2ARBA

Pterocarpus angolensis lectin (pal) in complex with the glcnac(beta1-2)man disaccharide
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
240
structure length
240
Chain Sequence
QDSLSFGFPTFPSDQKNLIFQGDAQIKNNAVQLTKTDSNGNPVASTVGRILFSAQVHLWEKSSSRVANFQSQFSFSLKSPLSNGADGIAFFIAPPDTTIPSGSGGGLLGLFAPGTAQNTSANQVIAVEFDTFYAQDSNTWDPNYPHIGIDVNSIRSVKTVKWDRRDGQSLNVLVTFNPSTRNLDVVATYSDGTRYEVSYEVDVRSVLPEWVRVGFSAASGEQYQTHTLESWSFTSTLLYT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the recognition of complex-type biantennary oligosaccharides by Pterocarpus angolensis lectin.
pubmed doi rcsb
molecule tags Sugar binding protein
molecule keywords lectin
total genus 56
structure length 240
sequence length 240
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00139 Lectin_legB Legume lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2arbA00
1SBDA 2D6PA 5DZEA 1AVBA 3FUOA 5JDBA 4C1WA 1V6KA 1V6NA 4GWMA 3WDWA 1Q8OA 3N7LA 2A5ZA 4LBQD 3UK9A 1VIWB 1AXKA 3BIWE 1LHVA 2TEPA 1I3HA 2D3PA 5DZFA 4U36A 3LSDA 2JJ6A 2A6ZA 2OUHA 1IS4A 1Q56A 3AZYA 4YLZA 1AJOA 2AH2A 2DWRA 3AZZA 3SISA 3L2YA 4Y1ZA 4Q27A 2Z42A 1V6JA 4GKXA 3NV3A 1GNHA 4Y22A 3MW4A 2PHXA 3B9CA 1MS3A 3FLTA 2VY0A 1BYHA 3AYCA 2ZHLA 3LSEA 1MS1A 3VKOA 1Z78A 4FPLA 1N1YA 2VW2A 1V00A 2WJSA 4Y26A 2D3RA 2EXKA 2GNDA 4DRRA 1SACA 5CAZA 3FLPA 1G86A 1SLAA 2C9AA 1BQPA 3N7MA 4FPKA 1LU2A 1S0BA 1QOTA 2VU9A 3ZXFA 5DXDA 2D7FA 1LOFA 4XIOA 2LALA 1SBFA 5EYYA 2A75A 5CA6A 1CN1A 3NV2A 4M3CA 2GN3A 1JYCA 3AJZA 1DIWA 4XTPA 1W6NB 4K21A 3O0WA 1GANA 1G9DA 5JOZA 1GLHA 2R1BA 1WLWA 2WSUA 3ZXEA 4CTEA 5JMCA 1HKDA 4YFZA 1LGBA 3KQRA 2OUJA 3VUOA 1APNA 1KITA 4BQ1A 2WKKA 4XJ8A 1UZZA 4FOQA 1YO8A 4Y20B 1DGLA 4TYSA 5KXCA 4BMBA 1OQ1A 1OKQA 1MS0A 2GNBA 3LCPA 3RG0A 2W52A 4M3CB 3ZXJA 3WDVA 4BMEA 1W6PB 2V5YA 2ZBJA 1MVQA 2FHRA 2UWAA 2UURA 3OBRA 2WT0A 3IN9A 2R0HA 1SFYA 4Q2FA 4FPYA 4R9AA 5E89A 1S0GA 2EXIA 4DQAA 2YZ4A 2ZGSA 4XOGA 1UL9A 2P34A 3AYAA 4FPCA 3W59A 1AXYA 3OY8A 3QLQA 1LEDA 2A3XA 1A3KA 1UPSA 4K1ZA 3VKFC 2GALA 3IPVA 1S0FA 1LOEA 4FPFA 5IK8A 1URXA 1JBCA 2JD4A 4WVWA 1QMJA 5EYXA 4PF5A 2FMDA 2YROA 3O5SA 1G8WA 1LHOA 3V65A 1JXNA 5T50A 4JC1A 1Q8QA 1DQ6A 1N1SA 1GICA 5GZFA 3HMYA 3ILRA 1G9FA 1D0HA 1G9CA 2JDZA 3OJBA 4ATFA 2OW4A 4PQ9A 1LOAA 2WLQA 2A7AA 3B00A 2D44A 2I2SA 4Y1YA 2VH9A 1F9KA 4PCRA 1MS4A 1RITA 4XIKA 1W6OB 5EXOA 2JE7A 1RINA 2E7QA 1ONAA 1AZDA 1LOBA 2A71A 1KRIA 1QGLA 1CESA 4YZ2A 4AWDA 1QOOA 2EAKA 4DS0A 3B69A 4LBKA 2DUPA 3A0KA 3DGTA 4Y24A 3M3CA 4OZXA 1UAIA 4M3CE 4YM1A 4YM2A 3USUB 1W6PA 1S0DA 4BM8A 4W65A 4ZXKA 1UKGA 1V6OA 1UN1A 3B3QE 3N7JA 1BZWA 4PBPA 2WSVA 3AP6A 2A3YA 4YGEA 4YZ4A 5H9QA 4YGBA 3R05A 3WDTA 1UX6A 4AYUA 1SLLA 3AP7A 3N3HA 2A3WA 1QDOA 3WG4A 2AGSA 1WD4A 4XMAA 1FV3A 2AYHA 5T54A 3UJQA 3WHTA 1QF3A 4YW4A 5IK7A 3ZSLA 4BOWA 3WNXA 2D3SA 2D6LX 5GLWA 3ILNA 5IUQA 4XJ9A 3ZSMA 1V6LA 4UW3A 1LOGA 1HQWA 5HCAA 2A6YA 4Z8BA 2ZABA 3BTAA 1JUIA 4FQ4A 1SCSA 1QKQA 2DYCA 5FRAA 5GM0A 1A8DA 3AJYA 1GNZA 1N1TA 1FAYA 2P3KA 5AVAA 2DVAA 3SITA 1GYKA 4FPOB 5F9TA 1IOAA 1DQ2A 4YW5A 1LTEA 2E53A 1UMZA 1HQLA 2ZHNA 2ES3A 4YG3A 3FFZA 2D6KA 4MYEA 2ZACA 3N35A 2ZZJA 3PVOA 2ZGUA 2VW0A 1Q8VA 5JVVA 2R1DA 1FV2A 1W0OA 4P9WA 4ITCA 1MS9A 2GMPA 4I30A 4YW3A 1GBGA 5GZEA 3RS6A 3WCRA 3OPZA 1CONA 4P9YA 2YY1A 1YI7A 4XHBA 2E51A 2GN7A 1H9WA 2NMOA 2WNEA 3AX4A 5GLZA 3SH5A 1JYIA 1RIRA 2ZMKA 3WUDA 2AREA 1DQ0A 3WUCA 5LK5A 1CVNA 1F5FA 3A0NA 3D5OA 1F31A 2CY6A 2R16A 4SLIA 1LGNA 4C1XA 5GALA 1WLCA 1AX0A 2XG3A 2W68A 3POWA 4LBQA 4UW4A 4Y1VA 3RMYA 5GLUA 1S0CA 1LGCA 3W58A 2GMEA 3O12A 1KDMA 2WQZC 1QNWA 4FVVA 5T52A 4K20A 5H9PA 4DPNA 3ZVXA 1YYNA 5E88A 1DYPA 5JOWA 2JKBA 5GZCA 1GZWA 1VAMA 2NYYA 1V6IA 5DUWA 4YM3A 1GV9A 1MS5A 3AK0A 5T55A 3FLRA 2NMNA 4M3CF 1TEIA 3MEPA 4XILA 2CYFA 1IKQA 3MW2A 1FYUA 1MR5A 1W6MA 1LESA 3WDYA 4XTMA 3WZ1A 5CNAA 3AP9A 3VKMA 2UWCA 3POYA 4JCKA 5T5LA 3GNEA 2GNMA 4R9CA 4YZ3A 3ATGA 4TZDA 4YG0A 3T1MA 1CQ9A 3M1HA 1PZ8A 3ZYPA 1Q8SA 3R4UA 4XBQA 1G9BA 4LBOA 3NWKA 3V0AB 4XJWA 1ZM1A 1DQ5A 1DZQA 1DQ4A 1IKPA 3U4XA 2DU0A 5SV8A 2UU8A 1FNZA 1SLCA 2ARXA 2VXRA 3V0BB 2ZGPA 4Q8KA 4YGDA 3V0BA 2YV8A 4ZKTB 2ZA9A 1ZA4A 2RHPA 3PMEA 3OYWA 4D69A 2D6OX 1N1VA 2ZGTA 4L8QA 3O0VA 3RMXA 3WLUA 2D6NA 1MACA 4UW6A 2PHTA 1LOFC 4LBLA 1YIFA 1IS5A 3AZXA 5L73A 2UWBA 1ENSA 2C5DA 1QOSA 4AGVA 1CJPA 3ASIA 3BODA 2KM2A 3NV1A 4GXLA 2DVBA 3OBTA 2ZGOA 1R1ZA 2AR6A 1SLTA 1W6MB 4RL7A 1BXHA 5KXBA 4AVSA 1W6NA 1DQ1A 2ZGRA 3AZVA 1W6QB 3N7KA 5IK5A 4IQPA 2YMZA 2CL2A 3D6EA 4CZSA 1U0AA 4GKYA 4FPGA 3N36A 5GZGA 1UZYA 1WBLA 1S0IA 1S1AA 2DUOA 1C57A 1CR7A 2ZKNA 1YXWA 1LENA 2R49A 3RQ0A 3M3QA 2E6VA 1CPNA 1ULCA 1ULFA 1AXZA 2HYKA 3AYEA 4P9XA 3AP4A 2ARBA 4JRAA 1FX5A 1GZ9A 3OGGA 3JUUA 3POSA 4FPHA 4YGCA 3T2TA 4YZ1A 2AUYA 2ZGLA 4NO4A 4YW1A 1SLIA 2WT1A 2EF6A 1AJKA 1DLLA 4LBQB 4R9BA 1G7YA 4AVVA 1SLBA 2EIGA 1H9PA 4GALA 2W08A 3NV4A 1WD3A 3HN1A 4NOTA 1WBFA 1CPMA 2A70A 4CRQA 2SBAA 3B01A 2PHUA 4ISQA 2V73A 4GWNA 4H55A 4LBNA 1AX2A 2ZGMA 2P37A 3IPVB 3ZSJA 2BQPA 1V6MA 4LBJA 4M01A 1LEMA 3AZWA 3M3OA 4FP2A 4XXAA 5JLVA 2D43A 5F5QA 4ATEA 3C2UA 1Y7BA 5GLVA 2NM1A 1ENRA 2EALA 4WV8A 3VV1A 1KDKA 4DFSA 4UW5A 5T5JA 3PJQA 5DUUA 1WW6A 3TB0A 1DHKB 3I4IA 5E8AA 3M3EA 4AGGA 2E7TA 1C4RA 4R9DA 3ZPYA 4BLJA 1LU1A 1VAVA 3WG2A 2DTYA 3ZXLA 2DTWA 3WDUA 2DU1A 2DVGA 1KJRA 1LOCA 1N3PA 1FNYA 3R4SA 3WDXA 4Q26A 2WT2A 2ZAAA 3BOPA 5CB7A 1PZ9A 5DG2A 5JOYA 3AFKA 5GJ6A 2LTNA 1JN2P 1LODA 1W6QA 3A4UA 2ERFA 5T5OA 1LHUA 5CBLA 4HANA 1ULEA 4Q8LA 4YZ5A 1AF9A 4M00A 5H9SA 2EXJA 3IMNA 3OY8B 1MZ6A 1NXD1 3OYWB 2GNTA 1X50A 4FP3A 2A6WA 4XJUA 4XZPA 2A6XA 1Z0HA 1DBNA 2VUAA 5HCFA 3WV6A 3AYDA 3TAYA 1VALA 1QNYA 1DYKA 2XB6C 3DUIA 2EXHA 1C1LA 4AVTA 3D4KA 3V0AA 1B09A 3INAA 3WG3A 2ZGQA 2YXSA 4BPZA 1WUVA 4FPEA 5EWSA 3UL2A 2GDFA 1BJQA 1YRZA 4Q1PA 1WLDA 4HL0A 2AENA 3KM5A 5BYNA 4AGRA 2DUQA 1VLNA 4YG6A 4LBMA 1QU0A 1ENQA 1A78A 3SNMA 1GZWB 1BKZA 3UJOA 4FOYA 4Q1RA 4XBLA 1WW5A 2Q5TA 4FPJA 1CIWA 5IT6A 3USUA 1AX1A 4FQZA 2ZHMA 1OFSA 1Q8PA 2DVFA 5HCBA 3SH4A 3WVJA 2NN8A 2JECA 3GALA 5DZGA 2NP0A 3M2MA 1GZCA 1LHWA 5KXEA 1KQRA 1LCLA 3ZXKA 3PVEA 3MPPG 4Y1UA 4XE9A 4KBBA 2PHWA 2P2KA 3VKLA 4GA9A 4WZFA 1MZ5A 1JOJA 1G9AA 2ZHKA 1N3QA 1PZ7A 1MVEA 2OVUA 1KJLA 1WW7A 3ENRA 2R0FA 1IS6A 5IK4A 3QCWA 1JW6A 1NLSA 2A6VA 2CWMA 4ISRA 4XJAA 3SH3A 1ULGA 2PHRA 1GSLA 4F83A 5H9RA 3CNAA 2CNAA 1EPWA 1ULDA 4XBNA 3IKWA 2D6MA 4YW2A 1S0EA 2P3JA 2GMMA 3Q9OA 4RA0A 3H0OA 3WHUA 3APBA 3MW3A 3FBYA 3PVNA 1W6OA 5DG1A 3WOGA 4BLIA 1QDCA 2JE9A 3RSJA 4DRVA 4WVVA 1LHNA 4XJZA 2CTVA 1DFQA 1JHNA 4YM0A 4Y20A 3O0XA 4XDQA 1HLCA 1GKBA 1N3OA 4PBOA 1IS3A 2DVDA 3T1LA 2DV9A 2DURA 5KXDA 1N47A 4FOVA 3AXEA 5FREA 1XQNA 5JOXA 1D2SA 1FATA 3ZSKA 3VKNA 2ZGNA 2P3IA 4XYXA 3AP5A 3I8TA 3HR9A 1LECA 4Y1XA 4XXPA 3WCSA 1S0JA 4FOWA 1LJ7A 1WCSA 2NZ9A 2ZMLA 5DUVA 1SBEA 2CWSA 2ZGKA 3IM0A 1J1TA 3AXDA 3FUQA 3WG1A 2SLIA 1O4YA 1LULA 3V64A 4ASMB 1WW4A 1H30A 3JU9A 2ZMNA 2PHFA 1I1EA 1SCRA 2H0BA 5T5PA 3ZYRA 5GZDA 4U2AA 2G4IA 2PELA 1MS8A 2VW1A 3ILFA 3RRDA 2W39A 1HDKA 1C1FA 4YFWA 5DUXA 1W0PA 2B7YA 4Y22B 4XHXA 1O4ZA 4P14A 3SLIA 5GLTA 2ENRA 4K1YA 4XMIA
chains in the Genus database with same CATH superfamily
1SBDA 1HX6A 1ULOA 5DZEA 1AVBA 1C8NA 3W9AA 4AHZA 2D5FA 4QXKA 4XF9A 4B7EA 3BYWA 4CUCA 2R042 1PO12 4CEYB 4CP0A 1Q8OA 4HN1A 2I74A 1LHVA 2TEPA 2I07B 4OHVA 4EWAA 2BOJA 2K2SA 2V09A 4LHKA 5LASA 2OQ6A 1Q56A 4L9BA 1QWRA 2X05A 3WP5A 3SISA 3ZIXA 1RUNA 4OUEA 4CPBA 5CFDC 3ECQA 3ZN5A 4QDSA 5FZMA 2UY8A 2WFF1 2HEVF 5BUVA 1GNHA 5LWBA 2VMGA 3O1OA 2CV6A 3H8RA 3T2QA 3VBFB 1K5MC 1ZX5A 1BYHA 3AYCA 3VHNA 2W0XA 3LGRA 1WGPA 2JDNA 3VKOA 2TBVA 4FPLA 5A32A 2BFUL 3R6SA 3I2DA 4C91A 1BEV1 2IFWA 3J7LA 4AEDC 1V00A 4Y26A 3D8CA 4J1XA 2FDJA 3DKQA 5KC6A 1DG6A 3UKVA 3ZKUA 2BYVE 4AVBA 3VD3A 1G86A 1GFF2 4HVRA 1BQPA 4CP1A 5JAXA 3UKTA 1QOTA 3SCFA 5CFCC 5FQ0A 1SBFA 3KV9A 2R7EB 2JE8A 1T6GC 5A7OA 3GCWA 5L36A 5C3RA 3AJZA 5IVEA 1GWKA 5L7OC 1GP6A 1OFNA 2HWB1 3O0WA 4K21A 1O59A 1G9DA 3L9JT 3EHKA 5FKCA 4AFAA 4KU7A 5FZ6A 1OPMA 2R1BA 4DXSA 3VBSB 1CAUA 1NE4A 1VBA1 2WNVB 1US3A 4WBBA 4ZS3A 4YFZA 3VUOA 5C5TA 1YFWA 1APNA 1BK1A 3A23A 2CGNA 5EQUA 3NJYA 1VMFA 2WKKA 1UZZA 4XJ8A 1L3JA 3MO4A 3RI8A 3OEBA 4IEVA 3LEGA 1T6BX 2Z69A 5FYZA 5JR2A 1ZBA1 3LCPA 1UY3A 2W52A 4M3CB 3HIFA 4RN5A 3VLBB 1O5LA 3WDVA 3ZYFA 2OZJA 4NAOA 1AL0G 4Z07A 3OBRA 3U4SA 2UURA 1UPIA 1TME3 3IN9A 1RUC2 4SBVA 5E89A 4R9AA 1BLZA 5C8CC 1VPHA 1V9U2 4DQAA 5KR7A 1W06A 3NQHA 2ZGSA 2HYXA 4FPCA 2P34A 4QPWA 2RS33 4XOGA 4EWDA 3VDDA 4HOOA 1JMUB 5LY2A 1OLRA 3VKFC 3GBWA 3BUCA 5F37A 5ACA3 4CE8A 4QU1A 5JXJA 1URXA 4M0HA 4CCKA 1ND3C 1QMJA 4WM7C 1B35C 4ARYA 2FMDA 2HWB3 4QPIB 4EE2A 4EZ4A 1JXNA 4JC1A 1Q8QA 4NRMA 4I2OA 5C9AB 1HN0A 4IEUA 1G9CA 3CZJA 2OW4A 4D6RA 3IDAA 1LOAA 1FPN2 2WLQA 4NROA 2AEYA 4LKSA 2QZ2A 3MZHA 4PCRA 2VOVA 1BCXA 2DCYA 1GQHA 1RUG3 2JE7A 3USSA 4CXWA 1UOFA 4IEWA 2XR4A 1Y3TA 1AHSA 4KWLA 2KR2A 2V4VA 1AR83 1W2TA 2J1AA 3PUHA 1CESA 4NVPA 1O3SA 4AI8A 3CJIB 5CKMA 1O3RA 2XBO3 2EAKA 1EV12 5FBZA 3RYPA 1KGYA 4LBKA 4YM2A 1ND3A 1UAIA 4M3CE 2YBSA 4AVCA 1S0DA 5K8SA 2BWCA 2IXHA 3PUIA 1H4HA 3N7JA 5A80A 4OMDA 1BZWA 4RQPC 4C0HA 3TBDA 2OPKA 3O1VA 1IPSA 5JPMB 2A3YA 2WFPA 3R05A 2QVSB 1UX6A 2VOKA 1SLLA 4N43A 4AYUA 2A3WA 3WF3A 1WD4A 2BJSA 3ZR5A 1XSRA 1FV3A 2AYHA 3WHTA 4D7SA 4YW4A 1W3VA 3UGGA 5A1FA 5GLWA 1TE1B 4H3WA 2EIEA 1AYM1 3ZYJB 4CCMA 1NG0A 4O7XA 1CIYA 4LEJA 1LOGA 5FY1A 4D7YA 2WO7A 4CP9B 1W2AX 2ZABA 3EXUA 4FO9A 1SCSA 5FRAA 5GM0A 4HKOA 1A8DA 1NE6A 3AJYA 3K3OA 4QHZA 4BISA 3JD72 2DVAA 5EPAA 4FPOB 5BNNB 1DQ2A 4YW5A 3VDCA 4XVHA 1US2A 1UMZA 1REFA 1IG0A 3MICA 2ZHNA 5FQ0B 5JXIA 3FFZA 4L97A 3FMGA 5A32B 1C8M1 1NQDA 2BVBA 1H2NA 1DGRN 3FX3A 4E8DA 3QBQA 2ZZJA 3PVOA 1JYXA 4HONA 5LA0A 3K75B 4GJYA 3D0SA 3RZHA 4A4AA 4QB2A 3UT0A 4YW6A 5K9YA 1W39A 2W46A 1UQXA 1IGOA 2F4PA 4YW3A 1JYNA 2HWD1 4YNIA 1CONA 2VQ0A 4JGYB 3WY6A 5BNPA 5C5UA 3N9QA 2WWSA 3NNMA 3J8F1 3B02A 5JOWA 3P6BA 4CEWB 2K46A 5I0DA 3ZKYA 4AI9A 2ARAA 2VVFA 5GKAC 4HKLA 5CKQA 3EJKA 2CY6A 2R16A 3H8XA 2VPVA 1M4WA 4NIIA 4AQSA 4C1XA 5GALA 2XG3A 3AKTA 4LBQA 2VMCA 5D1IA 3RMYA 3QH6A 1OMIA 2Y33A 3WP6A 5CG9A 1R1A1 5FAXA 3MIEA 5A33A 2PXJA 4FVVA 5FZCA 2Q8CA 4NPLA 4LHLA 3VBUA 5LA2A 3DYPA 2JG8B 1W3XA 1CZVA 2VMDA 1DYPA 1OQEA 5BNPC 2PMWB 3RYKA 1GV9A 1MS5A 4LLFA 1EAH3 1R64A 2MNGA 2RG4A 5FY7A 1CAVB 2VUCA 4QPGA 3ZMNA 1TEIA 1IKQA 2OA2A 3AC0A 3E6DA 5FYUA 3SKVA 4XFFA 1MR5A 4HVOA 3WDYA 4AG4A 5C9AA 1I5PA 5FZ1A 1Z7S1 1PIV2 5FZEA 3WZ1A 1H1MA 1LAJA 4IGOA 1EUTA 1NT0A 3BPSA 2UWCA 3POYA 2P5BA 1ZBE2 2Y8KA 5DDJ1 5FXVA 5J36A 2XPJA 4YZ3A 3ATGA 5JSRA 2PAMA 4QXHA 3U14A 3PDQA 1RJ7A 1PNFA 3M1HA 3Q8EA 2O0OA 4KU8A 3ZDSA 5I0TA 1G9BA 1JHJA 2KXLA 3VD7A 1FOD1 2BV4A 1DP0A 3V0AB 3GDBA 4XJWA 5FPBA 3N9LA 4LO7A 1DZQA 2WZR3 2GC2A 2B45X 3CKHA 3PLQA 3K4AA 3RFRA 1B35B 2W87A 1UOJA 3V0BB 1RUC3 4NWWA 3ON7A 4J25A 2RR11 4IV1C 2WNUC 4LIVA 4XFBA 3T2PA 3WW2A 3MUY1 5FUNA 4ZKTB 2X10A 1L7RA 2RHPA 2RS32 3OYWA 4D69A 1XOYA 1YCIA 3LIHA 1UX7A 1D4VB 3LOIA 4BK4A 2HWC2 5A6XA 1YLLA 1K5MB 2JIJA 1LOFC 4LBLA 3ZIWA 2YYOA 3AZXA 3ZO0B 3CIHA 5DAPA 1SPPA 1W8WA 3ASIA 2BGOA 2LROA 2BP6A 3KV5A 4AEDB 4E2SA 2W47A 3GJAA 5FZ3A 4A2UA 2ZGOA 1UYYA 2B5HA 5C71A 4RL7A 5KXBA 1BXHA 3LDKA 4AVSA 2J42A 1XE8A 5DDJ3 4CP9A 2HEWF 4OI4A 1OA3A 2YMZA 1P8JA 1YC61 3K46A 5CG8A 5GZGA 2BU9A 2Q30A 4MV2A 1ND2C 1UZYA 1PM4A 1S0IA 3L2HA 3PL0A 2QQOA 1GR3A 1SDDB 1CR7A 5A3PA 5FO8B 1BVP1 1YXWA 3RQ0A 5AC91 3M3QA 1ULCA 4P9XA 2RM21 5FYCA 2XBO2 1QXRA 2BNMA 4XUPA 1RUE1 2ZZQA 1GZ9A 4YGCA 2CU5A 4QM8A 5LEKA 2P6CA 3T2TA 4BZ4A 1AR72 2IXCA 1VBB2 4CCEA 4HT1T 1CAWB 1GZTA 3FZ3A 1VBC1 4FFHA 4D3WA 5ABJC 4CUBA 4Q4Y3 3ME2A 2K0GA 4IEOA 2YDEA 3A7QA 4CCNA 4ES8A 1WBFA 1JH5A 4CRQA 4YW7A 5JXGA 2SBAA 1C8M3 2HWE2 5CVRA 2JENA 4ISQA 3P5BA 1O5UA 3C7OA 4CDXA 1NA1B 4UT5A 3LEMA 3IZOA 1REDA 2BQPA 4LT5A 3M3OA 3PVBB 5JLVA 3BPZA 3HEIA 3U11A 4ATEA 1FMD1 4MXWB 4CUAA 3TNQA 4LR4A 3BTZA 5FZOA 3I2KA 4CEWA 4FTBA 1DHKB 2C6SA 5C7GA 3RYRA 1OURA 2PHLA 2D98A 5A1LA 5KHJA 4FTSA 5FZKA 3ZXLA 4EZHA 1E5IA 3WDUA 3KV4A 1LOCA 4DXZA 4UYBA 3WDXA 1XYOA 4Q26A 2WYFA 2ZAAA 3BOPA 2B46X 1GOFA 4J6GA 5GJ6A 2CAUA 1ZRRA 1JN2P 2LTNA 4NRQA 2ERFA 5T5OA 4LK7A 3VBHB 1WMEA 1HN1A 5LATA 1O3QA 2GU9A 1AF9A 5H9SA 3OPTA 4IV3B 3V56A 4QHOA 4QKBA 4FP3A 1X50A 4NIHA 2A6WA 2DCTA 5IVCA 5HBAA 1EUUA 2A6XA 1Z0HA 2H0VA 3POJA 5HCFA 3AYDA 3TAYA 4HN0A 1Q5OA 1OF4A 1QNYA 2XB6C 2YB7A 2EXHA 1C1LA 3DUIA 5FV3A 4A41A 1B35A 3KSCA 5JMOA 4FSJA 1Y9QA 4Y3OA 2YXSA 4R8HA 2YG0A 4QX8A 5EWSA 1QJZA 2CSGA 2ZPXA 4Q1PA 3VZOA 3ELNA 4BU2A 4HL0A 4QX2A 3CMGA 5L7OA 4QB6A 2FZ1A 4YG6A 3OUIA 1OF3A 1RUJ2 3JBG3 2CAVA 4QAWA 1EAH2 3PUAA 1YEWA 3OBAA 3N9PA 2AZ5A 1HRV2 1S2BA 3RGBA 2PTMA 4FCAA 5IJRA 2JDPA 2ZHMA 1AYN1 4FQZA 3ZMOA 1SEFA 2HBTA 3RZZA 5C4WC 5DZGA 4CDUB 2WA3A 2VOTA 4UI9L 1RUOA 1GZCA 5KXEA 4TSVA 1ZRDA 2VQTA 4ET7A 1AL21 2PQSA 3PVEA 3J7MA 4NHYA 4Y1UA 4JGYC 4KBBA 4JTOA 4YVSC 3BIEA 4WZFA 4HZFA 4LE3A 4XUQA 5FMOL 3RZJA 1S4CA 3F95A 3I97A 3WNMA 3ENRA 1MVEA 1A34A 1KJLA 2XONA 2RJLA 4OI0A 3O1TA 1NAEA 1JW6A 2PLV1 1PGL2 4JDNA 2Y26A 1RVF3 1NLSA 4W50A 4XJAA 3SH3A 1JZ4A 3MIHA 1ULGA 1GSLA 1DYOA 4F83A 1YFXA 2D6MA 4AF9A 1WZXA 3ZFGA 1ZBA3 4I09A 4AEKA 5A33B 3RWNA 3TYJA 3TN91 2GMMA 4CDXB 1VBE3 3H0OA 2OXBA 4KL1A 5FO9B 2VULA 3CJIC 3JZVA 3WHUA 2WBKA 3APBA 2RDNA 2D40A 1TME1 3FBYA 1DZTA 4QQ2A 4BLIA 4DRVA 2JE9A 1QDCA 1RMU1 4JGYA 1QEXA 2IC1A 1YUDA 1W8FA 3P3PA 1HV1A 4QX5A 2HWF1 4Z1VA 4E27A 4Y20A 5IATA 1SPPB 3O0XA 4RR3C 4CU8A 1W9SA 1QJX3 4TN7A 2QQKA 1YFUA 3MUZ1 2B42B 2DURA 5KXDA 1N47A 3OEAA 1NXMA 4GJZA 2VVEA 4AFBA 4F8AA 3NNLA 1S55A 1QXPA 3J9SA 5DQ0A 2RS51 1PVC2 2XJRA 3WCSA 1S0JA 2YC4A 3HNBM 1WCSA 3C7FA 4QGMA 4HPKB 2NZ9A 1DGWX 2HEYF 1DLCA 1PO21 3GZUC 5A7QA 1O91A 4CU7A 3UETA 1AR73 1O4YA 1LULA 2XJQA 4ASMB 4ASKA 5FP8A 1YFYA 5CYYA 1SCRA 5FP3A 4P00B 2PELA 1RUF2 4PF1A 1VMJA 1YJKA 2DBNA 3KHCA 2OT7A 1BBT1 3THTA 2DCZA 4N53B 3RZLA 1RHI1 2Y6JA 4LO6B 4MX3A 5FZ7A 3RJ2X 4XHXA 1O4ZA 2H6CA 4PIYA 2VCMA 1G6NA 1DU3D 3AMQA 4Q0VA 3SLIA 3BI3A 1WCKA 4JX0A 2D6PA 4Y5TA 4YSFA 3FUOA 5JDBA 4GB31 3VHPA 1V6KA 4E4HA 1GQPA 1UU4A 3VZMA 1RUI2 1V6NA 2YUEA 4IE6A 2Z2SB 5DPNA 1OOPB 2A5ZA 1TZOA 1WA4A 3N7LA 4MXWA 2I45A 2R073 5FY5A 3BIWE 1PM7A 5C70A 1I3HA 5FZLA 3VZNA 3LSDA 3Q8BA 4GMP3 3RVHA 4LO4B 4YLZA 2AH2A 4QD2A 2DWRA 3ES1A 3VL9A 4PHZA 4G3YC 4Y1ZA 2IVIB 1V6JA 4NIGA 2W1WA 1ODMA 3MW4A 1GU3A 4HFSA 2PHXA 4ZPIA 3B9CA 2VNRA 5FY8A 2VZTA 3T30A 4UFLA 3J4UH 5KHKA 3FJSA 3VBFA 2ZHLA 1TVGA 4MGZE 3VZJA 1MS1A 1Z78A 1HXS2 3LD8A 2VW2A 3GBFA 3PURA 2VZVA 1VBD2 5J98B 2GNDA 4DRRA 1W8OA 1SMVA 3KWVA 1COV3 2R041 4CSWA 4BCUA 1ST8A 2DCKA 3FLPA 1UIKA 1SLAA 4LA2A 1MZFA 4WVZA 3VHOA 5BNOA 5F3CA 2CGPA 1LU2A 1PX4A 3DF0A 3ZXFA 5DXDA 4IW3A 5I0UA 4XIOA 2LALA 1OH3A 2A75A 4HK9A 4CA9A 1I9RA 3ACHA 1J3PA 2XQRA 4R4ZA 2GN3A 4CDQB 1JYCA 1FT9A 1Y9MA 3IAQA 4ZXEA 5AFEA 5FK7A 5FZ8A 3FHQA 3W5MA 5IVVA 4QX3A 1QY4A 2ZS6B 4COVA 1WLWA 4IGQA 2WSUA 5LEJA 1JU4A 4OZOA 1LGBA 4QKDA 2VO5A 2OUJA 3KQRA 3WW1A 4RFT0 5FJKA 2XVLA 1L7QA 3MPBA 4BQ1A 3I3EA 4AHWA 1NUKA 4FOQA 3OGJA 3SXWA 2Y6KA 5JIUA 4WM7A 4Y20B 3WEZA 5C4WA 4TYSA 3I49A 1OQ1A 5LY1A 1MS0A 4IEQA 5APAA 3LA7A 5ANNA 4CYDA 3O1SA 1W6PB 1X82A 1O6UA 2KD7A 4MLOA 2Y6LA 4H14A 2UWAA 3CEWA 1CAUB 4Q2FA 2QJVA 1F5JA 5LW9A 4B4RA 3AL5A 3J26N 2EXIA 3VBHC 5KHHA 1AR92 1RTVA 2GH2A 2XJTA 4XC9A 2BBAA 2GH8A 4CU6A 1AXYA 3OY8A 3LEKA 1E5SA 4GQ7A 4HG6B 5JR7B 4PQQA 1RUD3 5I8YA 1QJX1 2GALA 5LA1A 1UIJA 5EP9A 2B39A 1S0FA 1JZ8A 1OLME 2E7AA 4R4XA 1JBCA 5IK8A 2WWJA 3BALA 1UKRA 1LHOA 1HW5A 2VOXA 1XXNA 4BQXA 2J1TA 1SDWA 3IIIA 3OSDA 3PU8A 1POV0 1ZBA2 1H2KA 1VBA3 4YVWA 3HT2A 4MXVA 1VBE2 3OJBA 3B00A 2A7AA 3ZXGA 2D44A 2I2SA 3VZKA 4Y1YA 3WQ0A 1F9KA 1RUC1 3LEIA 5G05L 4AXOA 1F4AA 1V9U1 2E7QA 1YHFA 5FPAA 1AZDA 1LOBA 3M3IA 1CZTA 1ZVFA 1QGLA 2O14A 2BBVA 5LCWL 2P3YA 1AR62 2GP3A 3A0KA 4QPIA 4A3ZA 4OZXA 5F7UA 1W6PA 4I0WB 2P17A 3NJVA 4ZXKA 1UU6A 4EWEA 2XOMA 5AFBA 2ORXA 1LR5A 4YGBA 1WMDA 2QQMA 1QDOA 5IAXA 4LQRA 3NKTA 5ACA1 3RNSA 5IK7A 4N53C 1RXFA 3ZSLA 2D3SA 2D6LX 2BNNA 4ORFA 4XJ9A 3CHXA 2VMIA 4KG8A 4KG0A 4RHV3 4N7UA 3OD0A 1I6XA 4UFMA 1H1AA 2QQWA 1OVSA 4FXGB 3FHAA 4NHXA 3CQOA 3H7JA 4QPYA 3ZFGC 4AK3A 3Q8AA 5CIRA 5HCAA 2FDHA 3LE0A 3HOBA 4ZU4A 2YFUA 4DY3A 4XCAA 4EROA 1GNZA 1N1TA 4NR1A 3PTRB 2CHHA 3VBSA 5F6LB 2WS93 2XJVA 3E5XA 1BVVA 3UYJA 2UYAA 3KLSA 5CFCB 1UO9A 2R061 1UU5A 2E53A 2BUKA 5FMDA 4V1PA 1QJU2 1HQLA 4XUNA 2ES3A 2UYBA 2BNOA 1SFPA 5A3TA 4AFMA 3WNLA 4P02B 2J1EA 1BHGA 1AYM2 1JZ5A 2R072 3MIGA 1FV2A 4MGKE 3LOBA 1U5XA 4ITCA 2Z79A 3AMNA 5F8PA 3WCRA 1YWKA 3T4HB 2X29A 3Q8CA 4XHBA 3OUJA 1OC1A 4PI2A 2WNEA 4TXWA 2QDRA 5GLZA 5J3UA 4M0NA 3VB9A 4BYYA 5LK5A 2FQPA 4XZUG 4D0QA 2VE1A 3VBOA 4SLIA 3ZFFC 3IDCB 1HXS3 3SQOA 1AX0A 4Y1VA 3POWA 5A7WA 2HLEA 5GLUA 4MSVA 4TTGA 4DMIA 2ZX1A 1VAKA 1KDMA 1COV2 1QJY1 3DYMA 4DB5A 4K20A 2C4XA 1YYNA 2BVVA 3SCHA 1QIQA 1S2EA 4QX1A 4YM3A 3HBKA 1V0AA 4N43C 2AEZA 3FLRA 2WAAA 3J8F2 4GD4A 2NMNA 2XMLA 4M3CF 5A70A 1HIXA 1AR81 3DEMA 2CYFA 3LKJA 4RR3A 3MW2A 1FYUA 3H3UA 3M8LA 4BQ5A 4FI9A 2ET7A 2ZEXA 5FYSA 3AL6A 3KD4A 4QKNA 2HH9A 4URAA 2GNMA 1NKGA 4RSUA 1U5ZA 4Z2WA 5FTTC 3BCWA 3DXUA 4XF0A 4ZU5A 4DXTA 1PZ8A 1XB9A 4V2WA 1UW8A 4EN7B 1Q8SA 2YGMA 3R4UA 3RZGA 5A7PA 1UYXA 2QCSB 3C7EA 3NWKA 4YVSA 2C0ZA 1DQ4A 1HB2A 1ND2B 2ZX0A 4JGZA 5M0TA 5EHDA 2UU8A 2VXRA 4L11A 2ZGPA 4YGDA 1W9TA 2QQNA 3NKGA 4AAXA 2YV8A 5FZDA 5LBCA 2VZOA 2VGDA 3ZPOA 1V70A 4OI2A 4L8QA 1J59A 1PIV1 1YQ6A 3ZDVA 1MACA 1YQCA 4XPVA 1CWPA 1YIFA 1IS5A 1C3HA 3NNFA 5L9VA 2UWBA 2HWB2 2FDKA 3C3VA 1NZCA 4QDQA 3TEXA 1VBA2 1EY2A 2AR6A 2PLV3 4RGGA 3A22A 5FIXA 2ZGRA 3BVCA 3N9MA 3H3LA 4A42A 4W6YA 2CL2A 4AHYA 2Q1FA 1XE7A 2RR12 2EIDA 4X6QB 5C33A 2DUOA 5IVJA 1C57A 4LKEA 3KT1A 5FP4A 2RS31 5HXVA 3LA2A 1U5IA 1ULFA 2FCVA 1AR63 2HYKA 3W21A 2HWC1 1JI6A 1FX5A 3OGGA 1KFUL 1X36A 4YVSB 2VJXA 5A3OA 3THDA 2JG9B 4Q0QA 4AAPA 3MLLA 4A7ZA 2B4KA 3K3NA 1SLIA 4URTA 3CF6E 2EF6A 4COYA 4I3PA 4QPGC 3NNJA 4R9BA 1K42A 4DO0A 1H9PA 3I3DA 3SEPA 4RFRB 5IYYA 4I02A 4FAHA 1CJDA 3MLJA 3B01A 2PHUA 5E16A 3KF3A 3KGLA 2W92A 5EFUA 2LS6A 2XJSA 4M01A 1KS4A 4XFIA 1LEMA 2XBO1 1BEV3 2VTFA 1RUE2 3EO6A 4HBNA 4KQ7A 4UXAA 4XXAA 2D43A 5F5QA 4OI1A 3C2UA 1XU1A 1AR71 3VV1A 3J7HA 2J1VA 1KDKA 1VBB1 1Y4WA 5FYHA 1NCQC 1RXGA 5BNPB 3OBZA 2FDFA 1GOHA 2FDGA 1WW6A 3TB0A 1GWLA 1OI6A 1OUSA 1K12A 2QQVA 1ZZBA 2WNUA 4OUMA 4AGGA 1UF2C 1C4RA 4R9DA 3ZPYA 1LU1A 4B1LA 3MBWA 2DTYA 4EV0A 3J7NA 2HWE1 1HRI3 2DVGA 3WW4A 1QHDA 1AYM3 5FZ4A 3THCA 1R091 2RVAA 1PZ9A 5FYBA 4F7ZA 5FLHA 2Q8OA 1HB3A 1W6QA 2VCAA 3AVRA 4XABA 5BNNC 5F6KA 5CADA 2JB8A 1ULEA 4YZ5A 3BGAA 3JB4C 3IMNA 5FZOB 5F5AA 4EN8B 4LE4A 1GMMA 3WNPA 4N9HA 4XJUA 2OIIA 4HK8A 1DBNA 1H6XA 5JWPA 1VALA 3LIGA 1DYKA 2X8KA 5EIYB 1VMHA 1T2XA 3D4KA 3V0AA 3INAA 4QQPA 1K45A 2A73B 4Q4X2 2XLFA 4FPEA 4AI0A 2GDFA 2B9VA 3IIAA 5TSWA 2ARCA 2JIGA 2QBXA 4MGIE 5E1RA 2FBEA 3KM5A 3KF5A 4AGRA 5BNNA 3E6BA 2CDPA 5F32A 1UMIA 2JDHA 4DY5A 1D2QA 1QU0A 1A78A 3CJXA 4RYDA 5EV7A 3SNMA 3WQ7A 3WR0A 4DIQA 5JZGC 5FDBA 2XKPA 5FYVA 4FPJA 4OFGA 5D8AA 2G9GA 3POBA 3USUA 1AX1A 1FI2A 4AI2A 1LKNA 1Q8PA 1X7NA 2JECA 4A7KA 2HWD2 5BNQA 3FHIB 1KQRA 5HPOA 1LCLA 3ZXKA 1ZBE3 3X29B 1JYVA 3S57A 1ZA7A 4XE9A 2PHWA 2P2KA 4IEYA 4JHZA 1O7FA 4COZA 2QUOA 1G9AA 2ZHKA 1NA1A 3QCWA 4JQRA 5DAXA 4JZRA 3JXSA 5JZGA 2A6VA 4ISRA 5F5IA 3HQRA 4IL7A 4Z92B 2WZR2 4AL9A 1JU3A 4A45A 4CCLA 2WIIB 3CL1A 3VBOB 3DN7A 4L2NA 2BFUS 4IETA 1HRV1 2RMU3 2XVGA 3IKWA 5CFDA 3WNKA 4DXRA 5CKNA 4PDWB 1CAWA 3Q9OA 4RA0A 2YC2A 4MZUA 3ACLA 3AMPA 3K77A 3MW3A 1J3RA 2HWC3 5DG1A 3WF1A 1W6OA 5F2SA 4XFHA 3RSJA 4WVVA 4OCTA 3N9NA 2VZRA 4BHPA 1RC6A 3D82A 5C6CA 3MIDA 2WQ8A 4KMQA 1HLCA 2YBPA 1GKBA 3VD4A 5JI7A 1IS3A 5A3MA 5A3NA 2PLV2 1PGL1 2DVDA 3T1LA 4GWIA 3AKRA 3P3NA 3N4MA 4FOVA 1YJLA 1ZBE1 2ZEWA 5DDJ2 2VTXJ 1XQNA 2QQIA 3TOJA 4O61A 1D2SA 5A7SA 2RR13 1RL3A 2P3IA 3D0JA 3VKNA 5JUVA 1UY0A 3I8TA 4N90A 4Y1XA 4XXPA 4W6XA 4K7JA 1LJ7A 1BMV2 5C3PA 2ZMLA 5DUVA 4NJ4A 1RMU2 4JDMA 1YNAA 2SLIA 4AQ2A 3H8UA 1VBB3 2W5FA 4UF0B 1XNDA 2G9ZA 2BEOA 2ZMNA 2F6BA 2PHFA 2JX9A 3JU9A 4XAAA 4B1MA 1I1EA 5GZDA 2IXLA 1ASJ1 2XWJB 2VMFA 4Q4Y2 1NCRA 3ILFA 4A7YA 2Q4SA 2W91A 4L0PA 4BWOA 1HDKA 1C1FA 4YFWA 3O7OA 2VMEA 3H1WA 4OHWA 1GP4A 4TLGA 4Y22B 5FK8A 3KV6A 4JRLA 1HRI1 5I0SA 3NAPC 4CVUA 5IUQA 5FZIA 4RR3B 5A3LA 3I2IA 1W8UA 5J1XA 3JBG1 3EYPA 2K9ZA 1RUE3 3H50A 5C3QA 1WMXA 2YGLA 2EICA 4LLOA 4GWMA 5G04L 3LFIA 3O1RA 2RJKA 4Q0PA 4CDQC 1OPOA 1VIWB 4K8RB 4Q4W2 4HETA 5AC92 2D3PA 2WLPA 4PDWC 1W2NA 4W4ZA 3ZFFB 2OUHA 2RM22 2TUNA 1IS4A 3AZYA 1UZ0A 1AJOA 4H2AA 3AZZA 1RUF1 4GZ9A 1MQTA 4A6SA 3L2YA 4CCDA 3HPNA 1AL23 2VBDA 4GKXA 4XUOA 5CZKA 2AACA 1ND3B 1MS3A 2CDOA 2VC9A 4MGQA 3K2OA 1D7PM 1NY71 1ZYBA 2VY0A 2VQAA 3LSEA 2N7GA 2O8QA 3AFGA 4JVAA 4KH9A 4NHKA 2QQUA 5FFOC 4H7MA 2EVXA 4Y5Z0 1N1YA 2ZJCA 3WP4A 1K5JA 3LB9A 1BK0A 2W94A 4MGYE 5T3NA 4BA6A 4MOAA 1KFXL 2WJSA 4MADA 2D3RA 1E5RA 5CAZA 2PN5A 3LWCA 2W1UA 2QZ3A 3HAGA 3EQEA 3ZFGB 3VBRA 3WW3A 1IHMA 3N7MA 3DCQA 4I0BA 4MUVA 3VGIA 4NN0A 2VU9A 1TMF3 1LOFA 2EIBA 1J1LA 5FPXA 1VRH1 4M3CA 2WUHA 3LFMA 1UY4A 1DIWA 2XLAA 1W6NB 5LBBA 4KWKA 1GANA 1E57A 5JOZA 4M4PA 1QQP3 1GLHA 5ERLA 1NQJA 2OQ7A 2W1QA 2VZSA 4GIQA 2JDMA 1QH6A 1SG3A 4ONUA 4CTEA 1HXS1 1HKDA 1IQDC 4HXCA 4IUGA 2WNVA 4JV4A 1RUJ3 2XJUA 3GZAA 2R6QA 3UV9A 4YARA 1QJY3 1Q43A 1YO8A 3MGUA 1ZZ6A 4IE5A 5BXXA 3MFCA 3VD9A 1LB2A 5KXCA 1JODA 1HRV3 2DF7A 1O4TA 2RMU1 1OKQA 2VVDA 2GNBA 3DL3A 3RG0A 4BXSV 2ADDA 2B9UA 4P5HA 3ETPA 1OLQA 5FZAA 4BMEA 2V5YA 2ZBJA 1MVQA 2FHRA 2HWD3 2RS11 2JICA 4FPYA 2DBIA 1KXGA 3C7HA 1ZRCA 3DPRC 1XYNA 2YZ4A 1UL9A 4ARXA 4CU9A 4E4SA 3SKJE 3QLQA 3OUHA 4UFHA 1XPWA 3IPVA 2WNUB 4G4FA 2RV9A 2XDVA 3GCXA 5BV6A 1MEC3 4QPIC 1RHI3 2PFWA 4PF5A 5EJZB 2YROA 3O5SA 4WM8C 5EYXA 4BQ4A 1G8WA 2WZEA 1UCXA 3ORJA 4UAPA 4CDXC 5C3SA 5T50A 5I8TA 3RZMA 1DQ6A 1N1SA 5GZFA 5E6HA 2C1FA 1VBC3 3KHBA 4CEYA 3POFA 1G9FA 1D0HA 1XNCA 4QQOA 1W2UA 2JDZA 4ATFA 4PQ9A 2A1XA 2VH9A 1RB8G 1MS4A 1EAH1 1IPKA 1W6OB 4XIKA 5EXOA 1RINA 5FO7B 2MEV1 1NLRA 1ONAA 4N53A 4YZ2A 5A1AA 2OS2A 1QOOA 1XC6A 1AYN2 2PAKA 3MIFA 3GHMA 5FMOS 1QJX2 3B69A 4CP2A 4DS0A 2DUPA 4Y5SA 3DGTA 3B93A 3LAGA 3ACGA 4Y24A 5D2AA 5F3IA 3USUB 4AQTA 1FMD3 1OSGA 1HQNA 4BM8A 4W65A 1UKGA 1V6OA 1UN1A 5FMCA 3H42B 5B2GB 4PI0A 4ZS2A 5FYIA 1YQ5A 4AEJA 3WX5A 3AP6A 5JPNB 2ETEA 4YGEA 5K7PA 1W9FA 4YZ4A 5H9QA 3VBSC 1PVC3 3GYDA 2ZX4A 4J1WA 5FZHA 3UGFA 3ZR6A 1PX3A 5A6QA 2AGSA 2XUMA 1QJEA 4MO3M 5T54A 4QT6A 3UJQA 2WABA 2GC3A 4IXLA 4XF4A 4XDPA 3WNXA 4BOWA 4HMZA 1H8TC 1RMU3 4IE7A 4BDVB 3ILNA 4JKKA 3ZSMA 1NLQA 1NCRC 1V6LA 3AKSA 2PQQA 1AR61 3E5QA 3POEA 2A6YA 2RJ2A 3KZ4C 3ZLIA 4Z8BA 1JUIA 1RUF3 3FWEA 2FCUA 3RWKX 4K40A 3H1YA 1U5YA 2AC1A 2RE9A 1U12A 5FP7A 1A8MA 2V5DA 1GYKA 4OULA 4YYOA 2VBPA 2G9FA 3TEZA 3I7DA 5FY9A 2ZX3A 2PHDA 2MPFA 4CDQA 2Y60A 1NCQA 3F2ZA 3M4FA 4YG3A 2D6KA 1GQGA 3ITQA 3U10A 1M06G 4WM8B 4BQ3A 3CDZB 2Y0IA 3ZSEA 2IUWA 2ZGUA 3FC0A 4CDWB 2VW0A 5CFDB 1UOBA 2R1DA 3O1PA 2QQLA 4Q4W3 3IBMA 1PGW2 1MS9A 3PIJA 4LHSA 5J09A 1XBFA 5IVFA 2GMPA 2RM23 1TMF1 5GZEA 4BIFA 3HBZA 2VZPA 1RUH1 4P9YA 5F3EA 3VN4A 1YI7A 3NNGA 2GN7A 2WYSA 4AW7A 3AX4A 4IGPA 1RIRA 2DCJA 1F2NA 2ZMKA 3WUDA 1VB4A 3WQBA 1CVNA 2IXKA 4ZZ5A 2LRPA 4UFJA 4XQ4A 3U07A 1HJGA 1WMFA 2R062 1LGNA 4JTNA 4LOSA 3PHMA 1WLCA 2W68A 4UW4A 2ZEYA 1S0CA 1LGCA 3W58A 2ORZA 2QE3A 1VBD3 4MHRA 4Q4V1 3WD5A 2GMEA 3AMHA 2WQZC 5T52A 1OD5A 1PGSA 5H9PA 1Y43B 4XF1A 4UWDA 5BPXA 4DPNA 3ZVXA 2HJIA 3GXUA 4RQPA 1AUYA 5E88A 3PIGA 4LIUA 2JKBA 3MDPA 2ZX2A 4OQ9A 1VAMA 1RVF1 5D21A 4E9KA 1V6IA 4GB32 4N8MA 5DUWA 3KT4A 3S0MA 1RUG1 3AK0A 1RUI1 2JDYA 1H8TB 2D97A 2XL9A 1JYTA 2VNGA 2XUEA 5C8CB 2WO2A 4UF0A 3E5UA 1QQP2 3MV11 1POV1 1W6MA 4NWVA 1NYWA 4XTMA 3BU0A 3AB0A 4LUMA 1NCRB 2Q8DA 4YVWB 2XGXA 3VKMA 2J1RA 4X8NA 4JCKA 3CZUA 5T5LA 4R9CA 4UBGA 4BIOA 2HWF3 4C8DA 1COV1 1QJY2 4TZDA 1R081 2C9KA 4GH4B 1Q3EA 3KCYA 1W28A 1K5MA 2X5IB 5DAVA 5CISA 3FFQA 4XBQA 2ZAHA 3UESA 4RS5C 1KD7A 2JXAA 4F3JA 1RYYA 1ZM1A 4ZU7A 5FPUA 1IKPA 3U4XA 1VBD1 4Q4V3 5A3WA 1W90A 5SV8A 2BW8A 4Y4YA 4BQYA 4OVEA 4OHYA 2LM3A 4NUBA 4Q8KA 3V0BA 3VL8A 2ZA9A 3PMEA 3KQ4B 3H9AA 4B4QA 2D6OX 1N1VA 5FP9A 5L9BA 2ILMA 3LDBA 1C5HA 3RMXA 1RUD2 4X6RB 2D6NA 3PTYA 1W8ZA 4UW6A 3WLUA 5CFCA 1X8EA 3I3MA 4LNVA 2BGPA 1MEC2 5L73A 3NW4A 2J7MA 2FZ2A 1ENSA 1D0GA 1QOSA 2C5DA 2WS91 1CJPA 4S2FA 4UOJA 3BODA 4RS5A 4BK5A 1POV3 2KM2A 3NV1A 4GXLA 3OBTA 3S6PA 2QDNA 3PUSA 3R0RA 1R1ZA 2P1BA 4XDOA 1RJ8A 1SLTA 1W6MB 3JB8A 1MPXA 4S2HA 4XURA 3IMMA 1D4M1 1W6NA 3AZVA 3N7KA 1F8VA 2H6BA 4CZSA 1PO11 4FPGA 3N36A 4WVMB 2ZOEB 3AMMA 2E26A 2ZKNA 3H3ZA 4GH4A 2JDKA 5FXXA 1AXZA 1ENXA 1MQTC 1AYN3 3LA3A 3AP4A 4NPRA 4O65A 2FDIA 4JRAA 2VZ3A 1OH4A 3NSTA 4FPHA 2F4LA 2VL4A 1TG7A 2WFF2 2WNOA 4YZ1A 2QQPA 4E2QA 3G6JB 4XW3A 4DNYA 4YW1A 3WINE 3BTXA 5FZ9A 1AR91 1AJKA 1DLLA 2YPDA 4TLFA 4AR2A 4LBQB 1XNAA 3WQ1A 4RD7A 4HSJA 3ZYHA 1NZIA 1SLBA 2EIGA 4GALA 3T0AA 1WD3A 3HN1A 4NOTA 3DV8A 2RDSA 5DABA 1R1A3 2RDRA 2Z4FA 4P9IA 3LDRA 4GWNA 1JS9A 4H55A 5JSPA 2NPIA 4LBNA 3HNMA 2ZGMA 3IPVB 2GZWA 2YFZA 3ZSJA 4RHV2 4LBJA 2KA3A 2ZEZA 2WR9A 3IDBB 2ATFA 4FP2A 4IE4A 2BWAA 2W1SA 1UOGA 3HJRA 2IFRA 2R043 1PO13 4XUTA 2E32A 2NM1A 5HI0A 4XETA 4WV8A 5LB6A 1TQ5A 2X09A 5FLJA 4DFSA 2ET1A 1WLTA 1SQ4A 4UW5A 3PJQA 3B5LB 5DUUA 1Z7S3 3MF9A 3O1MA 3WF4A 3N9OA 1REEA 2YC0A 3I4IA 4QX0A 5E8AA 1OOPC 1QJU3 2WA4A 1VAVA 3WP3A 3HQUA 5J7MA 5IFTA 5JCTA 5A7WB 3RI9A 2WQ4A 4TWTA 4UFKA 3NVCA 4QXBA 4DEVA 3BB6A 5CB7A 5JOYA 4YPJA 1LODA 3A4UA 2JD9A 5CBLA 1OHFA 3G7DA 4XAEA 4Y33A 4HANA 3VBHA 2PAEA 3DPRA 2EXJA 4M00A 2WL1A 2LUWA 5A6ZA 1MZ6A 1VB2A 3FN9A 3OYWB 5I93A 1ZZ7A 3ZYBA 2ID4A 5JSOA 2BERA 5D8AC 4NE9A 3ZYIB 4LK6A 3KMHA 1OBNA 3U37A 2R063 1ND2A 4AVTA 1NCQB 4QMAA 3WG3A 2ZGQA 4HSLA 1WUVA 3UL2A 1YRZA 1J83A 4YVWC 1XNBA 5FWJA 1R092 3S5AA 5BYNA 5L19A 3T09A 4COUA 3LZZA 2DUQA 5C3OA 4MH0E 1UXZA 4LBMA 1ENQA 1NA1C 1GZWB 4GB33 5LRSA 3BU7A 4Q1RA 5ABJA 2X5IA 4XBLA 1WW5A 3J8F3 4V2VA 5LBFA 4EQVA 3TWIA 1UZVA 2XLGA 5HCBA 2DVFA 3SH4A 4PIZA 3URFA 2NN8A 5FY0A 3ZM8A 2J1UA 1VRH3 2D93A 1C5IA 2Q8EA 3ZN6B 3UNPA 4Q4X1 1PNGA 4XACA 3LPFA 4QX7A 3TEWA 1WCDJ 3FL7A 4LPLA 3VKLA 2BTVC 1MZ5A 1JOJA 4MGTA 2ZKLA 1N3QA 2WC2A 2DFCA 3JQWA 4X8PA 5FOJB 3BTYA 1IS6A 1WWYA 1XU2A 5IK4A 4CDWC 4XFCA 3GGLA 2CWMA 4LXLA 4E8CA 4MVTA 5FZGA 4CEWC 2PHRA 3EB7A 3I3BA 5H9RA 4QQHA 4BQ2A 5KHIA 1MZEA 2CNAA 3CNAA 1EPWA 2MHFA 3I2HA 5EJ1B 2QTWB 1OUXA 4QWNA 2P3JA 3O14A 2HBUA 3VBUC 3NL1A 3ALQA 1FPN3 4KGGA 4HLTA 4NIDA 3PVNA 1CD3G 1W9YA 1XNKA 2EA7A 4L99A 3WOGA 3DKWA 4HPKA 2TNFA 2CTVA 1AR82 1X9TA 4LTAA 4LKFA 3A21A 3WXPA 3E1F1 1W04A 1H6YA 3RDIA 4XDQA 5FXZA 1EV13 3AKPA 3DECA 4P5YA 4CDWA 5SV5A 1N3OA 3NAPB 3VD5A 2XKOA 4JGZB 4FTEA 3OCPA 1YI9A 3CO2A 5BNOC 5FYTA 2YU2A 5FREA 4I0AA 5KWRA 4AI1A 4HKWA 3MF6A 2XHKA 3ZSKA 2ZGNA 4XYXA 1ODNA 2DDUA 3HR9A 2Y6FA 1LECA 1HB4A 3U75A 3K48A 2E63A 4LULA 3LF7A 3H8OA 3HD8B 1GP5A 4FFFA 1LNSA 1SBEA 4PJYA 2CWSA 2ZGKA 3IM0A 1J1TA 3AXDA 3PNAA 4AFCA 3RJRA 1STMA 3V64A 4CDUC 5F1RA 1WW4A 3VDAA 3MLKA 5JXHA 3ZYRA 3ZFEC 3T3YA 3W5NA 4PDWA 3ES4A 3IDEA 1MS8A 2VW1A 3C8XA 3RRDA 1F15A 3THPA 3I59B 3IAPA 2W39A 3MFAA 3K51A 1IPJA 1R1A2 3JD73 4CXXA 2BPA2 4N43B 5DUXA 1JZ2A 2OYZA 5GLTA 2F17A 4K1YA 5C8CA 1UYPA 2XHNA 4XMIA 3LPGA 4QPGB 5DN2A 4ZY9A 4ZZ8A 4C1WA 1BEV2 1WKYA 2BZDA 2BDRA 1ZZCA 5IW0A 3WDWA 4CDUA 1I5ZA 3WNNA 4MG2A 4LBQD 3T0BA 3UK9A 1AXKA 5FZ0A 2WINB 1OOPA 2XWBB 4JAAA 5DZFA 5F5CA 4U36A 3VBUB 3VBRC 2JJ6A 3WNOA 2A6ZA 1Z7S2 4P9JA 4Q4Y1 4Q27A 2PYTA 2Z42A 4KNCA 4Y22A 3NV3A 3AM2A 3TEYA 3H1MA 1F35A 3CJIA 1PMJX 4E4ZA 5LK7B 2R32A 3FLTA 5DAWA 5L9RA 1ULPA 2JG9A 4DUXA 1HRI2 4XEZA 3GHNA 5KBFA 4EN0A 3T4VA 2VAUA 3ZN6A 4A6OA 4FXKB 4NMIA 4DUWA 2JB4A 3ETQA 3U1XA 2EXKA 1DDLA 1UY2A 1SACA 4QXCA 4GULA 2FMYA 5A6YA 5IFPA 3DXTA 2WRAA 3VDDB 2C9AA 5J48A 4FPKA 3TN93 2VTXA 5ABJB 5IWFA 1S0BA 3RZKA 4QGNA 4CUGA 2D7FA 5CA6A 5EYYA 1UYZA 1OVPA 5AVPA 1CN1A 2VCCA 3NV2A 1WCQA 1X33A 4EN9B 4Q4X3 4Z82A 3JCIA 1EYBA 1J84A 4XTPA 1F4HA 3SEEA 2YPJA 2X53S 4CCJA 5F3GA 4E2GA 1PIV3 1R093 4GMP0 2WWUA 5IVYA 3ZXEA 5JMCA 2X5IC 5LZ6A 3I2FA 1YQ2A 1GWMA 1KITA 2ZCWA 3VHRA 4LORA 4AQ6A 3ABZA 1DGLA 1ZZ8A 2YHJA 3BKZA 4BMBA 1NOVA 1Y9GA 5J37A 3ZXJA 1PMIA 2IZWA 3NAPA 1FPN1 1VRH2 2WT0A 2R0HA 1SFYA 1O3TA 5FJHA 4IEZA 1S0GA 3IWZA 2QKDA 4G9SB 3AYAA 3W59A 3SMHA 1ZRIA 3MHZA 1W8TA 4NIAA 2JDAA 4JKLA 1LEDA 2A3XA 1A3KA 1OD3A 1UPSA 1EV11 2D5HA 4K1ZA 3VBRB 2BGCA 3ZOIA 1CAVA 1LOEA 1BBT3 1CAXA 4FPFA 2JD4A 4WVWA 2QQJA 2XQXA 3O1UA 2C26A 3M7AA 3V65A 5LRRA 1GICA 2IXJA 3OTFA 1W9WA 2RMU2 3HMYA 3ILRA 1UMHA 4I3GA 1PVXA 4K6BA 4S2DA 4Y4RA 4D6QA 2BOIA 1LRHA 1O8SA 2V4AA 4FAGA 2Q0AA 1O8PA 2C24A 1ZREA 1RITA 1OQDA 4FFGA 4ZONA 3ZFFA 4BE3A 1ZZ9A 2A71A 1KRIA 3ZXAC 4K8FA 4AWDA 2Y6HA 4DINB 4BJ0A 3M3CA 3SCGA 4YM1A 2P4EA 4GH4C 2JWPA 1XJAA 4PLMA 4FBFA 3B3QE 4PBPA 4DOUA 3JD71 5KHGA 2WSVA 4XQWA 1ALYA 1OA4A 5GZCA 3WDTA 3OG2A 5J96B 3TNPB 3AP7A 5K0UB 3POIA 2GSYA 2VUJA 3N3HA 3WG4A 2EAAA 5JI9A 4XMAA 5ANQA 1QF3A 2QFEA 1C8M2 2HWE3 1TNFA 2WZR1 1CAXB 3QACA 3AVSA 1UZWA 3ZFEA 5FZFA 4P08A 4R52A 2ZTNA 2VMHA 3P1IA 4UW3A 1W0NA 2WZPP 4OHZA 1HQWA 2ZXQA 4I01A 3WF2A 3HT1A 4PLOA 4B3NA 3KCCA 3BTAA 4FQ4A 5I91A 3OGVA 1QKQA 2DYCA 5BY5A 2MEV3 1FAYA 2P3KA 5AVAA 1IG3A 4L92A 3SITA 4IV3A 2Y6GA 2VD7A 5F9TA 1YIPA 1IOAA 5DMYA 2OZ6A 1SHWB 4NHLA 1LTEA 1OLMA 2JKXA 4OUSA 1JYWA 4MYEA 2ZACA 4B4PA 3JQXA 3N35A 2Y64A 1Q8VA 5JVVA 5I0RA 1GNYA 1W0OA 4NPMA 4P9WA 5AC93 5FOBB 5HXMA 1GOGA 4FFIA 1BMV1 5K0UA 4I30A 1WCUA 1GBGA 3HQXA 4P9LA 2WN2A 5FPVA 3OPZA 3RS6A 5EZWA 3DPRB 4PT6A 2HKXA 2YY1A 2Z5WA 4QB1A 4CEYC 2E51A 1AL22 3K4ZA 1H9WA 2IVJA 2NLRA 2NMOA 3KT7A 4OMCA 3SH5A 1JYIA 3WUCA 2AREA 1DQ0A 2GC0A 4UBHA 2VZUA 4GAZA 4P9GA 5A7NA 4CPBD 1F5FA 1HB1A 3A0NA 3D5OA 3VZLA 4DZGA 1F31A 4D8MA 4QU2A 1ASJ2 3IT8A 1VP6A 4QDRA 5B4XA 3MIBA 2WDBA 2O1QA 4JDOA 3O12A 1QNWA 2XL7A 2IXIA 5FBJA 5K0UC 3TN92 1PGW1 3PUQA 4IDZA 4CCCA 3T0DA 1FOD2 3H7YA 1GZWA 1TMF2 2NYYA 3JBG2 1RUH2 2PA7A 5FZBA 3AKQA 2VXJA 3GBGA 1QH7A 5T55A 3S5QA 4LITA 2G19A 3MEPA 4YRDA 3OPWA 4XILA 3HVDA 4Q4W1 4XQDA 4AVAA 4D94A 3GF6A 1LESA 3LQCA 4O9EA 3MI8A 4EN6B 4LUKA 5HCHA 2Q1ZB 5CNAA 3AP9A 2CGOA 4OHXA 5L7OB 4EJRA 4Q0UA 2VNVA 3GNEA 2VZ1A 4S2GA 5FPLA 5CEHA 4LKDA 4N7IA 1VJ2A 4WZCA 4YG0A 1NY72 2RS52 5FUIA 1CQ9A 3PJYA 3T1MA 3KCXA 4IE0A 4KGQA 4PIXA 3ZYPA 4ZHNA 3FBMA 4NAMA 4LBOA 4QHBA 4D7TA 1XSQA 4AFDA 1JZ7A 1RVF2 1DQ5A 1OKOA 2DU0A 3GZTB 3I2OA 1FNZA 1SLCA 2ARXA 3KB5A 4AEDA 3OGRA 1UXXX 2Y38A 3NO8A 1QQP1 1ZA4A 3KS7A 2W2IA 1DGWA 2ZGTA 3GZEA 3I2GA 3O0VA 2VUDA 2PHTA 1W8HA 1BBT2 1PO23 1X9PA 1PK6C 1QXJA 4META 1RHI2 4AGVA 1XNTA 2Q1MA 5ISLA 1JTZX 5KC5A 1QJFA 1E5HA 2DVBA 4RS5B 1VBC2 3B94A 3CBNA 1W8NA 3UKNA 3NRUA 1EP0A 2QNKA 4IEXA 1DQ1A 4LA3A 2J1SA 1W6QB 5F39A 5IK5A 3VBOC 4IQPA 1UWWA 3D6EA 1R083 1U0AA 4GKYA 2YBKA 4AZZA 4RGKA 1UNBA 1WBLA 4KWJA 2L9LA 3S30A 1S1AA 5FLIA 4XFGA 1LENA 2R49A 1CGPA 2E6VA 3ZFEB 1CPNA 3AYEA 2VBBA 1JOBA 2ARBA 4KWUA 4A44A 1PK6A 3JUUA 3POSA 5FY4A 4Z2AA 2RS12 4IV1B 2JDUA 1FMD2 1DCSA 1OXCA 2AUYA 2ZGLA 3B7MA 2VNOA 2JG9C 2FCTA 3PMSA 4NO4A 2OKXA 2WT1A 1S2KA 1DZRA 5A3UA 4NRPA 4W8JA 4ASLA 2W3JA 2VCBA 3E97A 4LOTA 4QM9A 4B7KA 1NX9A 4EYUA 1G7YA 4GMP1 4AVVA 3QOPA 3I59A 1D4M2 2W08A 3EBRA 3NV4A 4NHMA 4RQPB 1CPMA 2A70A 1SZBA 2XJPA 4INDA 2FD8A 2B8MA 1CX1A 5DAQA 2V73A 3I3QA 3HWJA 1H0BA 4E4DX 2XXZA 3OF1A 1AX2A 2P37A 1V6MA 4OQ8A 2JG8C 4IEPA 4O9GA 4YWAA 5FKBA 3AZWA 3S7IA 1XRUA 2W95A 3MYXA 4Q29A 4IV3C 3M70A 3POGA 1RUI3 1Y7BA 5GLVA 2WO3A 4QQLA 1JZ6A 2UY9A 1ENRA 2EALA 2MEV2 1W2OA 1TNRA 4JGZC 4H7LA 4LMFA 3PU3A 4ES9A 5T5JA 3ZXDA 1KEXA 4JQTA 4Q0SA 2LW8A 2O8OA 3M3EA 2E7TA 4BLJA 4BXFA 3WF0A 4XF3A 1H2LA 3WG2A 4HVQA 1W99A 2DTWA 4IERA 2DU1A 1DGRA 1KJRA 1N3PA 2GC1A 1FNYA 2WO1A 2Y0OA 1ACCA 3R4SA 4OLLA 2WT2A 5FYMA 1UY1A 2E31A 2W9XA 4RHV1 3GM8A 5DG2A 2GAUA 3AFKA 4BQWA 3ACFA 1RUJ1 1LHUA 1VRBA 1H8VA 1IQAA 4Q8LA 2RDQA 5LBEA 3OY8B 1NXD1 1CX4A 3OGSA 1POQA 2GNTA 3QD6A 4XZPA 5C4WB 4C90A 3QH7A 4QKFA 2VUAA 3WV6A 3W20A 5FXWA 4B8EA 1ASJ3 4AE2A 3C7GA 1B09A 4WM8A 4M4RA 4D6SA 1JZ3A 1W05A 4JHTA 4BPZA 3ZX7A 2WN3A 2GP5A 1BJQA 1W03A 5FR3A 1XYPA 3CLPA 3SC7X 1WLDA 5CU1A 2AENA 1PMHX 2G1MA 1PHMA 1VBE1 4BB3A 4AOCA 1FOD3 1VLNA 4LHNA 3S7EA 4DEQA 4C0BA 1BKZA 3UJOA 3OOXA 1RUH3 4LO5B 4RGAA 2J22A 5LA9A 4FOYA 3SHRA 5JZGB 1H1IA 1KS5A 2Q5TA 2OX0A 3Q8FA 1CIWA 1C28A 2VQUA 4IESA 1X8MA 5IT6A 4N9IA 4DUVA 2WAOA 4K9SA 1OFSA 3WVJA 1JUHA 3NMBA 5FMBA 3ZN4A 2IWGB 2NP0A 3GALA 5FWEA 3M2MA 1LHWA 1TME2 3EMRA 5JIAA 4AHXA 3I2JA 1V9U3 3ST7A 1H4GA 2NQYA 2VOWA 3KVAA 1AR93 3MPPG 2HWF2 3MV01 5K4LA 5BNOB 1H2MA 4GA9A 4WVMA 4XCBA 1EPZA 2RS53 5C8WA 1MQTB 4FT8A 1IZ3A 1PZ7A 2E33A 2OVUA 1WW7A 2VECA 2VM9A 2XH6A 3IB3A 2R0FA 4KI5M 5D8AB 5EJ3A 3K4DA 3T08A 5ACA2 4IV1A 1WA6X 1HV0A 3VDDC 1H8TA 5IVBA 4Q4V2 4CCOA 1PK6B 1A6CA 1ZNPA 3NJZA 4QGLA 1FXZA 4B29A 1ULDA 4XBNA 4YW2A 1S0EA 1PVC1 5IHRA 3ROUA 1VR3A 1L7LA 1OT5A 4CXYA 3TRSB 4MGSA 1XE0A 3DYOA 2JEMA 1RUG2 3VBFC 3B9IA 3ACIA 2VR4A 5I8SA 5IAVA 4WM7B 1LHNA 3KGZA 4AEMA 1PO22 4XJZA 3CU7A 1CZSA 1ZRFA 1DFQA 4A3XA 1J58A 1JHNA 4YM0A 3E6CC 3BN6A 1J3QA 2R30A 1VE0A 1UD1A 2VZQA 3VDBA 4PBOA 3BOWA 4LO8A 1QJU1 3U78A 5C9AC 4JKMA 2ADEA 2DV9A 4MHUA 4COWA 3AXEA 1RGSA 3KVBA 4BH9A 1K3IA 5FYYA 5HV0A 1DF0A 2E9QA 5JOXA 1R082 1FATA 3I54A 2V72A 5F2WA 3T2OA 3U0ZA 3AP5A 2R071 4K3UA 4FOWA 3FE5A 2P6HA 1OA2A 4Q5OA 3WT3A 2OPWA 2VG9A 3OB8A 3OD4A 4UFIA 4AI3A 2RS13 2WFF3 4XFAA 3FUQA 3WG1A 4PLNA 5HV4A 5FPZA 2WNVC 1H30A 3UGHA 2H0BA 5T5PA 4U2AA 2G4IA 1RUD1 3GJBA 4KBZA 3NJXA 2BRTA 1D4M3 4GWJA 1GUIA 1SFNA 4OYUA 3RPQA 3R4DB 3ZYGA 1MEC1 3HNYM 4W6WA 5B4NA 1JOPA 2JG8A 2WS92 3D3AA 2DFBA 4LJHA 3WSOA 2Y34A 1W0PA 1YQ8A 2B7YA 5FUPA 2XVKA 2YU1A 3HN3A 2WZ8A 4P14A 5FCCA 2ENRA 1HJFA
chains in the Genus database with same CATH topology
1SBDA 1HX6A 5DZEA 1AVBA 1C8NA 3W9AA 4AHZA 2D5FA 4QXKA 4XF9A 4B7EA 2R042 1PO12 4CEYB 4CP0A 1Q8OA 4HN1A 2I74A 1LHVA 2TEPA 2I07B 4OHVA 4EWAA 2K2SA 2V09A 4LHKA 4L9BA 1Q56A 1RUNA 1QWRA 3WP5A 3SISA 3ZIXA 5CFDC 3ECQA 3ZN5A 5BUVA 2UY8A 2WFF1 2HEVF 1GNHA 2VMGA 2CV6A 3VBFB 1K5MC 1ZX5A 1BYHA 3AYCA 3VHNA 2W0XA 3LGRA 1WGPA 3VKOA 2TBVA 4FPLA 5A32A 2BFUL 3R6SA 3I2DA 4C91A 1BEV1 2IFWA 4AEDC 1V00A 4Y26A 3D8CA 4J1XA 5KC6A 1DG6A 3UKVA 2BYVE 4AVBA 1G86A 1GFF2 4HVRA 1BQPA 4CP1A 5JAXA 3UKTA 1QOTA 3SCFA 5CFCC 5FQ0A 1SBFA 1T6GC 5L36A 3AJZA 5L7OC 1OFNA 2HWB1 3O0WA 4K21A 1G9DA 3L9JT 3EHKA 4AFAA 4KU7A 1OPMA 2R1BA 3VBSB 1CAUA 1NE4A 1VBA1 2WNVB 4WBBA 4YFZA 3VUOA 1YFWA 1APNA 1BK1A 2CGNA 2WKKA 4XJ8A 1UZZA 1L3JA 3RI8A 4IEVA 2Z69A 1ZBA1 3LCPA 2W52A 4M3CB 3VLBB 3HIFA 1O5LA 3WDVA 2OZJA 1AL0G 4Z07A 3OBRA 2UURA 1UPIA 1TME3 3IN9A 1RUC2 4SBVA 5E89A 4R9AA 5C8CC 1V9U2 4DQAA 2ZGSA 4XOGA 4FPCA 2P34A 2RS33 4EWDA 3VDDA 1OLRA 3VKFC 3GBWA 5ACA3 1URXA 4M0HA 4CDXB 1ND3C 1QMJA 4WM7C 1B35C 2FMDA 2HWB3 4QPIB 1JXNA 4JC1A 1Q8QA 4I2OA 5C9AB 4IEUA 1G9CA 2OW4A 1LOAA 1FPN2 2WLQA 2QZ2A 3MZHA 4PCRA 2VOVA 1BCXA 2DCYA 1GQHA 1RUG3 2JE7A 3USSA 4IEWA 1Y3TA 1AHSA 4KWLA 1AR83 4NVPA 1CESA 1O3SA 4AI8A 3CJIB 1O3RA 2XBO3 2EAKA 1EV12 5FBZA 3RYPA 4LBKA 4YM2A 1ND3A 1UAIA 4M3CE 4AVCA 1S0DA 5K8SA 2BWCA 2IXHA 1H4HA 3N7JA 1BZWA 4RQPC 4C0HA 3TBDA 2OPKA 5JPMB 2A3YA 2WFPA 3R05A 2QVSB 1UX6A 2VOKA 1SLLA 4N43A 4AYUA 2A3WA 1WD4A 1FV3A 2AYHA 3WHTA 4D7SA 4YW4A 5GLWA 1TE1B 4H3WA 1AYM1 3ZYJB 1NG0A 4LEJA 1LOGA 4D7YA 2ZABA 3EXUA 4FO9A 1SCSA 5FRAA 5GM0A 4HKOA 1A8DA 1NE6A 3AJYA 3JD72 2DVAA 4FPOB 5BNNB 1DQ2A 4YW5A 1UMZA 1REFA 3MICA 2ZHNA 5FQ0B 3FFZA 4L97A 3FMGA 5A32B 1C8M1 1NQDA 2BVBA 1H2NA 1DGRN 3FX3A 3QBQA 2ZZJA 3PVOA 3D0SA 5K9YA 1W39A 4YW3A 1IGOA 2F4PA 2HWD1 4YNIA 1CONA 2VQ0A 4JGYB 3WY6A 5BNPA 2WWSA 3J8F1 3B02A 4CEWB 2VVFA 5GKAC 4HKLA 3EJKA 2CY6A 2R16A 2VPVA 1M4WA 4AQSA 4C1XA 5GALA 2XG3A 3AKTA 4LBQA 5D1IA 3RMYA 3QH6A 1OMIA 3WP6A 5CG9A 1R1A1 5FAXA 3MIEA 5A33A 4FVVA 4LHLA 3VBUA 2JG8B 1DYPA 1OQEA 5BNPC 3RYKA 1GV9A 1MS5A 4LLFA 1EAH3 2MNGA 3ZMNA 1CAVB 4QPGA 1TEIA 1IKQA 2OA2A 3E6DA 4XFFA 1MR5A 4HVOA 3WDYA 4AG4A 5C9AA 1Z7S1 1PIV2 3WZ1A 1H1MA 2UWCA 3POYA 5DDJ1 1ZBE2 5J36A 2XPJA 4YZ3A 3ATGA 5JSRA 2PAMA 1RJ7A 1PNFA 3M1HA 3ZDSA 2O0OA 4KU8A 5I0TA 1G9BA 2KXLA 1FOD1 3V0AB 4XJWA 4LO7A 1DZQA 2WZR3 2GC2A 2B45X 3PLQA 1B35B 3V0BB 1RUC3 4NWWA 2RR11 4IV1C 2WNUC 4XFBA 3WW2A 4ZKTB 2RHPA 2RS32 3OYWA 4D69A 1YCIA 1D4VB 3LOIA 2HWC2 1YLLA 1K5MB 1LOFC 4LBLA 3ZIWA 2YYOA 3AZXA 3ZO0B 3ASIA 4AEDB 4E2SA 4A2UA 2ZGOA 2B5HA 4RL7A 5KXBA 1BXHA 4AVSA 1XE8A 5DDJ3 2HEWF 4OI4A 1OA3A 2YMZA 5CG8A 5GZGA 4MV2A 2Q30A 1ND2C 1UZYA 1S0IA 3L2HA 1GR3A 1CR7A 1BVP1 1YXWA 3RQ0A 5AC91 3M3QA 1ULCA 4P9XA 2RM21 2XBO2 1QXRA 2BNMA 1RUE1 2ZZQA 1GZ9A 4YGCA 4QM8A 5LEKA 3T2TA 4BZ4A 1AR72 2IXCA 1VBB2 4HT1T 1CAWB 3FZ3A 1VBC1 4D3WA 5ABJC 4Q4Y3 3ME2A 2K0GA 4IEOA 2YDEA 4ES8A 1WBFA 1JH5A 4CRQA 2SBAA 1C8M3 2HWE2 5CVRA 2JENA 4ISQA 1O5UA 4CDXA 1NA1B 1REDA 2BQPA 4LT5A 3M3OA 3PVBB 5JLVA 3BPZA 3U11A 4ATEA 1FMD1 4MXWB 3TNQA 4LR4A 4CEWA 4FTBA 1DHKB 3RYRA 2PHLA 2D98A 5KHJA 4FTSA 3ZXLA 3WDUA 1LOCA 4DXZA 3WDXA 1XYOA 4Q26A 2ZAAA 3BOPA 2B46X 4J6GA 5GJ6A 2CAUA 1ZRRA 1JN2P 2LTNA 2ERFA 5T5OA 3VBHB 1WMEA 1O3QA 2GU9A 1AF9A 5H9SA 4IV3B 3V56A 4FP3A 1X50A 2A6WA 2DCTA 5HBAA 2A6XA 1Z0HA 2H0VA 5HCFA 3AYDA 3TAYA 4HN0A 1Q5OA 1QNYA 3DUIA 2XB6C 2EXHA 1C1LA 1B35A 3KSCA 4FSJA 1Y9QA 2YXSA 4R8HA 5EWSA 1QJZA 2ZPXA 4Q1PA 3VZOA 3ELNA 4HL0A 5L7OA 2FZ1A 4YG6A 1RUJ2 3JBG3 2CAVA 1EAH2 2AZ5A 1HRV2 1S2BA 2PTMA 4FCAA 4FQZA 2ZHMA 1AYN1 3ZMOA 1SEFA 3RZZA 5C4WC 5DZGA 4CDUB 2WA3A 1RUOA 1GZCA 5KXEA 4TSVA 1ZRDA 1AL21 3PVEA 4Y1UA 4JGYC 4KBBA 4JTOA 4YVSC 4WZFA 4HZFA 4LE3A 5FMOL 3ENRA 1MVEA 1KJLA 4OI0A 2RJLA 1JW6A 2PLV1 1PGL2 4JDNA 2Y26A 1RVF3 1NLSA 4XJAA 3SH3A 3MIHA 1ULGA 1GSLA 4F83A 1YFXA 2D6MA 4AF9A 1ZBA3 4AEKA 5A33B 3RWNA 3TYJA 3TN91 2GMMA 5FO9B 1VBE3 3H0OA 4KL1A 2VULA 3CJIC 3JZVA 3WHUA 3APBA 2D40A 1TME1 3FBYA 1DZTA 4QQ2A 4BLIA 4DRVA 1QDCA 2JE9A 1RMU1 4JGYA 5BY5A 2IC1A 1YUDA 3P3PA 1HV1A 4QX5A 2HWF1 4E27A 4Y20A 3O0XA 4RR3C 1QJX3 1YFUA 5KXDA 2B42B 2DURA 1N47A 1NXMA 2VVEA 4AFBA 4F8AA 1S55A 1QXPA 3J9SA 2RS51 1PVC2 2XJRA 3WCSA 1S0JA 1WCSA 4QGMA 4HPKB 2NZ9A 1DGWX 2HEYF 1PO21 3GZUC 1O91A 1AR73 1O4YA 1LULA 2XJQA 4ASMB 1YFYA 1SCRA 2PELA 1RUF2 1YJKA 1BBT1 3THTA 2DCZA 4N53B 1RHI1 4LO6B 4MX3A 3RJ2X 4XHXA 1O4ZA 2H6CA 4PIYA 3AMQA 1G6NA 1DU3D 4Q0VA 3SLIA 1WCKA 2D6PA 4YSFA 3FUOA 5JDBA 4GB31 3VHPA 1V6KA 1UU4A 3VZMA 1RUI2 1V6NA 2YUEA 2Z2SB 1OOPB 2A5ZA 3N7LA 1WA4A 4MXWA 2I45A 2R073 3BIWE 1PM7A 1I3HA 3VZNA 3LSDA 4GMP3 4LO4B 4YLZA 2AH2A 4QD2A 2DWRA 3ES1A 3VL9A 4G3YC 4Y1ZA 1V6JA 3MW4A 4HFSA 2PHXA 3B9CA 2VNRA 3J4UH 5KHKA 3FJSA 3VBFA 2ZHLA 4MGZE 3VZJA 1MS1A 1Z78A 1HXS2 2VW2A 3GBFA 1VBD2 5J98B 2GNDA 4DRRA 1SMVA 1COV3 2R041 4BCUA 2DCKA 3FLPA 1UIKA 1SLAA 4LA2A 1MZFA 4WVZA 3VHOA 5BNOA 2CGPA 1LU2A 3DF0A 3ZXFA 5DXDA 5I0UA 4XIOA 2LALA 2A75A 4HK9A 1I9RA 1J3PA 4CDQB 4R4ZA 2GN3A 1JYCA 1FT9A 5AFEA 1QY4A 2ZS6B 4COVA 1WLWA 2WSUA 5LEJA 1LGBA 3KQRA 2OUJA 3WW1A 4RFT0 2XVLA 3MPBA 4BQ1A 4AHWA 4FOQA 3SXWA 3OGJA 5JIUA 4WM7A 4Y20B 5C4WA 4TYSA 1OQ1A 1MS0A 4IEQA 3LA7A 1W6PB 1X82A 4MLOA 4H14A 2UWAA 3CEWA 1CAUB 4Q2FA 2QJVA 1F5JA 4B4RA 3J26N 2EXIA 3VBHC 5KHHA 1AR92 1RTVA 2GH2A 2XJTA 2GH8A 1AXYA 3OY8A 4GQ7A 5JR7B 5I8YA 1RUD3 1QJX1 2GALA 1UIJA 2B39A 1S0FA 5IK8A 2E7AA 4R4XA 1JBCA 3BALA 1UKRA 1LHOA 1HW5A 2VOXA 1XXNA 1SDWA 1POV0 1ZBA2 1H2KA 1VBA3 4YVWA 3HT2A 4MXVA 1VBE2 3OJBA 3B00A 2A7AA 3ZXGA 2D44A 2I2SA 3VZKA 4Y1YA 3WQ0A 1F9KA 1RUC1 4AXOA 1V9U1 2E7QA 1YHFA 1AZDA 1LOBA 3M3IA 1ZVFA 1QGLA 2BBVA 1AR62 3A0KA 4QPIA 4OZXA 1W6PA 4I0WB 2P17A 4ZXKA 1UU6A 4EWEA 5AFBA 1LR5A 4YGBA 1WMDA 1QDOA 5ACA1 3NKTA 3RNSA 5IK7A 4N53C 3ZSLA 2D3SA 2D6LX 2BNNA 4ORFA 4XJ9A 2VMIA 4KG8A 4KG0A 4RHV3 4N7UA 3OD0A 1I6XA 1H1AA 4FXGB 3H7JA 4QPYA 3ZFGC 4AK3A 5HCAA 5CIRA 4ZU4A 4DY3A 4EROA 1GNZA 1N1TA 4NR1A 3VBSA 5F6LB 2WS93 2XJVA 3E5XA 1BVVA 2UYAA 3KLSA 5CFCB 2R061 1UU5A 2E53A 2BUKA 4V1PA 1QJU2 1HQLA 2ES3A 2UYBA 2BNOA 4AFMA 1AYM2 2R072 3MIGA 1FV2A 4MGKE 3LOBA 1U5XA 4ITCA 2Z79A 3AMNA 3WCRA 1YWKA 2X29A 4XHBA 5GLZA 2WNEA 5J3UA 2QDRA 4M0NA 4BYYA 5LK5A 2FQPA 3VBOA 4SLIA 3ZFFC 3IDCB 1HXS3 1AX0A 4Y1VA 3POWA 5GLUA 4MSVA 4DMIA 2ZX1A 1VAKA 1KDMA 1COV2 1QJY1 4DB5A 4K20A 1YYNA 2BVVA 3SCHA 4YM3A 4N43C 3FLRA 3J8F2 2NMNA 4M3CF 1HIXA 1AR81 2CYFA 3LKJA 4RR3A 3MW2A 1FYUA 3H3UA 3M8LA 2ET7A 3KD4A 2GNMA 4RSUA 1U5ZA 4Z2WA 5FTTC 3BCWA 4XF0A 4ZU5A 1PZ8A 4EN7B 1UW8A 1Q8SA 2YGMA 3R4UA 2QCSB 3NWKA 4YVSA 2C0ZA 1DQ4A 1ND2B 2ZX0A 4JGZA 2UU8A 2VXRA 4L11A 2ZGPA 4YGDA 3NKGA 2YV8A 2VGDA 1V70A 4OI2A 4L8QA 1J59A 1PIV1 1MACA 4XPVA 1YIFA 1IS5A 1C3HA 2UWBA 2HWB2 3C3VA 1NZCA 1VBA2 1EY2A 2AR6A 2PLV3 4RGGA 2ZGRA 4W6YA 2CL2A 4AHYA 1XE7A 2RR12 4X6QB 5C33A 2DUOA 1C57A 3KT1A 2RS31 5HXVA 3LA2A 1U5IA 1ULFA 2HYKA 1AR63 2HWC1 1FX5A 3OGGA 1KFUL 1X36A 4YVSB 2JG9B 4Q0QA 4A7ZA 3MLLA 4URTA 1SLIA 3CF6E 2EF6A 4COYA 4I3PA 4QPGC 4R9BA 1H9PA 4I02A 4FAHA 1CJDA 3MLJA 3B01A 2PHUA 5E16A 3KGLA 5EFUA 2XJSA 4M01A 1KS4A 4XFIA 1LEMA 2XBO1 1BEV3 1RUE2 3EO6A 4HBNA 4KQ7A 4UXAA 4XXAA 2D43A 5F5QA 4OI1A 3C2UA 1XU1A 1AR71 3VV1A 1KDKA 1VBB1 1NCQC 5BNPB 1WW6A 3TB0A 1OI6A 2WNUA 1ZZBA 4OUMA 4AGGA 1UF2C 1C4RA 4R9DA 3ZPYA 1LU1A 4EV0A 2DTYA 2HWE1 1HRI3 2DVGA 3WW4A 1QHDA 1AYM3 4F7ZA 1R091 1PZ9A 5FLHA 2Q8OA 1W6QA 5CADA 5BNNC 5F6KA 1ULEA 4YZ5A 3JB4C 3IMNA 4EN8B 4LE4A 4N9HA 4XJUA 2OIIA 4HK8A 1DBNA 5JWPA 1VALA 1DYKA 2X8KA 3D4KA 3V0AA 3INAA 4QQPA 2A73B 4Q4X2 2XLFA 4FPEA 4AI0A 2GDFA 3IIAA 5TSWA 4MGIE 5E1RA 2FBEA 3KM5A 4AGRA 5BNNA 3E6BA 4DY5A 1D2QA 1QU0A 1A78A 3CJXA 5EV7A 3SNMA 3WQ7A 3WR0A 5JZGC 5FDBA 2XKPA 4FPJA 4OFGA 5D8AA 2G9GA 3USUA 1AX1A 1FI2A 4AI2A 1LKNA