The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
35
|
sequence length |
155
|
structure length |
155
|
Chain Sequence |
b'ASIEVKVQQLDPVNGNKDVGTVTITESNYGLVFTPDLQGLSEGLHGFHIHENPSCEPKEQEGQLTAGLGAGGHWDPKGAKQHGYPWQDDAHLGDLPALTVLHDGTATNPVLAPRLKHLDDVRGHSIMIHTGGDNHSDHPAPLGGGGPRMACGVIK'
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule keywords |
Superoxide dismutase [Cu-Zn]
|
molecule tags |
Oxidoreductase
|
source organism |
Neisseria meningitidis
|
publication title |
CU/ZN superoxide dismutase from neisseria meningitidis K91Q, K94Q double mutant
rcsb |
total genus |
35
|
structure length |
155
|
sequence length |
155
|
chains with identical sequence |
B, C
|
ec nomenclature |
ec
1.15.1.1: Superoxide dismutase. |
pdb deposition date | 2005-08-18 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF00080 | Sod_Cu | Copper/zinc superoxide dismutase (SODC) |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Beta | Sandwich | Immunoglobulin-like | Superoxide dismutase, copper/zinc binding domain |