1SXBA 1HX0A 1N26A 3PWPB 4ZT1A 2J8UB 2ENSA 1G7MB 3HZYB 3Q9PA 1UZ8B 3P0VH 3US0A 1CVSC 1GJUA 2VL5B 4YHPB 2I25N 2WLNA 1N8OE 5C9JB 4L8BB 3O8XA 5DVLA 4FP8H 1FCCA 3WFEH 5HBBA 1CDIA 3CFIC 5IMKA 4WTZA 1J0ZA 3NSXA 4P5TC 4B3EA 4ODUB 4OLWH 4CVWA 4UQIM 1A6ZB 5E8NA 4XWGH 3O3EA 1S78D 3MTXA 2KC0A 2NNXA 3PWJB 5DUBA 3VD1A 4IOSA 4Z76B 1ED3A 4JCMA 1N12A 3VD5A 4CJ1A 1OTTC 4ZPVA 2ATPA 5G4NA 2V7HA 4TNWK 4QT5A 2WHVA 2OAAA 3ILEA 3D30A 2G5BA 1PG7L 4OGXL 4LLVB 1QW9A 4MWFB 1MI5E 3KH4A 4OIAA 1C12A 4X5XA 3LMJH 1FFRA 1L7IL 1DVFC 1GKEA 1HSBA 4KO9A 1M2VA 1S9VA 1VCBC 4OD3H 1RURL 2E7DA 3K81A 4PCKA 4IYKA 1FLRH 4JO4H 4NB7A 1Z2KA 3FUFA 3JV5A 1EJ6A 4YHOH 1UZ6F 2I27N 3JUZA 2DJSA 5D7LB 4BHUI 2NX5A 1EHLL 1A6UH 1PFCA 1RUKH 3BW9A 5MEQB 4WCYH 2IXQB 2GBUA 5IHZB 5IB2B 1A7RL 2KZBA 5A6LA 3STBA 3E3QE 1LDSA 1ZEAH 5BRZE 1KCSL 1JRHI 4L4VE 3QGVA 1JV2B 3KPQB 2PYEB 4LBAA 5CIPH 3UEZA 4CW1A 3Q5YA 5DK2A 5HVHC 1L9SA 5DJAB 5DZNA 2JJTA 4U6HA 2QJDA 1F2XK 2ENJA 4RAVB 3S0PA 1SEBB 5DDHB 3CXHK 2PP7A 4HBCH 4GOSA 1PZSA 1BLNB 1NAKH 2UY6A 1E3ZA 4LLWB 1U3HD 3ALXA 3GEWB 3JT2A 5FCUL 2E9BA 3VFVB 3QUZB 2CCLA 15C8L 3IPFA 4NN6C 4X4XA 3L4YA 4R9HA 3WEXA 2DYSB 5T3XL 3K72A 4D8PB 4U0RC 4PJ6A 3Q6FB 3MJWA 4KI5E 4RMUA 4O2CB 2JK5A 1YNLH 4Q6YA 3Q3GB 4Y4FA 4AQ1C 3QEQD 3LS4H 4UQCA 1NBZA 2WJ7A 1YPZF 4PWEA 4HUVA 3BJ91 4PJIF 4UZSA 2OTUA 3G5YA 2NY4B 3MRRA 4CAGA 1DQJA 3LS5H 3N85L 2G0LA 2AGJL 3OPUA 5C6TL 4KKAD 1FN4A 3HMWH 4ZK8A 3QZOA 4XCYA 5DVKA 3QUMH 3CXHJ 1SJXA 3CFQA 4X5WA 4V1DA 3RFRA 1KLGB 2D7TH 2A38A 5E8PB 5C3TA 4F7PA 5ITBH 2V17L 3KHOA 5ABDE 3BWAA 3W3BA 5HGHA 3ZE1F 3GINA 2OL3H 3IS1X 4GG6F 4JG9A 1XGUB 3FH5A 1IBBA 2I9LB 2D2OA 3F7YB 5F7HA 4FYSA 2Q8AL 2BWDA 1X5FA 2XWRA 4RH4A 3FB5B 5JQIB 5E8EA 2CUIA 5T3ZL 1PFOA 4LVEA 2DQJH 1UTDA 1IGJB 4EN3B 1ETB1 3DIFA 3O4OB 4AC2A 4UOW1 5L2KE 2QTEA 4RMRA 3IU4L 4GW5A 3DURB 1RVFL 1DJWA 1YNTF 5KJRL 4MASA 3HN5A 2PUQT 2VDPB 3KYKH 1SHMA 1WIUA 1PZBA 1T7VA 1CFSA 1JGUH 2QGBA 4NPKA 4A2MA 3BVUA 5KYWA 4NENA 2CSPA 4P46D 1EMTL 5KVFE 5I17B 3VI4E 4XP9H 4GNKB 1RP8A 3PAUA 4FQIL 1P7QB 3VQ1C 1Q0YH 4RMTA 2R1YB 4PJDF 3WMSA 3U7YL 1DTUA 4UQ2B 5DHYA 1SJEB 1HYSC 1GTFA 4ZO6A 4UI2A 3VRJA 4N4YB 2BFGA 2GUYA 4AV0A 4Z7WB 4PW9A 1HU8A 1I3RB 2YAEA 2VT0A 5A2CA 2OMUB 2WKOF 2YPLE 1DFBL 1FC2D 2I9LA 1GC1L 1TMQA 3CZLA 3H9SE 3Q8BA 5AUMB 4P5SA 4LLAA 4MA8H 4TUJB 1HILA 4P48A 2FYVA 4J6IA 1CQYA 5HVGB 5C7ZA 5C0CE 3BP6A 3L1OH 5DR5L 2B08A 2OR8A 2XC8A 3R8QA 3MVSA 2VDQH 3LVEA 5KSAC 1SGKA 4ZG1A 1UD6A 3IN2A 1NCHA 3KPLA 5D5MB 2M2DA 4L29A 5DEGA 3UAEA 5K1JA 1WICA 4FXKA 4L37A 3AG4B 3ROLB 1JZ2A 4BKLB 1FVDB 4LLMB 4Z7QE 4JHAH 4JMXA 4WSKA 4DETA 2QQLL 3ZSTA 5LQBH 3IVKA 3VGBA 3QJSB 2ZOKA 2Z1KA 1IEAB 4PCYA 3GBNH 5G2NA 1YMHA 4MFHA 2XSKA 2YMXL 4K3DL 1S8DB 5BO1L 3IJYB 4R5TA 4R7VA 4WFFE 4JRFA 3N40F 4ZOCA 1IKOP 5I66A 3WNLA 4S0HA 1Q9WB 3MLXH 5DFAA 3VFPA 3BT0A 4NGHL 1PJ9A 5C09A 1ODUA 1TMCB 1RZKL 4OIFA 1OPGL 2WPGA 4Q9QH 5ADPH 1U8KA 4UOQA 3WSQL 2Q7YA 2JKWA 2LLLA 2VDLB 1HIMH 2FSEB 4HJEA 2VUKA 3DMMB 1OW0C 1GVIA 3HBPA 2XPZA 2ROYA 3KGTA 3GMRA 2AEPL 4PP1D 4CILA 4J3WA 1HI6B 5DEFA 1NBYA 1YN6B 4G6KL 5JTWA 3QAZC 1NL0H 5JOEA 1ZS2A 5EEWA 2AXFA 4HWNA 3QUXC 1AZCA 3LQAH 4R0LB 1RFDL 3CSTA 5AZEL 5EC2A 1YCSA 2ZX6A 1TZIB 1YYCA 3BGAA 4D94A 2YHGA 1C16A 1DLFH 1NGXB 2YD2A 4AL8C 2CBTA 3CHQA 3HUJE 4ENZA 2VR5A 3BFQG 4OZ4A 4PV8B 3GBMH 3LXUX 1UCBL 4KVCL 5C0IA 1MPAH 3NJIA 4WI4A 4A2GA 4TUOA 4XC1L 4AQ8C 1WJ3A 4Y1SA 1L0QA 3QXTA 1F1AA 1C5CL 1R19A 2VLRD 4DQOH 3MV9D 3SDXF 5EC2B 4FZEL 2HKHH 2DI9A 1IU1A 1NAMB 1JP5A 3JWNG 1B6UA 4YDJB 4KQ3L 1V05A 1YPZE 5ICZA 4G42B 2X2JA 1YN6A 4FQ1H 2X6VA 3NP3A 3DJ9A 1AG6A 2WKOA 4HJ1A 4KI5F 4LNRA 4PR5B 3PDGA 3BAEH 3V4PL 1XB3A 3CDCA 1IVTA 4MDIB 3V4VH 1UG9A 1KYFA 3L8QA 3MRDB 2VLKB 1TZ8A 3QR0A