2AQQA

Cu/zn superoxid dismutate from neisseria meningitidis k91e mutant
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
155
structure length
155
Chain Sequence
b'ASIEVKVQQLDPVNGNKDVGTVTITESNYGLVFTPDLQGLSEGLHGFHIHENPSCEPKEEEGKLTAGLGAGGHWDPKGAKQHGYPWQDDAHLGDLPALTVLHDGTATNPVLAPRLKHLDDVRGHSIMIHTGGDNHSDHPAPLGGGGPRMACGVIK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase [Cu-Zn]
molecule tags Oxidoreductase
source organism Neisseria meningitidis
publication title CU/ZN superoxid dismutate from neisseria meningitidis K91E mutant
rcsb
total genus 36
structure length 155
sequence length 155
chains with identical sequence B, C
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2005-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 2aqqA00
1OAJA 2VR6A 3HW7A 1SDYA 3KBFA 2GBTA 1E9QA 1L3NA 2Z7ZA 2ZKYA 1F1DA 1E9OB 2AQRA 2VR8A 1B4LA 4N3UA 1P1VA 2JCWA 2WKOF 3QQDA 2V0AA 2WZ6A 2E46A 1TO4A 1UXLA 2AF2A 3GTTA 2Z7UA 2ZKXA 4N3TA 2GBUA 3L9YA 3LTVA 2ZOWA 1IBHA 2VR7A 4A7VA 1IBDA 3L9EA 2C9UA 5KBLA 2JLPA 4U4IA 2WKOA 2K4WA 1PTZA 4OH2A 4A7UA 2WZ0A 2AQPA 3GZPA 1DSWA 1CB4A 3KH4A 2GBVA 5CU9A 1SXSA 1N18A 3KH3A 1YSOA 1Z9PA 2WWNA 3CQPA 5KBMA 1JK9A 3KM1A 1E9PB 1IBFA 4MCNA 4A7GF 3ECUA 3KM2A 1U3NA 2AQNA 3QQDB 4A7QA 1SDAB 1EQWA 1DO5A 1SRDA 3S0PA 1FUNA 1ESOA 2R27A 1E9PA 1F18A 1UXMA 1SOSA 3F7LA 3PU7A 2AQTA 3GTVA 4L05A 1SXBA 1QUPA 2WWOA 2Z7WA 1MFMA 3MNDA 2XJLA 1BA9A 1SXZA 1BZOA 1IB5A 1S4IA 2WZ5A 2LU5A 1HL4A 3K91A 1PZSA 1JCVA 1TO5A 1YAIA 2AEOA 2Z7YA 3KBEA 4BCYA 4BCZA 1N19A 3HOGA 4A7SA 1JK9B 1YAZA 4MCMA 2AQSA 4A7TA 4BD4A 2ZKWA 2XJKA 1EJ8A 1HL5A 1OZUA 3T5WA 1SPDA 1F1AA 2WYZA 1KMGA 1CBJA 4A7GA 1XTLA 2APSA 3HFFA 3CE1A 1E9QB 1B4TA 3ECWA 3H2QA 2SODB 2E47A 3F7KA 2C9SA 2C9VA 3CQQA 1OALA 1SXAA 1XTMA 2WYTA 3RE0A 1COBA 1OEZW 2NNXA 1SXNA 1Z9NA 1XSOA 3ECVA 3MKGA 1IBBA 4FF9A 1SXCA 1E9OA 3GQFA 4OJAA 3SODB 1PU0A 2Q2LA 5KBKA 1RK7A 2AQQA 1Q0EA 3H2PA 1OZTG 1AZVA 3GZOA 3GZQA 4B3EA 1F1GA
chains in the Genus database with same CATH superfamily
2E4TA 2NY5L 1R24A 3QS3A 3O2WL 1THAA 4D0CA 2K6ZA 3DX6A 1QR1A 1OK0A 3WO4B 2IBZY 4NKOB 5HVFB 4Z7VB 3QA3A 4OBSA 1SJEA 3BRFA 2L04A 4OGXH 2NW3B 5I66A 2ZT9C 4LHQB 1IM9A 3MCG1 4KFZC 1L9OA 5A40E 3MLPA 4R8WL 1AR1B 5EN2B 4B7LA 2IOOA 3F12A 1ZV9A 4L5FE 3ARED 5KSBE 1IGJA 2XIIA 3BP5A 4I0PD 5CSZA 3HBPA 3IWUA 4L9LA 1E4KC 3UX9B 2YSSB 4JKLA 2UZPA 3VD9A 3QQ4A 1F3JB 3GNMH 2DQGH 4JJ5B 4W9DC 1KB3A 4LSPL 2AJYL 1RKRA 2VZSA 1RUPH 3ISYA 2K4AA 3H7LA 3U4EB 4EI5B 1IC4L 1AQKH 5CSBA 5CR8A 4V1DA 1CFVH 5CEXB 2OMVA 5I8EA 3M1BA 5I1JL 3TNMA 2EO9A 4IDLA 4Q9QH 2BNUA 3S8FB 5KUMA 5D55A 3ZTJH 1NCCL 2NQ3A 4N20A 2VMJA 4BYHA 2AXHA 1EQWA 3CX5J 2ZOLA 5CJOL 4CC1A 2J6WA 2QKIA 4UM9B 1SQMA 3PJSA 1U8PB 3MX0B 1ZHKB 5ELIA 1QA9A 3TBWB 1T2QL 1Z9LA 2CXKA 4R4NC 3UOAB 4PWHA 5D1XD 3OAYK 3SE3C 4D0CB 4XVSL 4JN1H 3AUWB 2CBOA 4M8UA 4O02A 4OUOA 1WWBX 1C5BL 1ICTA 3BKYH 5HDBF 1L0PA 4PJEB 5KVEE 1ZWIB 1WCBB 4Z7IA 1DN0B 1P4IL 1YYLH 3FZUD 4ZXBA 4RBPK 1M71B 1N0LB 43C9B 1HINH 2P1YA 3EJSA 3F3HA 3N1FC 2OW7A 5CJ8A 5DMIH 4DZ8B 5J13C 1PZ5A 3CCHA 3K1DA 3K6DA 4JRYE 3RIKA 5H2BB 4N5EC 2CO6A 3B7RL 4QRRD 4XCFH 1FG2B 3GS4A 2KZ1B 1S9XB 1ACYH 3O9WC 3UTOA 4G8GD 3OZ9L 1QQDB 4NQXA 1J0YA 1Y0LB 2HFEA 4TN9A 4UM9A 4ZJ9A 1QI3A 4F9PA 5F3BA 1KN4L 4G9FE 5DYOB 3PY9A 4GG8B 2BSRB 4XT1C 1CL7I 2RH0A 4YAQB 1SLVA 3MRDA 4P3CH 4B9PA 5L4MA 2UVFA 4J6RL 5CP3A 1SDYA 4M9PA 2YKKA 3JWNH 4OCRL 4YFDB 3JBG7 3T2NH 1DLFL 2E9BA 2VR3A 2P52A 5DD1L 1U30A 5TDOA 4L8CB 4MAZA 4JJOA 4TUOB 3L54A 2Q87A 4FXLA 3KAAA 4CNIB 3GJFH 5IZ7A 4YPGB 3VUAA 5JTWA 1N70A 5EBWB 4KJQC 3RWGB 3VWKB 3II3A 3IJEB 3OKKA 2W65A 2XY2A 1T66C 1QMUA 3FH7A 3GIVA 1QFWM 2J73A 3OR7A 3FU0A 1JPST 4LVNB 3RVUC 4LARH 2B20A 1E0OB 1R0AH 3M8OH 3WTYA 3KDPB 2FATL 1F97A 2VLKA 3EO1A 1QW9A 5KSUA 3QUZB 3S37L 2UUDH 4YZWA 4KTYA 4Q56A 4JZJB 5E8NA 3RFZA 2EVHA 3KBHE 3UIYA 1SOQA 2V7NA 1BBJB 4MCZA 3VGFA 3KM1A 4GY4A 4ADIA 3F7PC 5CBEA 1BZEA 1OSYA 2B77A 3BXNA 1NIEA 3BWAB 3T77A 3TZVB 3W39B 4F15C 4FQIH 2OTWA 1M42A 2V5TA 4P4KD 4PWGA 1WTGT 4PCYA 3SKMB 5E24E 3EH1A 3HS0A 5J56B 4L18A 1FZMB 4EUPG 4Z3HA 1SQ2N 2FX9L 1I3UA 4GRWH 4PR5B 2VW7A 3QQXA 3WNKA 3UAFA 1PLGH 3QG7L 1V3LA 4HETA 3KLSA 4JPKH 1ZLUH 1CTNA 3PHSA 1I1AD 3R4DA 5L8KB 2X4OB 1FYTE 5FYJH 5SWZB 4R9HA 3FO2A 1I3GH 3GMPA 1QO3A 4H0IA 4KI5D 3VQ1C 2WZ5A 5B7EA 4MJJA 4UIKL 4XPBL 5C0AD 1P4LB 4Z3FA 5C0JA 1CLZL 2AJSH 4LP4A 4PG2C 2DQFB 2AJZB 2IXQB 4PS7A 2NPLX 3F85A 3L95A 2W9LA 1JTTA 5L6YL 2YUZA 1Y6NR 2BVQA 1P6WA 1BOYA 3B3IA 5IMKA 1S7XA 5IIEB 1R47A 2LU7A 5HGHB 3V4PL 4Q52A 2CIIB 2VABB 4MJHA 1F3DJ 2TRHA 4NO0D 3B2VH 4P2CG 1SLXA 1R1CA 2YWYA 1A0QL 3OKOA 4TSAH 3EBGA 3KPSB 4PJFF 4F1ZA 1CGSL 5DZJA 5L7XH 3B2XA 1A5FH 3CHOA 3OB0H 3QDHA 3S5LA 1YEDB 3FQWB 4JG9A 4XODA 4HULB 3DSFL 3MNMA 4APXB 3P4MA 1M53A 3ZE1F 1J5CA 1SMOA 2BNRA 2J8OA 2G4GA 4H26A 5KUKA 5HHMD 3EIFA 3EJCA 4L8CA 2O93L 4AM0B 3NZUA 2ZCZA 1BMGA 2I27N 4XP9L 3MBWA 1EEQA 5DJXB 2AXWA 5KW9H 1BZ7A 3ATEA 4KO7A 5AB2A 2ICEC 4UV7L 1ET7A 4JZOB 5GRUH 3S4SA 4Z8FH 1AKJA 3GDCA 3NQKA 3VXUA 4OI9A 2WVVA 2R1YA 4MNGB 3N44F 4JM2D 4JGJA 3TASA 1J0KA 4P2QE 4NO2B 1URLA 3GI8L 5JW4R 3IXAB 3SJVE 1OTSC 3LTVA 4ZX3A 1SZNA 4M6MH 2XXGA 2NUTB 3EDDA 2P80D 2YAOA 5LJYH 1IILE 3OXRB 1IGIH 5FECB 1FVEB 3HC3L 1GOFA 1JNJA 1HH9A 4K71B 5DJ8B 4AV0A 4MA3A 1YRKA 4QYAA 3H3BC 5D70L 3CFKA 3ZHFA 4JO3H 3DOIA 3MVSA 3ZTNH 4AOFA 1F5WA 4MDIA 4UIMA 4YFLF 5HGAB 4ZMVA 2Q3ZA 3PLYA 3PWPB 1AQKL 1EZVY 1A6PA 3HI5H 5JR1H 5HJGA 1WG3A 1UWFA 2CCVA 3DXAD 3WHE0 3C60A 1SDAB 1BBDH 3EFFA 4Z7UA 4YWGH 3TN0B 4PMEA 1UD2A 3GMPB 5AEAA 5DD3L 3MUUA 5I74C 1FYTD 4FQQB 2DI7A 4MQ7A 5I0XA 3NESA 2XX0A 3MRHA 3WFEH 1ZPLA 2MOQA 3ZYOA 4I0PB 5E1GA 1N68A 1KBVA 1Z5YD 2OTPA 2WXRA 1WYJA 3AREB 3ML9A 2UY6B 4O58L 4TXVB 4U1NB 4HHAA 3WNLA 2KMWA 4MJ2A 3QORD 5EIQA 3WEAA 4LSVL 4P46A 3EGSB 3K91A 3SGEH 3GSNA 3MBEA 4JRYB 4FLHA 1VKXA 3WTTA 3IM1A 3P0YL 5HI4D 1GAFL 4NZ8A 3G5VB 2XWBB 5BMFL 4WK4B 5B39B 2B5IC 3IKCA 1P4BL 5B1KA 1CIUA 2DJ4A 2BRRL 5CP3H 2GK2A 3OKLB 1BG9A 1TCRA 2O5ZL 1BECA 2GTZB 5T5FH 3RAJL 2WYZA 1KMGA 2ICWB 4FCHA 4ODWA 5FW7A 2YJQA 4XN1A 4RZKA 3O2WH 4Y4HB 2MPAH 3BEWB 3ZGHA 3SO3C 4RA3A 3FB6A 3L3DB 1HEJC 2AK1H 5IFAL 5E6YA 4Q4IA 3RBSA 1OGAE 3TNNA 2BNQD 2HVBA 1E6OL 1MCLA 4JCMA 3NACH 4PMFA 4Q9BA 4I2XE 1FSKC 3O41A 3QXAB 2QMKA 1BOGA 2D3NA 1GZQB 4WW1A 2C4FU 2JJTC 4HZ1A 1V5JA 3IPFA 2I9LB 3NJKA 4A6YA 4HWEH 3PAUA 2VJ8A 2WLHA 1HSBB 2CKBH 3HE6D 4EDWH 2OMUA 1S9WA 1UATA 4X0KB 4FQQA 2XOTA 2ORBL 5TE7H 1V54B 2A1WL 4QTHB 2X4UA 1DLFH 2V2XB 4BFKA 2YPLE 3JYCA 3ZQ9A 5JPMB 3DUUB 4MMZA 4R2GB 2PPFA 2QV2A 3SJVD 5KS9B 2J1YA 4FP8H 4Q9RL 2OMNA 1TJIH 3LRSA 5CLTA 1QPKA 3JWNE 4GRMA 4WU5B 2XWRA 2Q6WA 5CJXC 1LK3H 2XFGB 2JCCF 4TQPA 3T3PE 2NQDA 2NY1D 1BQ5A 1GY2A 1XGZA 5CP7A 1YA5A 3TJEH 1ECYA 3WNMA 3DX4A 2RR3A 3C09B 3GSXB 1IUZA 2NY2C 1W15A 5E1AB 3VSQA 3LZNA 3WEXB 5E2VL 2Z4QB 1UA3A 3GMLB 4XGZB 3S37H 3N43B 1JPSL 2G9HA 3S5ZA 4DEUA 1LEGB 4QT5B 1MREL 1OGSA 5D1ZI 2OBGA 5EZIH 3TEUA 3GRGA 4HJIA 3VXOB 2QL1A 3LKNA 3VAEA 4JZNA 1P7QD 2NQCA 4NQVB 2F5BL 2LGNA 2BHYA 5T1KB 4FTVB 3EYUH 4H1LB 2J44A 3BD5A 3T2PA 5E2TH 4GI8A 2WNGA 2Q7AA 2EVIA 3WS6A 4KTGA 2WUBL 3PF2A 1NMAL 4IHBA 3ZE0B 2P5WE 2PR9A 4HWUA 1AI1L 1G7LB 5FWRA 2Z8WC 3UZVA 5B4MD 1TQVA 1VB9A 3OPZL 4EI6A 2X4PB 2ZSVB 1VJSA 3L7FB 4HAGA 5E8OB 3OLIA 1FNLA 3HN8A 5CJOH 1NSNL 4NJ9H 4OFDA 5CSGA 2ZZUT 1NGXB 4KX7A 4G1MA 5K1VA 5KVFL 2YA2A 4I9XA 5DC4B 3P4NA 4JREB 3ULSA 5KJRL 2VUKA 3GKWL 1U91A 1YN7B 3FN0L 2NZ9C 4U1KB 2ADJA 3GF8A 2Q86B 2YBGA 2EKSB 3PAZA 1A7BA 2IEPA 1HQRA 2XZCH 2C9SA 4JZOA 2XQYK 3S4SB 4BQ9A 5A7EA 3NIGB 4RSYA 1DQQA 3IF1A 3MJ8A 1BQHG 1RPKA 2IDUA 3QXDA 1LO3L 3HE7B 5E2UH 2F6AA 4O9HL 4A2MA 3N43F 3DDGA 4KKPA 3MXWL 4ZTOH 3VXOA 4V2CB 1B2WL 3BPCA 1WBXB 1DBKH 3E1F1 2O72A 4NYLB 3V0JA 5CHNB 5KBKA 5JIHA 4J6IA 2KKQA 2ZWKA 5GZOD 3F6IA 3NABL 1RSFA 2DZEA 3QNYA 5FUCE 1EO8H 4HG4K 4POZC 4XVOA 5K9QG 2I85A 5CJQL 3HS9A 2XWJB 3GUTA 3G6AA 4RZCB 1FFTB 5HHQB 4PJIE 3VD4A 4JFHE 5HBBA 3M88A 4X6CF 5PAZA 2WQUA 2CNYA 5T3XD 1ZD6A 4XNUL 1CGYA 1HVXA 3S36H 2UXTA 3DC0A 4U31A 4JFZH 3G04A 2CA4A 2Z7UA 4MMZC 4OLYH 3CK0L 3OG6B 4XVTH 1FQ9C 3PWVA 5ID0A 4FQCH 1H3WM 4FNQA 1YECL 1M7DB 3C6LC 4LSTL 2UVEA 2QLVB 2DF3A 3HMXA 4KTDH 3TIEA 1D3CA 1JPFA 2KLTA 2RD0A 4HW6A 3TOPA 5FYJL 3ZUNC 4HDIA 3V5HB 1KEML 2WLLB 1MWOA 5F88B 1XEDA 2KZKA 1UWEH 2KH2B 4G43A 3KH4A 3R1GH 4HS6A 3RUGA 2DLTA 1AANA 4PB0H 3G6JE 4M7LH 5E7BA 3RA7H 1Z9PA 4AEHL 2MQ0A 2CNZA 1PCSA 3CC5A 1PGRB 3ABGA 4WNQB 3CFBA 1IFHH 2BP8B 2H3XC 1A7PH 4XN7A 4U33A 3MNZA 5HHOE 5FO7B 2ADFH 2KPNA 4DN4L 2Z8VC 3PWNA 3CH8A 4YHOH 3JWOH 4LEOB 1GL4B 1I9EA 3MRLB 3PV7A 3F7LA 1KT2A 2IVFC 5MERA 2ZSVA 4CKQA 3T8VA 3ZRSA 1M2OA 4D7PA 4K5LA 3FB8B 4A2DA 3RJQB 5BXFB 3AS0A 3DI3B 3TH2T 4RX4D 2EIBA 4NQXB 4PRID 3ULSB 5AVYB 3BAXA 1R5VA 4WKXA 3UG3A 4GLRI 1N19A 1U8NB 4PQXA 3U36A 1HXYA 3IGAB 3UYRH 1GZHA 1KTLB 1AXSB 3GIVB 3OR7B 3QRLA 4OZHE 3DSNA 4L1HA 2XJKA 1EJ8A 2BRRH 3CCHB 3N0PB 5T33L 4L29A 2F8IA 4HT1L 3RL1B 2VJXA 1HL8A 1ITBB 4GUPA 2YRPA 5EU6D 4ZI8A 5BOJA 1FBIH 4GG6B 5BVPH 4ZOAA 4XCNB 3X13B 4UT9A 3KGSA 1USZA 4B95C 1ZWIA 1U0QA 2HVJA 2MCAA 3BPOC 2CM5A 3VSTA 1QNZH 3IDNA 4W68A 1G43A 4PRDB 2Q2EB 3J27A 2OTWB 3DV6B 1H19A 4NSKB 4KRPC 5C0RL 3FQRA 1M56B 3WELA 2CLRB 1CXEA 4L8DB 1M2VA 2ZF8A 1TENA 1GC1H 5JYMA 3T1FB 1YEIL 1W6LA 2TRYA 4IU2A 3MTXA 4MXWL 4JDTL 3B9AA 2XXFA 3DETD 4IMLA 3TX4A 1DQVA 1UJ3B 4YHLL 5HYSB 4XGZA 2IOIA 4AGQA 2DLHA 2F61A 5C0CE 1GGCL 1EHKB 4FYTA 3LNDA 1XH0A 4NQUA 1CVSC 4IOFC 4JMXA 3ZE0F 3UP6A 3MRRA 3OWEA 1KTCA 2PYED 2Y7QB 4M6NH 4ZT1A 5GGRA 3DSNB 3DXAA 4JHAL 5CN1A 1V3KA 4U6HB 5KVDL 2H45A 5MEQA 2CXGA 1YC8A 4OIBA 1HXYB 3IGAA 5IROC 2V3DA 4F15B 4G7SB 2KHAA 4HZAA 2X4RB 2WLIA 1YNTB 4XC1H 4HUCA 4H1LH 3VFVA 1LP9B 1ERNA 1AGCB 4XP5H 2A0LC 2ZP8A 3L4UA 1XCXA 4J27A 5HHVL 5FYLL 1JXFA 1AJ7L 3KH3A 1T5WA 4U0RB 3UBGA 1RSYA 3AB0C 3MXVL 5ITFB 3EZ8A 1MREH 1X4YA 2OA9A 1X5GA 2ZTBA 4MRBA 4A2FA 4JLRA 2BP5M 1NINA 1R3IL 3FFDA 4NIKB 4Z7WB 1SF5A 4YO0B 4E41D 3ULVF 5LAPA 4DW2L 2QPUA 2I7OA 3HI6L 2Y3AA 2A6DB 2HT2C 4I9WE 5E2UL 4HZLA 3TFKC 3TH3T 1F18A 3OR6B 2YQ2A 4LCWD 5HHNA 3HKFA 3M1BB 1U8JB 3WXVH 1ZHLA 5EZOH 3NDYE 3C5ZB 4EBQL 3C2AH 1HHGA 2LU5A 3W2DL 2NNAA 4GEJA 3QDMA 2FBOJ 4GSRA 5GSVB 5ABZA 1AGFA 2PCPA 5EBMB 3WTSA 3E9TA 4TNEA 4PP2B 2V5MA 3MRRB 4QJ3B 3QPXH 3DETC 4TUUA 4XH2A 4A37A 8PAZA 3KHQA 2AV7A 4JUTA 1PKOA 5I30L 1WSST 3SDXB 4MQSB 1I8UA 1JZIA 1BF8A 1OAKL 2V9TA 2J8UA 2NTSP 4PJ8C 2PXYA 5DD5H 1L3WA 3F7KA 4UQDA 1G6RL 5T3XE 4ZTPL 3UJTH 3LAFA 1HT6A 1MCWM 4UIMB 5HGAA 4ZFGH 4KAQH 1JF5A 1CGTA 3MBED 4FXKC 2OR8A 4IRSC 1BCIA 4S1RL 2VLLB 4TRPH 1HEHC 1ML0A 4W9CC 1I9RH 4MMYB 4CILA 4P5TC 5IB2B 1RUKL 1Y18B 4IBSA 1FJ1B 3NIDF 4JGUA 3V4VB 3VXRA 4QRPB 3WMPA 3CHPA 4PTTB 4TLUA 4DZBB 4U1SB 5KANG 2IMMA 3DROA 4HJ0C 1VESA 4N8UA 1XGYH 3VJ6B 4IU3B 1LL1A 1ZCRA 4PJAE 5KANI 5IBLD 1UEYA 3KG5A 3QJTB 1PBYA 4MCZB 4NUMA 3GHBL 4UTBH 3D4YA 4N8CH 3IDGA 3QQ3A 1FV1B 1NUNB 4X42A 1MAJA 3C5XA 3EOAB 2GEEA 4JFDB 4AIZA 3RWCB 3ATFA 3ZSTA 1J8SA 3FUHA 5C08B 5TQ0L 3WAKA 2CH8A 2GUYA 2EO1A 1N6QL 5FUZH 1FSKB 1G7HB 3LMJH 1FYHB 3LB6C 2I60H 3VFOA 4TM9A 1DVZA 2E86A 4J6RH 3BLBA 1JWMA 4N0RA 2AI0H 4FABL 3VI3A 4P2YA 4WDIB 4ZMOA 1K8DB 1QRNA 5FM8A 4GBXC 4K5MA 3GLZA 1JS4A 3QEHA 3H56A 4AGOA 3FCTA 4J3VA 4L1DA 4E9LA 1JDAA 3AQYA 1EO7A 1CB4A 1U3HC 5A2AA 5AAWA 1HZLA 3MREB 2W07B 2K6YA 3ZKMD 1EJOH 3GC3A 3H4HA 4M7LL 1W80A 3V4VA 4JO3L 3ZTNL 4PJBE 3FQXA 4OV5A 4G7VL 4MMYA 1KENH 5FKPA 4Y19A 5DJ8A 2G3NA 2FE0A 2HN7B 1QFPA 3L5WB 4KJWD 1S46A 1A6TB 4LPCA 3QORB 4XP4H 4HU2A 3T9WA 3T1WA 4HV8B 2PABA 1IKFH 4H8WL 4L05A 2ED8A 5CZXD 1C16A 2BOBA 5EDSA 3HB3B 1R3JA 3ARBA 3MRMB 3NTCL 5KEZA 3AAZB 2AEPL 4FYQA 4J3TA 4JY6A 1X5YA 3IDGB 5AZ2H 4LSRL 4NJAH 3E2HB 4MVBD 1CDHA 4CU8A 2DH2A 2CLRA 2PO6B 4HIJB 4P9HL 4X6BB 4L4VA 3MA9H 4ELMF 4G11A 3WJLA 2ATKB 4LCCC 3KLHC 1NAMA 2MTAA 2P28B 1EXHA 3Q5TA 4NUJA 3K4ZA 2HT4C 2ZCHL 2H9GB 5EEZA 4MLSA 5IBTL 5EF1A 2JH2A 1J8KA 5E8EB 1K5NB 1MI5E 4KV5E 3N85L 2NXZC 3D07A 3PL6B 1I8IB 4JFOA 5C8JB 3LIZL 3HG1D 1ZPUA 2FK9A 5I8CA 4P8QA 2Y5EA 1D9KC 1OALA 5ESAA 3MV7B 3RNKB 2HH0H 4FQ1L 4MA1B 2X28A 4HUUA 5T5FA 1GYCA 3QXUA 2QZQA 5IB3B 1Z3GL 1T2QH 4BKTC 4G8GA 2BNQA 3QEUB 5HHOA 4QTIL 5KS9E 1LO5A 1REIA 3F58L 4H8UA 3S9DB 2ESVE 2YPLB 2YXFA 3K71A 3D3VE 1OWWA 2AXGB 1MJJB 5C07D 1UACL 4Y4FD 1DE4B 3KPOB 1QABA 2WP3O 1FORH 5BNXD 4YPGA 1INEH 5C09E 5E0FA 4FZ8L 4K8RH 5E9AA 5AW0B 5IW6A 2NY7H 1U36A 1BXXA 2E46A 3H9SB 4PEEA 5KVGH 5HYFA 2BCMA 3LQAH 2GJ6E 5D1QB 3LZRA 5KN5B 3N41F 5IT2H 2BW5A 4PJ9B 3SGKC 4FLQA 4J8RA 4QRPE 3S3DB 4WWPA 5FF6A 3LZFH 4HZLB 4I1NB 2RGSA 4XNMA 2VNCA 1KYOK 1YEJH 5I16B 5BZZA 5H8DA 4WJKB 2P5ED 2HFEB 3GSNB 4JVPA 3HZMA 4PJ7B 4J2QA 5AYUL 4XMKH 3PQYB 4YHYC 2HTKC 5F7MC 3U1QA 2DPKA 1KBWA 3BVWA 1N18A 5H37H 4OV6F 3Q1SL 3H7BA 4KK9D 3SPVB 12E8H 4NNYB 2CK0H 4Z3EA 1O6SB 3A6CH 2WQSA 4M7LT 2XG4B 1NMCB 2BMKB 3BVTA 3WJMA 3GGWA 1BAFH 4FXGB 1B4JH 1DO5A 2UZXA 3QR2A 3B8YA 4JY6B 4EI0A 5F7DB 1H6UA 2A77H 3ZDYE 3GNML 1DSYA 1I1AA 4XNZB 3Q8EA 4QO1A 1ZT7A 3LS4L 1O7DC 3VGDA 3D87B 3RZWA 1JZ6A 3NAAH 4XP6H 1B4RA 2RB8A 1N8ZA 5BQDA 1GXEA 1IVLA 3RZCD 4MZ2A 3Q2VA 4L23A 2YPVH 1S3KL 2ROYA 4NCC1 3FK3A 5D1QA 2IWGA 5HPMA 5INDB 1W16A 1AHMA 3O8XC 2JIXA 4BCYA 2GCYA 4FFWD 1NUDA 3B1TA 3MV9D 4QI3A 2BWQA 4X7TB 3VB8A 3VRIB 3P0GB 3UC0H 4XNUH 5EPMB 1I8AA 3B5GA 3DA0A 5EHFA 2Y23A 2N1KA 1RCYA 3CNKA 4P3CL 5F72S 5FKPB 5CD5D 3HCVB 2V2TB 3KMDA 4O02L 4YEEA 1AKJB 1ID5I 3C8HA 5D71H 2Q7YB 2CO4A 2RQEA 2IAMD 4DKTA 5GGVH 4GSDH 3P30L 1UEMA 5HYIA 3WD5H 2C3VB 2E76C 2VSCA 2VDNB 2Q3XA 1GGTA 3FQTA 3L3GB 4I3RH 3DMMD 4HUVA 3HZYA 3L4XA 2IMNA 2XIDA 3CFUA 4C4KT 1UZGA 2JKLA 5CCGE 4CADA 4DP8X 4KVPA 4QAWA 3QI9B 4QHKI 2TSBA 3JUYA 5DJDA 5SX5H 4FTVD 5E0QA 3HAEH 1X9QA 5T5NG 1OGTA 1U21A 4IGBD 1OOAA 1BFOA 4L48A 3F64A 1TUPA 2D2CC 2AVGA 2WCPA 4XO9A 4Y8AA 3WDIA 1D5BB 3VFMB 4NRZA 1J10A 1S3KH 1NAML 1EA9C 4MKTA 5EA0L 3B9EA 3VTAA 3IGLA 3F00A 4BV1A 3M8OL 5BXFA 5CD3A 4JEGB 3CUPB 3VXUD 2IH3B 4PJHA 3QCVH 4Y2OB 5EOCH 1ZEAH 1J9TA 3D4CA 4P2QB 4H8QA 3MRLA 4PJHF 4LVHC 4A7VA 3S2AA 5DHVB 1T83C 2FBJH 4PJCF 2B9AA 5C9KA 4OFYD 4DSYA 3FT0A 3WO4C 2OCJA 2CBTA 4PJXF 4PWJA 3SY0A 1KEMH 5KTEL 1LVEA 1JOIA 1MCCA 5L9DH 4ZODA 4N2AA 2BSEA 2H1XA 2B14A 4KVCH 1NFDA 3RWIB 4GUOA 1BHGA 2YRLA 4M3HA 5T3XH 3U4EA 1SHSA 1NBYA 2ZP0T 4Y2DB 1RUAL 1KV7A 5HJDA 3WV0A 1WIPA 2CCWA 2FJHA 2YMXL 3SKUD 5CIPA 1IQWH 1P7KA 4ORGB 3EJQA 2EUWA 4QUOA 3MOAH 4ZFOA 5AVUB 2O5YH 1XO8A 1J48A 1Q38A 2NUTA 2Q8BL 3PE9A 4LCVA 2E7CA 4LQFH 2XETA 1YDPB 3LKPB 3QIBC 3WSQH 4L8SB 1E4WL 4RVBA 2FR4B 2B1OA 2ITCA 3FXIC 4NKDA 3KLAB 2Y36L 1HEZB 2DQDL 3Q6GL 1OM3H 5D7LB 3C08L 1L9PA 3LH9A 2Z31C 3MRQB 1MCIA 3CZKA 3FMGL 2H41A 3DSFH 3QR0A 1MUJA 5F3HB 1UWGH 3WJLC 3MUZ1 4WGWB 5C3LD 2NR6C 3L45A 3CDCA 4X6DA 5DXWA 5EU6A 4BCXA 4XB8A 4OIIH 1UASA 4JK0D 1KEGL 1IZKA 1G7MB 3OZLA 2Z34A 5GSRA 3RWJA 4ODWB 5AAMC 5DYFA 3GWJA 2PLTA 1AGBB 3ETTA 3MPCA 1IGCH 1NGZA 1KJVA 3QUKA 2X1OA 2YUXA 4U1KA 4JDVB 2EEBA 2FJHB 4K3DH 1CD8A 2R29H 5DRZA 3T0EC 5DA4A 4DK6A 2FLMA 2VDRH 15C8L 3DRTA 1SN2A 3BIBX 3QEGL 4XNXH 1G9ML 2ZNWA 2H2PC 4ZFOB 2EYSB 2BO0A 2PXYD 5CN3A 4GAYA 1TTAA 2IBGA 3PWPD 3O6FD 3DBXA 4PLJD 3KHOA 1NAKL 3CZFB 1A3LL 2ZOUA 4R4FH 1MFEH 4ZPVA 1A6AB 1JN6B 3L2NA 3CPLB 4YX2H 5KSAA 2D8KA 4NFCA 2C9QA 4FRWA 5I1GL 1TQCB 2QVMA 4P2OA 1H5BC 3BSGA 2IH1A 1A64A 4KKAD 3BRGC 2F7IA 2R7EB 3E1ZA 2ZXQA 3PREA 4P48A 1MH5A 5FDWB 2ZUTA 1HHIA 3QGVA 1OXYA 4Q6IB 2YRBA 3FTVA 4XAWH 3TZVC 3D9AL 4EXKA 1HYSC 2O6EA 3WUWA 1RK0A 2CGRL 5GRYA 2VLKB 1OSZA 3CV5A 3PHQA 3UJIL 1AQ8A 5F1NA 3I2CH 3NFSL 1ZE3C 1T4KA 3P30H 1X5IA 2YHGA 4GXFA 3QEGH 4NDMA 3RL1A 1S7TB 2ZX9A 4K55A 2V7NB 4TRPL 2XWXA 3D3VA 1F58L 1HQRB 4HKZB 4I5BB 2Z31D 4FNLH 4MXQD 3BP4B 3WHXB 4ODXB 4Q9RH 1G7LA 4RISL 3CVBA 3T0XA 4BDVA 4GRWF 4X8JB 3FSOA 3CMOH 4AVJA 2IDQA 2YD0A 1R17A 3IETB 5C1MB 3B6SA 3L1OL 2ZUUA 1CLVA 4OLWL 4H8WC 4H1LA 3UBXI 2A5UA 3US1A 2BRQA 1Y6KR 3QDMD 3QIWA 1F8TH 1MIMH 1RP9A 4TVPL 4CL7A 1NLDH 3OR6A 2YGNA 4N8CL 4O2EB 3RWEA 3QI9A 4ACPA 3VXMD 5HYJE 2YD7A 3PHAA 3UGXA 1EVTC 5AKRA 1IT9H 4U3CA 2K9UA 4R4BA 4P9HC 5E51A 5FDYA 5C07A 1NIBA 2CGRH 3UJIH 2H32B 3AC0A 1FLRL 5FM5O 3PABA 1YPZA 3LKRB 3TURA 4XX1E 2HRGA 43CAB 1B4JL 1KN2L 5SWZD 4AG4H 1FC1A 5BZXA 2MH4A 3LQAL 1LEKB 2WUBH 4J3OG 5C08E 2JB6A 5AVSB 5ILTL 5LGKA 4MS8D 3QJRB 1JPFB 4PVBA 2A6JB 4Z7VE 3EHBC 5ERWA 5F89B 3IGFA 3MLRH 2L3BA 1F4WH 4N0YL 2YN3A 3DJ9A 3DGGB 5J7CC 1PPIA 1FGNL 2CZNA 2BOLA 2E59A 4GAGL 2FH6A 2DQHL 5ADOH 2LV4A 4ZAKB 3GJFA 1IC7L 2B39A 3FS9A 4GRWB 3DVGB 3NPZB 4XVJH 2VH5H 4P5TA 4LCIL 4XBGB 3F58H 1FFRA 35C8L 1OP4A 3V4PB 3HR5B 2ED9A 1I7ZB 4QHPA 4NC1C 1KY7A 3QQ9C 1CQKA 3QO0B 2OX5B 3EJZD 4XCYB 3C5SB 4HJEA 2VR9A 1TR7A 1UH2A 5E2TL 3P2BA 3TVMD 2JKIS 4RWYH 4EQ3A 3MDJA 3VWKD 2ZIDA 4JHWL 4MCYB 2JJSA 5C07B 3O4OB 3FFCA 1XMEB 3QZOA 4P5MB 3EYUL 4HOXA 1GYWA 1T83A 2HXAA 4UQ2A 1V7NL 5E9DB 5LVEA 4JFPA 2X7LA 2OQJB 4Z7QE 3BP4A 4NM4L 4WDIA 1R3LA 5IM7A 3ECBA 3QC6X 2XYBA 4WAFA 5A2LH 3HI1B 4FAAB 2XTSA 4K7PY 3S96A 4N2NA 5SWSD 3GJEB 1TCMA 4TQIA 1BLNB 1ES0A 5TH2B 3FSZA 1QVOA 1YN6A 2PWGA 4JFUA 4TNGA 5FLUA 4RBPH 2OMXA 3HPLB 1PY0A 4YK4C 1T80A 1AIZA 4KV5F 3LV3A 3UMNA 4BELD 5CF3A 1A1OB 3MOAL 3BYYA 5ALBL 5L0QC 2FO4A 4X5WB 1NC4D 3LZPA 3VJ6A 3JTSA 4OUUB 2APVA 2O4EA 3D2UA 1F1AA 4YHIA 3PWPE 1PAMA 4HK3J 5ESAB 1C7TA 3QC5X 2VDRB 4ONFL 3ULUD 4F92B 1BWWA 5B38B 2J6EA 1LEIA 4WUUD 2VQTA 5FGCB 2BHUA 2EP6A 1I75A 1IGFH 2EE0A 1AP2B 2ADIA 5BVPL 4EUPB 2LU4A 2OMZB 5F89A 4EN3C 3DUHA 4FJZA 3P40A 4NJ9L 4WFHD 3SE4C 2WNKA 5LGHL 3K6SA 4FXTA 1T22B 3IE4A 3VVVA 3FNKA 1CLYL 3OF6A 1NIDA 2XN9E 4FXGA 3UYOD 2JJWA 3HS0C 3OQ3B 4LDCA 1IBBA 1NOAA 5F8QC 3TBTB 4OJFH 3W9DA 5IHHA 4UM9D 2B08A 1XIWC 5EZJB 2ZWNA 3B3IB 1NBVH 1BPVA 3VI3F 3DJZA 4TSBL 4RMBA 4RAHA 4NEHB 1BYOA 4U1JA 3CU7A 3NCXA 5EZLA 2GBTA 4JFHD 2WO4A 3SE9H 3RUGE 3DOSA 4KTDL 4OZIB 2DIAA 4IYKA 3SDDB 3HC0B 2GSGA 2HJKA 5HDBB 3VMPA 1FPTL 4AENB 1RIVH 1WBYB 2H4EA 4NN6B 4UQAA 3H42L 5D8JL 3V9CA 1YEKL 2D7TL 5ADPL 1OARL 1P5UB 1R0AL 5CILH 1G9NL 3WI9A 1S9KC 1Y7VA 5D9SB 4PCKA 4Z76A 5ICYB 1BVKB 5CJQH 4GQQA 2VDPB 1AXIB 3KPPA 3KR3L 1DVUA 1WFMA 1WQVT 2DQ6A 2XZQL 1DSWA 1MFCH 2FDBP 4R7VA 4GRLA 2DLIA 1FH5L 4U2ZA 5CS7A 1PNCA 2BOCB 2NLJB 4U0RC 4JFXB 3L9RB 4UV7H 1Z5LA 4Z0XA 1PZ3A 1AH1A 1ZGLA 2VISA 3TBTA 4MAYD 3A22A 3B7SA 3VRIA 3W56A 3DBSA 2HVKB 2G9HB 1XD1A 2EH8H 5J89A 5DD5L 3F5WA 2HYMA 4ELMA 4WEBL 3HC3H 4B9KC 5IJVB 1NBZB 1CTOA 5I8KL 5AZEL 4U1NA 1S9VB 4EKJA 3VFPB 2VM3A 3PNWB 4OIIL 4A38A 4PRAA 4K9JA 5JOPE 3QDJA 1ZDSA 3PV6A 3IDXL 3UDWA 5A3ID 5CIPH 3MUY1 3SBWA 5DMIL 3DROB 1IM3D 1RUML 4NQQA 1YAIA 4Z3GA 4JPWH 2XWDA 3ROOB 2VDMH 1T0MB 3DURB 3SDYH 2JXMB 1IJ9A 3IFLH 3F2LA 1WA0X 4EN3D 3KLKA 2RCSH 3GXIA 2V7HA 2PPDA 4BJLA 2G5RA 1G7PB 5BZDA 5JNYB 3EFFB 4Z7UB 2KUTA 5DQDH 5MENB 3ZE2B 1F3DH 2PCXA 4KZDH 1XVSA 1LM8V 2G2RA 5BO1H 1LE5A 1MCOH 4DGIL 1CBVH 3BPNB 3P4NB 1BD2A 4P57B 1A5FL 3IRCA 5I6XC 4YDVB 4QXGL 1OCZB 1Z9MA 4K7PX 1KIPA 2W65B 4Z0XB 1XF5A 4ISVB 3DKHA 4G1EB 4Y4KA 5E6IB 3UZEC 2CDGA 4KHXL 1NCAH 4XX5A 3D51A 2XN2A 3BZFB 2NY4D 3CBKB 3H9SE 1O6VA 1T1ZB 2NXZD 4G5AA 3EO1B 5I23A 2ZXBA 2YD6A 3EYQD 3H2PA 1TLKA 3RU8L 5TDNB 5GGSY 1F8TL 3D50A 5DEFB 2DEWX 2W60A 4WGKA 4YAQA 4JHZA 1GZPB 4YGVB 3EYFA 5DJDB 5B7MA 2OULB 2NX5A 3ARZA 1UKTA 3TO4B 4OFIA 3KYNA 4IRSD 4BM7A 4JM2A 4WWKC 1OAZH 5DVOA 2VDOH 2P9RA 4H20H 1F58H 3NFNB 4IKLA 5ESQB 2QKSA 1KCRL 5DJCB 5E08H 4S2SA 3NZHH 3RY6A 2Z4QA 5EOQL 2DLFL 4NIYE 3NP4A 4MJ6A 3ZZLA 1GJIA 2GB2A 3TO2A 3G5WA 1HE8A 2W88A 2Z64C 3OGCB 1TIUA 5F93C 3IJ8A 1JV2A 4AYDC 4X8XA 4V1DD 4L1LA 2V17L 5JDSA 4P57A 5JW4M 4YHZH 3QJVB 1DBML 3TYFA 5JLZA 1PX8A 3V6OA 3ZJAA 2Y22A 1QPPA 4G8GE 5KS9A 1IAIH 1AC0A 3CXFA 2HKHL 4UMSA 4A7QA 2R4SL 4PHZA 2ARJQ 2ATAA 2Z93A 4WI5A 3DHUA 5IF0B 2IF7A 1FLTX 4FQXD 5C9JA 5BS0B 4UT9H 3W57A 1B3IA 2WTPA 3NCJH 4NZTH 2RFXA 4DQAA 3IFNL 5CBAB 5EB9A 1A6UL 3BSZL 3NTCH 3GMLA 3QORA 4OCSL 3K5SA 3FU3A 2XN9D 1DZBA 2MKWA 4GW1A 1MVYA 2V5RA 3X12A 4K9EC 4ZAKC 1BZ9A 1NGPH 4WW2F 4I77L 2DQUH 3F5WB 5D1XC 1EJFA 5KSUB 2WQRA 1AIFB 3KJ4C 3FQ1A 2X12A 4LIQL 4APQB 1PIGA 1JV2B 1M1XB 5BJTB 3ZSSA 2FYYA 2FX7H 1MELA 3VWJB 1JK8A 2P47B 1WP6A 4ETQB 4FFWC 4WK0B 2F5AL 4K3GA 5E94A 3QUML 4W4NA 4B9GA 4XO8A 3TTSA 1D5MA 4BQBA 4AV5A 4JM2C 4F5CA 1NC4B 2OYMA 4H5SA 5EDXA 3ARDC 4Q89A 2YKLL 3RWCA 4MBOA 4R7LA 1S7QB 4K3DL 2W0FB 1RZ7H 4OCXH 4OIFA 5TTRA 4P06A 3W3BA 4M6AA 2IALA 1VGEH 1NGZB 1P4BH 1SM3H 2N1TE 2GK0B 3C9NB 2R1XB 3MRPA 4GRLB 5IJBC 2CRMA 3FCSA 2UX7A 1SLWA 2E9GA 4FCAA 4WI4A 4F37F 3K71B 5J4MA 2K78A 1GCFA 5HP5A 4YSCA 1P1VA 4DPAX 4E41E 5AWNL 5FFOA 3L1FA 5IEHA 4ERSL 2ZAIA 4O9HH 2D31B 2DYRB 1GS8A 3TIEB 1PZBA 1HESA 2EADA 4F7TA 4ERSH 4ODXA 4UTCA 3BAWA 4Y19E 2CDGB 1S5HA 3F65A 1FGNH 4WI7A 4QF1A 1X5MA 1N8ZB 5E9DD 3PDGA 4MJID 4TSCH 1TSHA 1JGUL 2L4OA 2ZF9A 4JFQA 5CGMA 5B39G 3ZU8A 4OLUH 2FR4A 4R3SA 4V1DE 4KHTH 3WJJC 2X4QA 2WVUA 1OPOA 2AP2A 2GQHA 4ODHL 1YEFH 4P2RA 2DJUA 2LFGA 1XCQB 4HV8A 2ZAHA 2VDOB 2NZ1A 3OHXA 2FBJL 1JVKA 5ICZA 1CGXA 4O4YL 4XPAH 4DKFH 3G04B 4KU1A 4NQCE 1JNHA 2Q6WB 1OGAB 5BUPA 4OM1L 1WIOA 4KWUA 2QVIA 5TPWL 4BZ2H 5C0GB 1MJUH 4IRJC 5TQ2H 2C3HA 4AJYV 3M45A 1LWJA 3Q6FA 4ZAKD 1IU1A 1D9KA 3VFGH 4W70A 5IROD 3PIQB 3W1ZA 1CL7L 3MAWA 4LNVA 5HGBB 2WBJD 3U30C 2N4IA 3FCSB 3L48A 5D96C 5HHNB 4PJCA 1E42A 4HEME 1HOCB 2BVPB 2G5UA 3KXFA 4GKNB 3IXTB 5I8EB 4FYRA 3DTXB 4PRNB 3S2CA 4ZO6A 2OCFD 4TVPH 3T3MB 3BN9D 2IANB 2QBWA 5GQBA 4PTUB 5B3SB 3B6SB 5D93C 2Z8SA 1CLOL 1KTJA 3HUJA 4GAAA 1OF0A 4FXKB 2EE6A 4TKWA 4ENZA 2HLEB 1DVTA 2VW4A 1A7RH 1O7SA 4UT6L 5CSZB 3SE6A 2VIRA 2W60B 3VFVB 1A2YA 5D1XA 1SYVA 2WWMC 3ZDXE 4GSDL 3RE0A 4P9HH 1IAIM 3VM7A 4QKTA 3SDAA 1UCBH 1I85A 4X80L 1UXWB 4BKLA 4OBRA 4OD1L 3ALPA 2L7EA 2HKFH 3HMWL 1G9NH 4HWBL 3UG5A 1B0WA 3JWDL 3U6RB 1KJ2L 3MGOA 3PP4H 4KNSA 5JXEA 1I7RB 4B3VA 2YZ8A 4LL4A 5J6GB 1UOKA 4G80A 3BVVA 4G8EA 4TLSA 2E7LC 3Q2CA 1TQBB 5DT1L 4OGYL 1F1GA 1T7XA 4UQ2B 2AEQL 2P8LA 4M5ZL 4MYPA 4APQA 4N2GA 1LEGA 2VZ1A 2NY1B 1MSPA 4LLYA 1KNOB 4DN3L 2D4DA 2ZKYA 2VDKL 1F1DA 4CUCA 4NN7C 5FA3B 4X6DF 4ONHB 1B6DA 2DMHA 1KPUB 3KCPB 2A38A 5E9DE 4JM0A 5F6HJ 3CDYA 1W2KT 4QYOB 3TBYB 2G30A 3VD1A 4XBGA 5D7HA 4IMKA 3ARDD 4U6YB 2A3TA 3CHSA 5IHBA 2HTLC 3M6DA 4A6YL 3EOBB 4JO5A 1BFOB 4OD1H 2JB5H 3HI1A 1N2RA 2XG5B 3ARBC 5D7KD 3EDJA 3X3FH 2WWNA 2RJMA 4LIQH 3JWDH 2BHFA 4WKZB 1RP8A 4MHHG 2MQCA 4K5NA 3TPUA 3B8SA 4WNSA 2XV6B 5LXVA 4W9FC 2XV0A 2F19H 3MROB 2H6PB 1JUFA 3DO3A 3UZEA 3HB3C 3FFCB 1Y1UA 3RKPA 3O41B 3ZHNA 5JW4Q 3QAQA 2XSKA 1UYWL 1UXMA 3V6OC 5C6PB 1HZHH 5FUCC 4AQ8C 3N1PC 4L0YA 1N0XL 4Y7MA 2B3IA 1NZRA 4MAYB 5DJAA 1KPRB 1ECZA 5FHBL 3RGVA 1TVHB 3FUNA 3P11L 5FKAB 1G1OA 2CG9X 5IMLA 2IV9A 1CDJA 1AHKA 1RHFA 3FT4B 4C56D 3MRJB 3NPSC 2IWKA 4L8BB 1QQDA 1I9IL 1OF2B 2VB5A 1TTUA 5DUBA 3MJ6A 4GLRH 3VMNA 1UVQA 4EXPX 5LXGL 3U4BH 2HLAA 2X09A 2AMGA 3MXWH 3QUHA 1G7QB 3MLVH 1KIQA 3X3GH 5GZOC 2M83A 4NUGL 2YPKB 2E9JA 3T4YB 2WD0A 3QXWA 4YDLB 2K7PA 3D2TA 1XIWB 1FYTB 4OZIA 1R33A 4TQEH 4UV4H 1QD0A 1GSKA 2R2BB 5GRXG 3JWOC 4OFQA 2QZ5A 1J88A 3WS6C 1BX2A 1I4FB 2OMTA 5AW9B 3FQYA 5CM1A 3TPUB 2CA3A 2X9ZA 3CFJA 3QK0A 5DUPL 3B2DC 2XXMB 4JG1L 1LO2L 3SE8H 4RFNC 3PABB 1EUUA 4N2OA 5BV7L 2YR3A 1EFXA 2N0MA 2OMZA 4FNUA 2EXWD 5DJ6B 3TBWA 3U6XS 1BW8A 1KLUB 4G83A 5CN2A 4PREA 3I6KA 4F9PC 1A25A 1NDGB 1U3ZA 1ACCA 4IBTA 1A22B 2KPWA 4MNHA 1G6RA 1KACB 3TPKA 4OCWH 1ZTXL 4NKIL 2OP4L 1QP1A 3QB7C 3SJVA 1MF2H 2ZG2A 3VE0A 2IH8A 4JHAH 5KVDH 2QPFA 1MVUB 1RUAH 1G7IB 1WIUA 2X4SA 5IJVA 2Y06H 4LLAA 5I73C 3VDBA 4G7VH 3IMBA 1CXLA 1WE5A 2VLJA 3GPEA 1EANA 3DHPA 3X2QB 2YN5A 4KRLB 2R8SL 1Q1JL 5MEPB 3AWGA 2CGZA 4I0KA 3AWFA 3ARYA 4XBPA 3NG5A 3O2VH 5HHMB 2F7QA 1KB9K 2EC9U 2Y07H 3CC1A 2VAAA 3T2LA 5BW7A 1S7TA 2CMRH 1B0GA 1LQBC 4Y16D 3TGXA 3F62A 1I8LC 4ELMB 2R0WH 4Q0XL 1JV5A 1HIMH 3OWRA 4J8QA 2EDBA 4NB7A 4WI3A 1CTMA 5C08A 3TO4D 5HHOB 3WUWB 1QI5A 4WLCA 4YR6B 2XZAL 3JXAA 4MSWA 3V7AG 4N2HA 2DRUA 3H85A 2FECL 3QULA 4IOIA 3ESUF 2NDGA 1B6UA 1PEZA 3OHXC 1NFIB 3D69B 3TBCA 5H35A 5K39A 4XVUC 3ARVA 3UTSE 4LCUA 3I6GB 4PLNC 3WFBL 1CU4H 1O7VA 3FHEA 1UUNA 1S7RA 4PBDA 1KB9J 5BRZA 1F90H 3OKOB 4LEOA 2BZCA 5GHWL 2BY0A 2OL3H 3NIFF 3WLWC 2AJSL 2EDNA 2WWKT 4BDVB 2OCCB 5E6ID 1F41A 2YQBA 3P9MB 3QI9D 4HYTB 5HTSA 3RB7A 2GKIA 3MV8D 5HDOA 4BFBD 2QQNL 5FYJE 2CLZA 1UZ8B 5D7SH 2QR0B 3LH8A 4I18B 1RUQL 2Q3AA 4LZKA 1JUFB 1WFTA 3DOSB 3HE7C 4HIXL 4MB4A 2VDOL 4H20L 2ARJB 4PJ5D 3GD1C 3DO7A 1KB5H 2NTFB 2CU9A 5AUMA 4XHJD 5EZIL 1PMYA 2SODB 3R8QA 2UXGA 4JCLA 4ZFGL 3QA3B 3O8XB 4Y1TA 3GSWA 3L81A 2XN9A 2X4TA 1MAMH 2I69A 1G7PA 4TLKA 2Z3FA 4K3EH 5FYKU 1KPUA 3KCPA 1BM3H 2BP0B 3BGFB 4XO4A 4K3EL 2VSKB 2YD2A 1F4AA 3TBSB 4ABWA 1LDSA 5BMFH 3VXTA 4YQXH 2WLNA 1NAMB 3LHAA 1HYRC 3QE5A 1LEKA 1I9JH 4G59C 1CE1H 3CPLA 3ZDZF 3LEVH 4U1IB 3TFBA 4DP6X 4FNSA 3HW7A 2YK1L 1NFIA 3DUSB 5JW5A 2WXGA 2EDHA 1HS6A 1MRCH 2WXIA 1DJSA 2WKLA 3EJJX 5F1OB 3L3HA 4KKLD 5AOLA 3T4AC 5C97A 3IJHA 1NBZA 2KYIA 2V0AA 2X6AA 2ETWA 1AXSA 4XVTL 4LHUA 4PBVC 1ES0B 2Z35B 1BZ8A 1TXKA 3JT2A 5DSCA 2NY3D 4FL4B 2ZOLB 1R5VB 5T1MA 4KY1H 4L1SA 2KDYA 2IC2A 5LGJA 4MNQE 1A7OH 3LJ3A 1QR4A 4ODSH 3IMVA 1IC1A 2W81C 4ZDHB 2OQJA 1SVBA 1U6AL 3LHPH 3QIBD 1M1XA 1A9EB 4H1LG 2GTQA 5E6ZA 5JMOC 3BPLC 1E2VA 3FUIA 3QDMB 4Y5YA 5GSVA 2CDEB 1SHXA 1MXGA 2WBJA 4HKXB 1UWXK 3RJOA 2AAAA 4OGAC 3LN5B 1G87A 4G6FD 3BP5B 3IEAA 3ZY7A 3D69A 1ZVSB 5I6LA 1MCQA 4LBEB 3EOYG 4WGVB 5I28A 3TIDB 4F27A 4IK6A 1IV8A 1XH2A 2O6FA 3HR5A 4AYEC 5I1CH 5HDBE 1CN4A 3ABLB 4NENB 3KJ6H 3NJMA 3MBXH 3CH1B 3ARBD 1QRKA 4P2RD 1JZ7A 1XX9C 5JW5B 3RILA 2W0LA 2E6JA 1MY7A 2J72A 1C5CH 3MNVB 4HUNB 5LCVL 1TFHA 2X1PA 3QZWA 4ONGL 3NH7H 4NPYB 5GRWA 1Q9LA 5J5EA 1J8HA 2GJZA 5DEGA 3HAEG 1CG9B 1KBGL 3WXWL 4ZMQA 3WN5B 1ZTXH 4NKIH 2F7RA 2XWZA 4PJFA 5IMOA 1OVZA 2WBJC 2K3HA 4QXWA 5FV2A 3GMMA 1E6JL 3VO0A 1RIVL 4PY7A 3LSOA 4H0LC 5C7XL 5FFGA 1D7DA 1CF8H 3FU6A 3TT1L 1BIHA 5D7JD 3ZL2A 2NNXA 3MLWL 1ASQA 2PXYB 2XVKA 4KK8C 3OPZH 2WNXA 4ZD3H 4GQZA 2N01B 3HS0B 5CAYB 3ASWA 4S1DC 3MRCA 4NP4H 4LEXL 5D2LA 4WFGD 1DUYB 1L6XA 4HS3B 5I17B 3QUKB 2F8OA 5IB4B 3QEHB 2VXQL 2JELL 4G72B 3HCVA 2V2TA 4I18C 3ZW3A 3RFZB 2ADGA 3ABZA 4HOZA 1U8MA 3MRKA 1MHEA 4EVNA 3CPUA 4P9MH 4F8NA 5IVXB 1CUOA 4H5SB 3KVDD 5GISL 3UMTA 2A99A 3BZFA 3RPKA 1SHMA 3P9WB 4LPTA 1OANA 1MLCA 1RY7B 2HG0A 3N9GL 4J28A 1DVQA 3QJZA 4ZDHA 4KKRA 3Q13A 5T33H 2CR6A 5FCUL 1MCWW 4AL8C 4M00A 3NBNA 4M61B 1HEZA 3T0VA 4XXDA 4Z7UE 1E4XH 1SVZA 2Y1ZA 2HX9A 1DJXA 3MYJB 5GZOA 1NIFA 1LTXA 4C4UA 5IMMA 1QBLH 3B2UC 3T0ED 1TJXA 3EDKA 1CYGA 4KZEL 3RZCC 4DJMA 4NPJA 2XKSA 2YARA 2GBVA 1CURA 5DRWB 1CXIA 1K9TA 4IHOB 4NP4L 4OW6A 5BZDB 2J2ZA 2YXMA 4LVEA 3QIUC 3NJIA 4N0CC 3GSQB 4XMLH 1BMWA 4NO3A 3L6FA 4D0BA 4ACTA 3U2SA 5F7UA 1RZGB 4TF4A 4EDXB 2Z35A 3QUXB 1OSZB 3MLTA 3PHQB 3S0PA 3CK0H 1TZ8A 3O3DB 3N91A 3O9WA 3SOBH 1EGJL 3EW3B 2IGLA 2JKSA 5E4EB 5KBDA 1ZAGA 3OX8B 2J20A 4U3SB 2KZWA 3SOBL 3IJ7A 3ULUF 2F7PA 1UWGL 4XMVA 2KC0A 1EZLA 3EJRA 1PG7L 3LYRA 1FGVL 1KBPA 3A3YB 2X6CA 5F7WC 1IM3A 4FQHA 1L0QA 3QUYC 4GRMB 4N90E 4F8OA 3TFKD 5H37A 3IE9A 1CE6B 1C8QA 3FBQA 1T7VA 2Y1YA 4QRSA 5EU4A 1HU8A 4KKZA 5IFHL 1X5FA 3ZYZA 5DWUL 2DLEA 4XO3A 2OSWA 3D25B 4LT7A 4L4VE 3X17A 5D71L 2FSEA 4C83B 2GAZA 2R0ZL 4BUQA 2DI8A 3CZJA 4NZFA 3E0GA 1JMXA 4TTGA 5HHQA 2LE9A 1TQBC 1R3IH 2ENSA 2AS5M 3GXPA 3MREA 4F58H 2XTLA 4PRPB 1C08B 4YC2C 2F1BA 3INUL 4G80B 2NY0C 3I3DA 3R1GL 2BP8A 4G8EB 4D0DB 3QJOA 4IEFB 4HVBA 4MGXA 2DJSA 4OJAA 5D7LA 5BJTA 4LNRA 5SX4I 3B9KB 4JGNA 5KTEH 2IADA 2EIMB 5F88A 4Y5VC 3QNFA 1H9DA 3KYNB 4OSUH 4W4OC 1S6NA 4XC1L 5DD3H 4Z7OF 4RGNB 2MOVA 1G1KA 1CFTB 5LAXA 1KTDB 4KK9C 5DRNB 1OPGL 3BC9A 2IAMB 2WXPA 1YQVL 3E6HB 3V95A 2X5PA 4PGEA 3QDGA 4N8VA 3Q1SH 5HVWA 1WLHA 2PXYC 4X4YA 2V9RA 3A24A 2E9IA 3ZRFC 4JCWA 1WWAX 1LHZA 1J1PL 5CU5A 2K4WA 1WEJH 1JRHI 1NCAL 4IU2B 4XWOD 5I1KH 4LRIA 3ZOAA 4YHKH 3EAKA 1KDIA 1KWGA 1KC5L 1JHLH 3I75A 3E80A 3QG6A 4AM0Q 3QFGA 1XD0A 1ZLSH 1CD9B 2BSDA 4QRRE 3HNTL 2ILLA 3L1OH 3CQPA 1CI3M 3D18B 4P3DA 1GS7A 1RV6X 3ROLB 2PYEA 1S9YB 4F2MB 5ITBH 4F24A 4DGVL 2GJZB 2QELA 4LASL 5DEGB 3HG2A 1NWPA 3BCDA 4XBEL 4PP1C 5GGUB 1O0VA 1U8CA 3VNYA 2CHNA 4QHLA 1S78D 4XOBA 2UYLB 1DP0A 1TTBA 3GLEA 4HWNA 4Y9FA 3JWDC 3FYEB 1S9WB 4LOVA 1NKRA 4DPCX 3VRJB 1ULVA 3F8UB 2O5XL 4N0UB 4PJ5A 1DN2A 1E65A 1YUHA 1TJGH 2O5YL 4AYFA 5E8DL 4C4BA 3R06A 4D9QE 3ARFC 3Q9QA 2Q5BA 4J5VA 4Y16A 1RERA 2WO3B 4NNPL 4OCSH 1FZOA 2HT3C 5CKGA 4YLCA 2MRYA 2ENYA 2YPKA 3ES6B 4HJJL 4UI2A 4WI9A 5FF6B 3T4YA 4E2OA 4OIAA 4A7TA 4OLZH 3CMOL 5KSBA 1NGYA 3BVDB 5C0BE 1SMDA 1WTLA 2KI6A 3B43A 4LLUA 5HDLA 5L4IA 1VEOA 1YHPA 2X53A 3HUJF 2J43A 5BZWA 4EVNB 5DC9B 3I9PA 2X89A 3GXNA 4X7EC 1DVFA 1E6OH 1HKFA 4NHCH 3BVXA 1DQDH 1MVFA 4Y89A 1PCXA 1MCJA 4UUJA 4I3GA 1RULL 5DFVC 2ZXGA 4N0UE 3UCQA 1JXGA 3QUMH 4TUJB 1AG0A 4S0HA 3IGUA 3AW5A 4PJAA 3ESNA 2P48B 3VH8G 4KVNL 5B8CC 2ITFA 2NW3A 5HJBA 4AJVA 4FA8A 3RHWF 5F8RC 1RPUA 3VB9A 4PS4L 3FH5A 5I1AA 4PRHB 3ISRA 4RFEB 3C60C 2JCCE 2PP9A 3ZMNA 1MCRA 1WCQA 2PMZA 5HHME 4MD4B 1E28B 2DYPD 5ABAA 3WNOA 1EH9A 3BQUA 3EH4B 5L2JB 3ZBMA 1A3QA 2NT0A 1HDMB 4FQPA 4S1DD 3UAJD 3CFDB 1EZSA 1DYZA 1M6OB 1YNLL 4YSUA 2VLJB 3IGKA 3BFQG 3CG8A 1CQYA 5C0GA 1OTTC 5JIPA 5D7JC 3ZLQC 4XOCA 2GBUA 5D4HA 2B59A 3O3UN 4F7PA 1XR8B 2BFGA 1F02I 3G9AB 1HK6A 4MJIA 5K9JH 1AXTL 3L16A 2YEZB 2MIZA 5BQ7A 3TS8A 4U1LA 3DGGA 1DQDL 3UAJC 4K3HA 3J2PA 3OKMA 4MD5B 5EORL 4XCEB 1R3KA 5CU9A 2J4WL 4FJYA 4GKZA 4Y5VB 3H55A 3T4AB 5C09A 5ACLA 4XOAA 3MJWA 3RVWC 1IC5H 1EMTH 5CINH 4DP1X 1CLOH 3VG0H 3ILQD 1G6RH 2K8QA 2JELH 3JTBA 4DTGH 1HHJA 3W0WA 1HAWA 4PCTA 2X2IA 1XR9B 2P5PA 1MEXH 2GVYA 2IH1B 1ADQH 2FHFA 2BSSB 5CEZL 1JRHH 1M3JA 1XEUA 1ZIAA 1BX2B 3N40F 2A73B 2Z92A 5J11C 4HAFA 4HALA 4PSRA 1DQQB 3IF1B 3SGJA 4N9OB 3P3TA 2E4FA 1JNNH 3WNJA 4I87A 1AZRA 5KSBB 1XXDC 3PNWA 2C4FT 2Y7QA 4PJEF 3OZ9H 4KXZI 4QGTA 3FSAA 1CR9L 1E43A 1CGWA 2UX6A 2XTJE 1L9MA 3KXFD 5DZVA 2PWHA 4M8VA 4CDGC 4OGAD 1U91B 5AVZB 1AXTH 1XGTB 5LHDA 3BGMB 1GMEA 2WQAA 1FVCA 2X4NA 5F96L 4E0RB 2B16A 4HIPA 1YDPA 1MJ8L 4BK5A 4JFDE 3MLSH 1HH6B 2YO3A 2VH5L 3ZYJA 3IXTA 3FT4A 1A9EA 4YDNA 3TCTA 4R7DB 3F6JA 1L6PA 3LIUA 4GFTB 4KDWA 2XRAH 3H9ZA 2DQEL 3H9HA 2NYYC 5DK0A 4JRXA 1SXAA 4HX1B 3CFCL 4W1TA 5IQ7L 4G6JH 3QRBA 1T7WA 2YXVA 1D9KB 2BWIA 3GBEA 1U95B 3ARFB 4NZRH 4ZFOL 5F7YC 4AM0A 2VQ4A 3FT2A 2OL3A 3G5YB 2FSDA 5EC2B 4KKLC 4FI8A 4YVUA 1EZVX 3RTLA 3F7QA 3V6FA 3N6YA 1FG2A 4ZXBD 1Z66A 2BVPA 3WY1A 3REWA 2VR5A 4UQ3A 4G1EA 2X4TB 4PVLA 1VIWA 4QR7A 4XPBH 3LKNB 3RVXC 2HUHA 5I6MA 3D0AA 5B7FA 2DM2A 3B37A 2Y5TB 3LKPA 4Y1AD 3MJ9H 3MRMA 4RDBA 5JQHC 3QJXA 1T7YA 3DMMC 3TBSA 3SKNA 1TZAA 4XE0A 2ICEA 5H4ZA 3W39A 1WAAE 1QTSA 5EO0B 2I60L 1ROCA 2YEZA 4PIRF 5CGYC 4YXHL 2VUYA 3U9UA 1JVOA 1WWWX 3UADA 4TLTA 3H6AA 3MJGX 3CN0A 4RRPG 3VYNA 1IX2A 4KY1L 3W9EA 1ZT1A 2BHZA 3CH1A 1JYNA 5EMYA 1R3JB 32C2A 2X0WA 2BINA 4XZUB 4YSSA 3D6GA 5B3NA 1SJHA 2AZUA 2ALAA 2ZKHL 1QPXA 1J11A 1Z6JT 4UIKH 2ZX5A 1BJMA 2H0PA 3GS7A 4UMGA 2D3JA 2IPKB 5F21B 3O8XD 3W38A 3WTXA 1JWUA 1S3RA 2ICWI 2BX5A 2N7AA 2HLAB 2XPYA 4WIQA 3WENA 3KM2A 1VSCA 2FJGA 4XPTL 1AGBA 1FPTH 4AENA 2B5IB 5D2NE 4JY4B 4HOWA 2XN0A 2D7QA 4FI7A 1AQHA 1DBJL 1SMAA 5CEXA 5JW4N 4G43B 1OKEA 4PGBA 4D9LH 3BSZA 1LO0L 1FL5B 2CDEA 5IFJB 4FZEH 1X5ZA 2VTFA 2D9QB 4KK6C 3V0GA 3MJ8B 1W8OA 2CIIA 2VABA 4S10A 1WZAA 2XPGB 3T3PF 2HFFA 1AQDA 1YEIH 2AJVH 4HKZA 1U8LA 4I5BA 3EBHA 3LS5L 1XCTA 4OJFL 4YR6A 1GZHC 4XNQB 3CDGA 1F6AB 4FQLH 4KZ0A 4LPVA 3TO4C 1HC1A 1HH6A 1CI5A 4DEPB 2DBJA 2Z1KA 4KUCD 5DD1H 1QBBA 1FF5A 1QHQA 1QSZA 5DMGD 4DGWC 1TZGH 2ID5A 3P0YH 4ABQA 4DIXA 4Y16C 2ZOTA 5ACZA 3NIGE 4S11A 3CAFA 4WKZA 4DK3A 1VLXA 4WTZG 4LOEA 4M1CD 3D2UD 3K2IA 2X2UA 1HWHB 2XY1A 1XTLA 3GSVB 4A2EA 4YSOA 5L2KB 4RLDA 3CSGA 1IARB 1D5ZA 3WUZA 1IFHL 3QDJE 3JTTB 9CGTA 3LH2H 4EEEA 1QBLL 1W91A 2WM0A 1PYWB 4YWGL 2OXHB 1EFXB 3D0LA 2R29L 2DMBA 4AMKH 1JP5A 5IB1B 2HX8A 2E6QA 2APXA 5GGVY 3G9VA 3C8KB 3MSPA 4DETA 4HBCL 4LAJH 1K5WA 1SXCA 3KJ4B 1X5AA 3BH4A 3ZE0E 3GSWB 4G8IB 4D8PA 2BC4B 4U6VH 5AVXB 5FECA 4L37B 3PS6A 4NNPH 2QLYA 1NOFA 3MX0A 4Q0XH 4QXGH 4NO0A 4K94C 2VDNL 1JZEA 3N44B 2BSBA 2V3EA 1FC2D 2PNDA 1FZKA 4BFJA 3B2UD 4OFKA 1BSIA 3HJ0A 5I1EH 2BCKB 2WZ6A 1QWHA 4ZG1A 1KJMA 4JE4B 2DM4A 2A6DA 1G0XA 1TLMA 3VX0A 5D7LD 3MFGB 4JO4H 1N7ML 2WQ8A 1GS6X 25C8H 4GEIA 2Y06L 3RGHA 3SQOL 2EIEA 4NO2A 1ZHLB 3O6FC 1QLEB 1X5JA 3WN6A 1RUMH 3ZXAC 2ISDA 1JPGB 3BWZA 1ORQA 2VR4A 2B1AL 1P1ZB 2W95A 1OAKH 1ZLVK 4PG9B 2VQ1A 3D34A 5HDQH 1GC1L 3C6LB 1FL5A 3LNEA 4PRIE 5CZVL 3FQTB 5I18H 4KO6A 5AOIA 1FVDA 1H3XA 3RFRA 2J5WA 1QSEA 3TESA 3MODL 4IDJH 4JM2B 4M1CC 5L7XL 5AZEH 4WHTB 3VD0A 2VSMB 4PCSA 4AZ8B 4NUGH 2DQDH 5B1AB 2GAZB 2A83B 3FMGH 4LFHG 2K1MA 2P8PB 2GBAA 3CN1A 5LXGH 1JRHL 5EH1A 1MFAL 3W2DH 1PQZA 1ZJAA 1NFKA 1YEGH 4DAGL 3FPXA 4KROC 1FIGH 1OAQL 2VL4A 3CVHH 5EU4B 3BEVB 4XP9H 1BMZA 4C4KO 4JL1A 4CVXA 1DN0A 1AI1H 2B1HH 2NY6C 3PGDA 4X4KA 3TL5A 3VXRB 1RZ8B 1KCVH 5I0VA 5IOPB 1DQML 1YAZA 5C0ND 4RH4A 1CLZH 4LO9A 1NC2B 2WZAA 1JDDA 3LQZB 3DJTA 5D2LF 4OZ4B 1T2JA 1VACB 1J87A 1IAMA 1MY5A 3NRQA 4YSRA 1DFXA 1A8JH 1L9QA 4WW1B 3P02A 2RFXB 1KOAA 4R7XA 4PW3A 5C0CD 1T5KA 2AABL 1MIEL 1V27A 3LRGA 5GS1C 1FNGB 4QCIB 1NGQH 1BBJA 5J3HC 1CPUA 5IK3B 3GMMB 4G5ZH 1XGPB 4M43H 3TTYA 4LVOC 3PXHA 5DHVA 3WS3A 5E6RB 1NKOA 4LK4A 1KXHA 2DWXA 3WE6B 4FI6A 3AM8A 4M8QA 4ZSOB 4YDIL 1I3RA 3VH8A 1TVBA 3BFWA 3QYCA 4B3EA 4G6KL 3QG6B 4FLSA 4XCCL 1CICB 4A2GA 4XBMA 3VFUA 5I8OL 4EF3A 1N6QH 3M46A 2MMXA 1OD9A 4R84A 3ARGB 4W9EC 2VM9A 3GK8L 4PW9A 2OSLA 5D7IA 4QY8A 2XBZA 1JYWA 3NZ8A 1EGJA 2D3VA 3CSPA 2AJVL 2VZUA 2R4RL 2Y7MA 4PRNA 5J11B 2GEQA 4X6FA 1TJMA 3MRKB 1MW1A 4JMNA 4YUEL 4MNGA 3CHQA 1BM3L 1TQSA 3BMVA 3EYVB 1SEBA 3ARGD 2Q7YA 2JJSC 1VDGA 2XZAH 1NDTA 4BGDA 4WFFE 4IKIA 1A6ZB 1DVFB 3BPLB 5C6TL 2VL5B 3WL9B 2D7MA 4HT1H 2VDQB 2VITA 4AQ1B 4OCNC 4PJIF 1UGKA 1KFAL 2ATKA 3KL5A 3RPIA 1OP3K 1OE3A 5AW4B 2A9MH 1YG9A 3ULUH 1OW0C 5EV7A 1IRAY 1Q1JH 4YSQA 3F7VB 2W1NA 2ZOOA 1GIGH 2P24B 4N26A 3ATDA 4ODHH 2Y07L 5INCB 3NA9H 2UWEA 2R56L 3UL4A 3TT3L 4CVUA 1YUKB 1RJCA 3GRBA 5GPRA 5IQLA 3WE1A 4X7FC 1UB6B 5BVJB 1IB5A 3CFCH 1INDH 3CGTA 4L4VB 5FGBA 1E4WH 3S5LG 3T6ZA 1SOXA 4QRQA 3DX9A 2W5PA 4I3SL 5LWYH 3QHFL 4F7EA 3G6JF 4JN1L 5FS5A 3A4AA 4NQDA 2Q8AH 2QQLL 3OHMB 3ILPA 3GB7B 1WT5A 2V9QA 4ONHA 2MKLC 3QJFB 4CGTA 2AQSA 4L4TB 4KRMB 5F7BA 3SKJL 3BZ5A 1XBDA 2PW1B 4K4KA 2OYKA 2RACA 2RMNA 1FZMA 1EIBA 2ZUSA 5HHXH 4OM1H 1T1XA 3N04A 4K07A 1L0XA 5DA0B 4HLZG 1GGIH 5B8CB 3JVFC 5L2JA 1E5BA 2P8PA 4AUYA 1NQBA 1TTFA 3AT9A 4KDTC 4U6TA 3EJTA 3M07A 5D6DA 5JORA 2K6WA 3SPGA 3U0PB 1QHOA 1AR1C 3HAEA 3LPGA 4FDWA 5ESQA 2VITB 4AQ1A 1H3TA 3VW3H 3P4OA 2BVOB 4YSPA 3VXPB 1VPOH 3OJMB 4OQ1A 3RTQB 4AQ8A 1WD9A 2DYPB 4HJUA 4FYSA 3KPLA 5DVMA 2C3WA 3EJYC 4XMPH 2VXQH 1NJ9A 3FAWA 3H9SA 4QWWC 1OCCB 2Q8AL 1DSFL 2OSXA 1LNUA 3HG1B 5KVEL 4LXFA 4R5TA 2CO3A 3L5IA 4MYWB 1YEKH 2D7TH 3MUJA 4JKPH 2ADGB 2IADB 5KVEH 4ZFFA 4QLWA 1JNNL 1YEGL 5E94B 1O9ZA 1O75A 1PZ2A 3WTWA 1BYPA 2E6PA 4FP8L 3G5VA 4HWBA 3IS1X 4ZUUA 3ZR6A 1JWSB 5IVXE 3H3KA 3D48R 3WOVA 1J1OL 1FHGA 2EYTB 1CVRA 2CRIA 4XPFL 5D72L 3RUGF 5I1HH 4GQRA 3U7YL 2G2RB 1LK2A 4JRYD 5ENWA 5C0RH 4UQ9A 4UT9L 4EDXA 1TJHL 1AFVH 1RZPA 3GJFB 1CGUA 2WN2A 3L5XH 4XE5B 3BFOA 2AQNA 1CYWA 1K5NA 1R46A 3N40P 4AIXA 2NNCA 2EDJA 4G9FD 3WMSA 2PCFA 3GIZH 2NZ9D 5I6PA 5I0DA 5D2NA 4GKZB 2XWTB 2NNAB 5F9OL 3V4VL 2FNWA 3DXAB 1HKLH 5I1EL 2D9CA 4RMWA 1OW0A 5IBUG 2A9AA 5DHYB 2F8XC 4OLWH 1XT5A 2QPDB 2Z93B 3CBJB 1C5DA 3CN2A 4QTHA 3RBGA 1IAKA 3WIHL 5A2BA 5DHVH 2QHRH 5IREA 1P5UC 2BXZA 3Q8BA 5DJCA 3ZO9A 2VDPH 4MZIA 2DM7A 1SUJA 3AABA 2ENPA 3EJPA 4WTQA 5F7HA 1OK8A 4KRNA 1RIUL 4PJBF 3W0WE 3BQVA 2IFGA 2Y7OA 4OLYL 1IIKA 3S37X 5LCVA 3RNQA 5DRNA 3T3ME 2F58H 4XR8C 3WCYA 4LF3A 1PL3A 5I0WA 4KBPA 4GINA 3AU0A 3BGFC 4TQHA 1C7SA 4MDJA 1FNEB 4TSBH 2HLFD 4V1DB 2B9BA 3HG1E 2X70A 4JRXD 1P84J 4MX7B 4F9LA 1G94A 5LQBH 4EE2A 4YHPA 4CC4C 3FPYA 4GG6A 4U49A 5D4JA 1E90A 5KSVA 2W92A 1DCEA 5FYLE 3OG4B 3IMTA 5EFIB 3WIIH 8FABA 3FB7A 4I3RL 4PV8A 4E42A 3NN8A 5H94B 4ZW5A 3AUVA 3IKCB 2MHAB 2CUMA 2FGWL 3ET9F 3HTLX 5JXED 1CD1A 1XF2A 1MLCB 4G8FB 1OZTG 1U41A 4LLWB 4MFHA 1T03L 4WUUA 3WIHH 1G5AA 3ULVH 1IEBB 3UBFA 3DX0A 3IRPX 3I6LE 4ABVA 3V9FA 2FD6H 2X4SB 1FO0L 1NDMA 4HH9A 5GRVK 4ANVA 4GPVA 3DUSA 5BW7C 4BH7B 2H26B 1O9WA 5AL8A 4E41A 1J8RA 3L9YA 2F2HA 2VXVH 3P4OB 1UUSA 4XI5C 1S5IH 1OAXH 1ZT4A 2C1PB 3OKDA 5IESH 5K59F 1M9SA 3O4LB 4KJYB 5INDA 3NMEA 4PJAF 5HPMB 2VXSH 4W9JC 3MV01 3OLGA 1FFPB 3MN8A 1N64H 2JV6A 4EQ2A 1ZLEA 1TNNA 1H15B 4QRAA 2ZOKB 3C12A 5LBSH 2I9TB 4PJXB 3HNTH 1UM5L 1UA6L 4AW7A 1NEPA 3B5TA 4IBVA 1NWOA 4F80A 3IDJB 4R2GD 4PRHE 5GS0C 5EOTA 4WI0B 5IQMA 5DJ2B 4A68A 3TVMC 5AAPA 3DWTA 3NJGA 5EBLA 1B3JA 3SDYL 3CSYB 3SEPA 2HUEA 3EDFA 3E6HA 4O00A 3PU7A 1XCTB 3C9NA 2RCSL 4PS3A 3T04D 2P44B 2GY7B 3D09A 5A16A 5E5UB 4I88A 3GKZA 4GBXB 3QUXD 1GKEA 5E5RB 1U3HD 3X11A 3HG0A 2XWJA 4G1MB 2XQ0A 1V7ML 2E0PA 4NNXA 1UT2A 5DRZB 1SY6L 4K8RL 2NXYD 3TCLA 4MA7L 5FGBC 3UPAA 4QF1B 4KITB 3TBVB 3VYPA 5EEVA 5J6GA 2CKBA 2NY7L 1VERA 3VI3E 4PLKD 1J9RA 2CD0A 5CMAB 1C08A 3BDXA 3RWJB 5I5MA 3QRFM 2BP3A 4P5MA 1BVKA 5F3FA 4MMXC 5JHLA 2JKJA 3KLLA 5C70A 3WY4A 2X3BA 1ZE3H 3UPCA 1A3RL 5FR3A 1OEZW 4WO4D 1WC7B 3FT3B 1USQA 2PTTA 2A7BA 2VIRB 3ZYIA 1MFCL 2XZQH 4ZQKB 3UG4A 3JVGC 3QFJE 4J23A 4XNZC 1BP3B 2H3KA 3BVNB 3JV4A 4NZUL 3WBDA 4GSXA 4FFVD 2HKAA 2AEPH 1R34A 4KKCC 4ELME 5DJ2A 1RK7A 2VLRB 4CSSA 3P77A 4DKEH 1GYUA 1MCHA 3GDBA 1RU9H 1XF3B 1RJLA 3KDMA 3WGVB 1IFRA 1J12A 2B59B 4ZYKB 3BQUC 4UBDC 1SYSA 3REWB 4ES9A 2VN6A 1SLUA 1XAUA 4FEIA 5E9NA 4HIHB 3D4ZA 1CFVL 2DQFA 5D7JB 3CFQA 1E4XI 3EJYD 3UTZB 5CXPA 3HMXL 5A6LA 3L9EA 4FNPA 2VLJD 5F6IB 3TZVA 1H15A 4E5XB 5CBEB 3FRPG 4KKCD 4LU5H 1MNUL 2WYHA 3NUKA 3BRDA 4R7NA 4HIQA 2B4CC 1JIBA 4DO6A 3S36X 5C0IA 1CLYH 1PS3A 4NFBA 4HEMA 4U6XB 3CFNA 3VI3B 1FL6A 3MCLL 2IPUG 3SYQA 3NSCA 5EORH 3OB8A 1GMIA 1WZ1L 3IDUA 4AL8L 4O58H 5T5FL 2ZCLH 3OJDA 4LQ1A 1JZJA 3QWOA 3UJTL 3ELQA 3B7UX 1OP9A 3QFDA 4PBWD 5GS1A 1LDPH 3L5XL 4C8XA 4BH7A 3QUYA 4NKQB 4XNBA 3RVTD 5C2BL 2WVVB 4HP5A 1I7TA 1QW8A 2CAKA 3CDZB 1M05A 4FQ2H 1OAUH 1KCSH 1UQSB 3Q0HA 5IB5B 1DVFC 2R2BA 3PNRB 1A1MA 2G9KA 3MBWB 4MX7A 1S4IA 1U8MB 3BGMA 3GMQB 4OFVA 3OGCA 2YAPA 3PDDA 2EVFA 5IK3A 3QO1B 2F1EA 2OJ1A 3C2AL 5E6IA 5C3IA 1XWVA 4PV8B 1WAAA 2WW8A 1OCWH 4M93C 35C8H 1Q9OB 3WIHA 4NO0B 4DESA 3K6NA 4UOW0 3DVFA 2NSMA 2XUWA 3QEUA 1ZGLM 3QIBB 1LXMA 4M48L 4YSTA 5C71A 4U6XA 3K0WA 3I9IA 3EXLA 5I30H 3QPQC 4WUKL 2JLLA 4R7NB 4YC2B 2XZZA 1AGCA 2DQEH 2QPSA 5FXCH 1I8IA 3CWGA 2CM6A 4U1MB 2NZIA 5C0AB 5JHLL 5JLZB 1ZT1B 3ECVA 5EN3A 4ZTOL 5F1IB 4FF9A 2FL5B 4QJ4B 2LLGA 2WQVA 2XTJC 3UTQB 3OKNB 4LKCA 2EACA 2XWBA 3I02B 2P5EA 4MWFB 1OO2A 1HAUA 2EXYD 1F6LL 1AG6A 4F7PB 1IMHC 1PJWA 5JIDA 2AANA 4MB3A 3DNKA 4GBXD 1JZ5A 5ADOL 2DWSA 1TETH 1OF2A 3ULVC 4HFUL 3V6ZB 3QQDA 2J88H 3U6XA 3MRJA 3GGWB 1NEZB 4LHUD 5FM5M 2WSDA 4F2FA 2MQGA 3MBXL 5JNYA 2WAHA 5TF0A 5IF0A 3ZKQD 1LWRA 4DVBB 1G5GA 2EDRA 2WXNA 1SFHA 1KXQE 5JZ7C 3WKYA 3L5JA 3W81A 4I0CC 1EEZA 1OP5K 1KN2H 4MKMA 5FO2A 3QIBA 4JY5L 2C9RA 2DD8L 1KLFB 1P6FA 1FA4A 4UDUB 4EMZA 3RQ3A 4J4PA 3KCWA 1SEQL 4GKOA 2J5LC 1SBSH 4LLMB 3EYVA 3CSFA 5C0BD 1RK1A 4UU9B 3QCUH 1XF1A 1URIA 5T1MB 5C0DA 3UFIA 4AI7A 4HCIA 5E9DA 2WXKA 1P7QB 5GS0L 4J2XA 5HHVH 3KE0A 1F6AA 4HISA 1ETZA 4WTWA 1MFNA 4HJ1A 3PHOA 5K59E 1RL1A 3E9UA 3GZKA 5BV7B 3M7FB 1ZOXA 3N42B 3QIWC 2FO1A 1FIEA 2C5DC 3VVWA 1GGYA 3ELAT 4GNKB 3BKCL 5F0JB 1KGJA 3G3LA 4NQDD 1T1XB 2RTTA 1U2YA 4GIAA 4ZUVB 1TTGA 3SQRA 4Y16B 4YXKL 4DO4A 4QT5A 3BDBA 4RDQF 5HHPB 2ITEA 1SDDA 4C59B 2JIXB 4MQTB 1ASOA 1JNHB 1BVZA 1XGQA 2YSTA 4LHJB 3W37A 4P0DA 4UT7H 2MEJB 4LPUA 4HUWB 4Z1PA 5EA0H 5IROA 4F7EB 1A3ZA 2BCKA 1XF3A 4JPKL 2VN3A 4L5FL 1CE1L 1ODUA 2YGVA 2XLLA 4PJIA 4OUUA 5EBGA 1FDLL 3AY2A 5IHLB 3OLDA 5EU7E 3DO7B 4N24A 3CIQA 4QXTA 3IMUA 1XSJA 2Q20A 2MSPA 4GP8B 5ISZB 2HVKA 2XV3A 4GH7B 4XPHL 4L37A 4PWKA 3N5AA 4JRLA 7PAZA 3Q2WA 4NPYA 4CSTA 2GFBA 3T0WA 4XNQA 3DUUA 1DL7H 2FWSA 4JG0H 3U0WH 4I7ZC 4BSWB 1PNDA 1FWXA 4LIQE 3P73B 3T8XB 2BVQB 5A2FA 5KYXB 5EO0A 4JFEB 1VGEL 2BS8A 3HVDA 5MI0C 3WY3A 3EF4A 4TTDC 4Z77A 3ARDA 3O11B 4G2AA 1C16B 2BOBB 3GSOB 3AG1B 3ORJA 4Y0GA 4CKVX 5EEXA 4EIZC 4Y4HD 3S96B 4YXLL 4YMPA 1BREA 4FQ2L 5IVZA 4JFFA 3KW8A 1UHVA 3SPCA 3TIDA 2Z4TA 3P9MA 4HCGA 3WIAA 5T3ZH 1QATA 3FQWA 4NN5C 4NRXA 3VFPA 4FX5A 3ISWA 5EOCJ 3OAYH 2UXFA 4IGBA 4UAOC 4XPTH 4DP4X 3SDDA 3Q6FB 3QCTH 2JQMA 3HHSB 1JJUA 5EU6E 2FZ3A 1DJGA 2OSLB 3Q7JA 1CDYA 4JVWA 1E8WA 1IGYB 4LLUB 2DDQH 4ADJA 2VISB 2P49B 2BSTB 4M7KH 5FUOH 6PCYA 3POHA 5T1KA 2BVYA 2OTUB 3RWFA 1SNRA 1IAOB 2GI0A 2GY5A 3D3VB 3DX1A 3GBLA 2PR4H 3SZKC 1KIPB 1DANU 1E9PB 1WPCA 2DWEA 9PCYA 4HPOH 1ZVHA 1MW2A 4DKFL 3S3CB 2PYFA 3QQDB 4N8VG 1G84A 4GI9A 2EEXA 3E7JA 12E8L 5I6NA 5M94B 3ERXA 2H8PB 5FO8A 3RP1A 3HI6H 1GPOL 3EDEA 3MUGA 2EH8L 1AP2A 1DANT 2ADIB 1BFSA 3K5RA 3L7FA 4JRWA 5HGHA 5T3ZD 4LSQH 1A4KA 1CLCA 1H5BB 2WLJA 5EU5A 5CP7B 5CZKA 1MNNA 3EG9A 1FNGA 3OMAB 4F57H 1KJ3L 4HK0A 5DZAA 5ICXB 2X44D 1HXMB 1KJ2B 2WTRA 3EFDH 2X10A 4N2BA 4R83A 1H0DB 4V33A 2BW4A 1PKQB 3RZCA 3GSOA 4KK8D 3K1KC 3OMNB 2D4FA 2WLLA 1JSYA 5C0AA 2Z91A 1IVTA 2PYEE 2Z7YA 3L5HA 1M6OA 4RFOH 3RWHB 4TVPE 3ROLA 3IDYC 1IC7H 3OAZH 2QV4A 5FOBA 3H53A 3MCKA 1S7SB 4JDEA 4KKBD 1YYCA 4MZRA 1OCWL 4Y2DD 3FOLB 4TNWF 1BXUA 2VLKE 2APSA 3QARA 4QHNA 4B0MB 3EGXA 5BV7H 4X5QA 4FG4A 4DWHA 3PXJA 1I3VA 2YEQA 4H0GA 5JDSB 4MD5A 5DHMC 5A2CA 3TM6A 3IDMA 2E27H 3WKML 2LW3A 5GXBB