2AR5A

Crystal structure of the mammalian c2alpha-pi3 kinase px-domain
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
117
structure length
117
Chain Sequence
MDGRIKEVSVFTYHKKYNPDKHYIYVVRILREGQIEPSFVFRTFDEFQELHNKLSIIFPLWKLPGFPNRMVLGRTHIKDVAAKRKIELNSYLQSLMNASTDVAECDLVCTFFHGSHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphoinositide 3-kinase
publication title Ligand-binding specificity of PI3Kinase C2alpha PX domain.
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 27
structure length 117
sequence length 117
ec nomenclature ec 2.7.1.154: Phosphatidylinositol-4-phosphate 3-kinase.
pdb deposition date 2005-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00787 PX PX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1520.10 Alpha Beta 2-Layer Sandwich PX Domain Phox-like domain 2ar5A00
2RAJA 3LUIA 4BGJA 2L73A 1H6HA 2WWEA 1OCSA 4P2JA 2RAIA 1KQ6A 4AKVA 2CSKA 1GD5A 4IKBB 4HASA 2RAKA 4ON3A 3P0CA 1KMDA 3IQ2A 3HPCX 3FOGA 4AZ9A 4IKDA 1XTNA 4PQPA 2DYBA 2V6VA 4PQOA 3DYTA 4OXWA 3HPBA 2V14A 1O7KA 2I4KA 1XTEA 4PZGA 2ETTA 2IWLX 2REDA 2CZOA 4IKBA 2YPSA 4P2IA 2AR5A 1OCUA 2REAA
chains in the Genus database with same CATH superfamily
2RAJA 3LUIA 4BGJA 2L73A 1H6HA 2WWEA 1OCSA 4P2JA 2RAIA 1KQ6A 4AKVA 2CSKA 1GD5A 4IKBB 4HASA 2RAKA 4ON3A 3P0CA 1KMDA 3IQ2A 3HPCX 3FOGA 4AZ9A 4IKDA 1XTNA 4PQPA 2DYBA 2V6VA 4PQOA 3DYTA 4OXWA 3HPBA 2V14A 1O7KA 2I4KA 1XTEA 4PZGA 2ETTA 2IWLX 2REDA 2CZOA 4IKBA 2YPSA 4P2IA 2AR5A 1OCUA 2REAA
chains in the Genus database with same CATH topology
2RAJA 3LUIA 4BGJA 2L73A 1H6HA 2WWEA 1OCSA 4P2JA 2RAIA 1KQ6A 4AKVA 2CSKA 1GD5A 4IKBB 4HASA 2RAKA 4ON3A 3P0CA 1KMDA 3IQ2A 3HPCX 3FOGA 4AZ9A 4IKDA 1XTNA 4PQPA 2DYBA 2V6VA 4PQOA 3DYTA 4OXWA 3HPBA 2V14A 1O7KA 2I4KA 1XTEA 4PZGA 2ETTA 2IWLX 2REDA 2CZOA 4IKBA 2YPSA 4P2IA 2AR5A 1OCUA 2REAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RAJ A;  3LUI A;  4BGJ A;  2L73 A;  1H6H A;  2WWE A;  1OCS A;  4P2J A;  2RAI A;  1KQ6 A;  4AKV A;  2CSK A;  1GD5 A;  4IKB B;  4HAS A;  2RAK A;  4ON3 A;  3P0C A;  1KMD A;  3IQ2 A;  3HPC X;  3FOG A;  4AZ9 A;  4IKD A;  1XTN A;  4PQP A;  2DYB A;  2V6V A;  4PQO A;  3DYT A;  4OXW A;  3HPB A;  2V14 A;  1O7K A;  2I4K A;  1XTE A;  4PZG A;  2ETT A;  2IWL X;  2RED A;  2CZO A;  4IKB A;  2YPS A;  4P2I A;  2AR5 A;  1OCU A;  2REA A; 
#chains in the Genus database with same CATH topology
 2RAJ A;  3LUI A;  4BGJ A;  2L73 A;  1H6H A;  2WWE A;  1OCS A;  4P2J A;  2RAI A;  1KQ6 A;  4AKV A;  2CSK A;  1GD5 A;  4IKB B;  4HAS A;  2RAK A;  4ON3 A;  3P0C A;  1KMD A;  3IQ2 A;  3HPC X;  3FOG A;  4AZ9 A;  4IKD A;  1XTN A;  4PQP A;  2DYB A;  2V6V A;  4PQO A;  3DYT A;  4OXW A;  3HPB A;  2V14 A;  1O7K A;  2I4K A;  1XTE A;  4PZG A;  2ETT A;  2IWL X;  2RED A;  2CZO A;  4IKB A;  2YPS A;  4P2I A;  2AR5 A;  1OCU A;  2REA A; 
#chains in the Genus database with same CATH homology
 2RAJ A;  3LUI A;  4BGJ A;  2L73 A;  1H6H A;  2WWE A;  1OCS A;  4P2J A;  2RAI A;  1KQ6 A;  4AKV A;  2CSK A;  1GD5 A;  4IKB B;  4HAS A;  2RAK A;  4ON3 A;  3P0C A;  1KMD A;  3IQ2 A;  3HPC X;  3FOG A;  4AZ9 A;  4IKD A;  1XTN A;  4PQP A;  2DYB A;  2V6V A;  4PQO A;  3DYT A;  4OXW A;  3HPB A;  2V14 A;  1O7K A;  2I4K A;  1XTE A;  4PZG A;  2ETT A;  2IWL X;  2RED A;  2CZO A;  4IKB A;  2YPS A;  4P2I A;  2AR5 A;  1OCU A;  2REA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...