2AROA

Crystal structure of the native histone octamer to 2.1 angstrom resolution, crystalised in the presence of s-nitrosoglutathione
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
106
structure length
106
Chain Sequence
KAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H2A-IV
publication title The oxidised histone octamer does not form a H3 disulphide bond.
pubmed doi rcsb
molecule tags Structural protein
total genus 31
structure length 106
sequence length 106
chains with identical sequence E
ec nomenclature
pdb deposition date 2005-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00125 Histone Core histone H2A/H2B/H3/H4
A PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2aroA00
1M18D 3REJA 4NE3A 3X1UD 5AVBB 3AN2A 1KX3B 4KUDC 3AZFC 5DNNC 4XZQB 5FUGB 1KX5B 2CV5D 5B33A 5GXQB 1M1AA 3WA9A 4Z66C 3W96C 2AROB 2YFVA 3MGRC 5AVCC 3WKJB 3MGPD 2BYMB 5CPJD 5B0ZB 5F99C 4LD9D 3UTBC 3B6FD 5GT3A 1P34C 1ZLAD 1P3PB 3AZMC 4H9NB 4KUDA 4J8XC 3X1VB 4H9PB 3AZFA 3W97B 4NE5A 5B1LC 3AYWB 1P3AA 4WU9C 3UT9B 3MNNB 4H9QA 5B0YD 3REHB 1P3LC 3AZLA 2FJ7A 4Z66A 3W96A 3KXBB 3AZJB 3REKA 3X1TD 3WKJC 1P3OD 3MGSB 1H3OB 5F99A 5GSUD 4XUJC 4QLCB 3UTBA 5B2JD 1P3GC 2F8NK 5DNMB 1P34A 5G49A 2RVQD 4JJNB 5BNVB 5CPIC 5B2IB 4WU8A 3AZMA 4J8XA 5AV8B 3X1VC 5KDMB 1S32D 5B1LA 4WU9A 3MNNC 5CPKB 1P3LA 3REHC 3VH5A 5E5AD 3REIB 4M6BA 3AZNB 3LZ1C 1R4VA 3AZJC 4YM6A 5GT0B 3A6NC 4KGCA 5B40B 3WKJA 1P3KD 3VH6A 3AFAD 4ZBJB 5JRGC 4ZUXC 2BYMA 3W99D 4XUJA 3AZIA 1P3GA 5DNMC 3O62D 4H9RA 2NZDC 1P3IB 5CPIA 5B2IC 3W98C 5AV8C 4WNNB 3MGRD 4J8UC 4YS3C 3KWQD 3AV1B 4J8VD 2IO5B 5B32A 3REHA 5AV9C 3LELD 3REIC 5BNXA 1U35C 3AZNC 3LZ1A 3REJB 3X1SA 3AZJA 5AVBD 1ID3A 3A6NA 2F8NA 3AN2B 1KX3D 3RELA 5JRGA 4XZQD 4ZUXA 1KX5D 3WAAC 5B33B 3B0DC 5GXQD 1M1AB 3WA9B 1TZYD 2AROD 2NZDA 3MGQC 2YFVB 1M19D 3W98A 1EQZA 1P3MA 4J8UA 4YS3A 1P3FC 4R8PC 3AZKB 5B0ZD 4H9SC 5AV9A 2F8NH 2HIOD 4WV4B 4Z5TA 3LJAC 1U35A 5B1MD 1P3PD 4KUDB 3X1VD 5B24C 3C1BD 3AZFB 3W97D 3AYWD 1P3AB 3UT9D 3MNND 3WAAA 2NQBB 4H9QB 3AZLB 2FJ7B 4X23D 1M1AC 4Z66B 3MGQA 3KXBD 4WZSB 3REKB 1P3FA 3MGSD 4R8PA 3AZHC 5AV6C 4G92C 3AZKC 5F99B 4QLCD 3UTBB 5DNMD 1P34B 5G49B 3LJAA 4JJND 3AV2D 5B2ID 4WU8B 3AZMB 5AV8D 5B24A 4J8XB 3AZEA 5B1LB 1P3AC 4LD9A 4WU9B 5B31C 5CPKD 2NQBC 1P3LB 2CWEA 3AZLC 2FJ7C 3REID 3AZND 3B6GB 1N1JA 4EO5B 4YM6B 5GT0D 5B40D 3REKC 4KGCB 5CP6A 3AZHA 5AV6A 5BT1C 3AZKA 5JA4A 4XUJB 3AZIB 1P3GB 2JSSA 2HUEC 4H9RB 1P3ID 3X1TA 5CPIB 3NQUA 1P3OA 4WU8C 3C1CC 4CAYA 3MVDD 5B31A 3AV1D 2PYOB 5B2JA 4J8WD 2NQBA 5AY8A 5B32B 1BFMA 1AOIC 4G91B 3KSYA 5BNXB 3B6GC 5CHLB 3LZ1B 3REJD 1BH9B 3X1SB 1ID3B 2F8NB 4EO5C 3NQJA 4YM6C 3A6NB 3AN2D 4KGCC 3RELB 5JRGB 5E5AA 4ZUXB 4DRAA 2L5AA 3AZIC 5B33D 5AV5C 3WA9D 2NZDB 3UTAC 3C1CA 3W98B 1EQZB 1F1EA 1P3MB 1F66A 4J8UB 4YS3B 3AZGC 2PYOC 5B32C 3R45A 3O62A 1P3BB 1AOIA 5AV9B 4E45A 5GT3D 4G91C 2BYKA 3B0CT 4Z5TB 1U35B 3B6GA 1KX4C 3X1SC 1ID3C 4Z2MG 1HQ3C 4KUDD 4J8VA 3RELC 3AZFD 5DNND 1P3AD 3LELA 3WAAB 3B0DB 5AV5A 3AZLD 2FJ7D 1Q9CA 4Z66D 3W96D 3MGQB 3UTAA 1EQZC 1P3MC 4KHAA 5AVCD 3AZGA 4CSRA 1P3FB 4AWLC 4R8PB 2PYOA 1P3BC 5F99D 3TU4A 3UTBD 1M19A 1P34D 4UUZA 4Z5TC 3LJAB 1KX4A 1BH9A 4WU8D 1HQ3A 3AZMD 4J8XD 5B24B 3WTPC 3AZEB 5B1LD 3LZ0C 4LD9B 4WU9D 2HIOA 3KUYA 1P3LD 1M18C 3VH6W 2LY8A 3C1BA 1N1JB 4KGCD 3WKJD 5CP6B 1WWIA 2CV5C 3AZHB 5AV6B 4G92B 2YFWA 4X23A 1P3BA 5JA4B 4XUJD 1P3GD 4H9OA 5CPID 3X1TB 3NQUB 1P3OB 3MGPC 4CAYB 3WTPA 3AZEC 3LZ0A 4NFTA 5CPJC 4LD9C 5B31B 3B6FC 5B2JB 5BS7C 5AY8B 3REHD 1M18A 3AV2A 1ZLAC 3X1UA 3VH6T 3LZ1D 1S32B 3AZJD 2F8ND 3A6ND 3NQJB 5C3IC 3RELD 5CP6C 5B0YC 5JRGD 2CV5A 5E5AB 4ZUXD 1JFIA 2HUEB 2NZDD 3X1TC 1P3OC 3AFAB 3C1CB 3MGPA 3W98D 1F66B 4J8UD 4YS3D 5CPJA 5GSUC 3B6FA 5B2JC 5BS7A 2RVQC 5AY8C 3R45B 3O62B 1A7WA 5AV9D 1BH8A 1AOIB 1ZLAA 4Z5TD 2BYKB 1U35D 1S32C 4J8WA 4J8VB 5B0YA 5E5AC 3LELB 5B31G 3WAAD 4E44A 5AV5B 5BO0A 3MGQD 3UTAB 1P3KC 3AFAC 1F66C 4KHAB 1P3FD 3AZGB 4CSRB 5GSUA 1ULYA 3W99C 4R8PD 3O62C 1TZYB 3B0CW 3TU4B 1M19B 4UUZB 3LJAD 1S32A 3KWQC 1KX4B 1HQ3B 5B24D 4J8VC 3AZED 3LELC 2HIOB 3KUYB 1B67A 1M1AD 5B1MB 5AVBC 4NE6A 1KX3C 1P3KA 3AFAA 5DNNA 3C1BB 4XZQC 1KX5C 4AWLB 5CP6D 3W99A 4HGAB 3AZHD 5AV6D 3AZKD 5GXQC 2YFWB 4X23B 1TZYC 2AROC 3TU4C 3V9RA 1M19C 3MGRA 5AVCA 4H9OB 3KWQA 1TAFA 3WTPB 1B6WA 5B0ZC 3LZ0B 5B31D 2HIOC 3KUYC 2NQBD 5AY8D 1M18B 5B32G 3AV2B 3WTPE 5B1MC 5AVBA 3X1UB 1P3PC 1KX3A 3B0BA 3C1BC 4XZQA 3W97C 3AYWC 5FUGA 3UT9C 2F8NG 3REKD 1KX5A 1KU5A 4HGAC 2CV5B 5BT1D 5GXQA 4X23C 1TZYA 2AROA 3KXBC 1JFIB 3MGSC 3C1CD 3MGPB 1F66D 3VH5W 5B0ZA 5CPJB 4QLCC 3B6FB 4JJNC 1AOID 3AV2C 1BH8B 1ZLAB 5B1MA 3X1UC 1P3PA 4H9NA 3X1VA 4H9PA 3B6GD 3W97A 3MVDB 3AYWA 3UT9A 4YM6D 5C3IB 3MNNA 4J8WB 5CPKC 5B0YB 3KXBA 3AZID 5AV5D 5BO0B 5GT0C 5B40C 3UTAD 3MGSA 4DRBA 4ZBJC 1H3OA 3AZGD 3VH5T 5GSUB 1WWSA 4Z2MH 4QLCA 2PYOD 5DNMA 5B32D 4JJNA 5BNVA 1P3IC 3TU4D 5B2IA 5AV8A 5KDMA 3MVDC 1KX4D 3X1SD 1ID3D 1HQ3D 3AV1C 4J8WC 5CPKA 2IO5C 3KUYD 5GT3B 3REIA 3AZNA 3REJC 5GT0A 3AN2C 5B40A 1HTAA 1P3KB 5DNNB 1EQZD 1P3MD 3W99B 5B33C 1P3BD 3WA9C 3W96B 1P3IA 3V9RB 4WNNA 3MGRB 5AVCB 3MVDA 3KWQB 3AV1A 1TAFB 3WTPD 3LZ0D 4H9SA 5GT3C
chains in the Genus database with same CATH superfamily
1M18D 3REJA 4NE3A 3X1UD 5AVBB 3AN2A 1KX3B 4KUDC 2J8PA 3AZFC 5DNNC 4XZQB 5FUGB 1KX5B 2CV5D 5B33A 2G5HC 5GXQB 1M1AA 3WA9A 4Z66C 3W96C 2AROB 2YFVA 3MGRC 5AVCC 2Y2QA 3WKJB 3MGPD 2BYMB 5CPJD 5B0ZB 5F99C 4LD9D 3UTBC 3B6FD 5GT3A 1P34C 1ZLAD 1P3PB 3AZMC 4H9NB 4KUDA 4J8XC 3X1VB 4H9PB 3AZFA 3W97B 4NE5A 5B1LC 3AYWB 1P3AA 4WU9C 3UT9B 3MNNB 4H9QA 5B0YD 3REHB 1P3LC 3AZLA 2G5IC 2FJ7A 4Z66A 3W96A 3KXBB 3AZJB 3REKA 3X1TD 3WKJC 1P3OD 3MGSB 1H3OB 5F99A 5GSUD 4XUJC 4QLCB 3UTBA 5B2JD 1P3GC 2F8NK 5DNMB 1P34A 5G49A 2RVQD 4JJNB 5BNVB 5CPIC 5B2IB 4WU8A 3AZMA 4J8XA 5AV8B 3X1VC 5KDMB 1S32D 5B1LA 3EPKA 4WU9A 2ZY5A 3MNNC 5CPKB 1P3LA 3REHC 3VH5A 5E5AD 1Z2CB 3REIB 4M6BA 2Y2OA 3AZNB 3LZ1C 1R4VA 3AZJC 5GT0B 4YM6A 3A6NC 4KGCA 5B40B 3WKJA 1P3KD 3VH6A 3AFAD 5JRGC 4ZBJB 4ZUXC 2BYMA 3W99D 4XUJA 3AZIA 1P3GA 5DNMC 3O62D 2JE5A 4H9RA 2NZDC 1P3IB 5CPIA 5B2IC 3W98C 5AV8C 2XD1A 4WNNB 3MGRD 4J8UC 4YS3C 3KWQD 3AV1B 4J8VD 2IO5B 5B32A 3REHA 5AV9C 3LELD 3REIC 3H0LC 5BNXA 1U35C 3AZNC 3LZ1A 3REJB 3X1SA 3AZJA 5AVBD 1ID3A 3A6NA 2F8NA 3AN2B 1KX3D 3RELA 5JRGA 4XZQD 4ZUXA 1KX5D 3WAAC 2VQRA 5B33B 3B0DC 5GXQD 1M1AB 3WA9B 1TZYD 2AROD 2NZDA 3MGQC 2YFVB 1M19D 3W98A 1EQZA 1P3MA 4J8UA 4YS3A 1P3FC 4R8PC 3AZKB 5B0ZD 4H9SC 5AV9A 2F8NH 2HIOD 4WV4B 4Z5TA 3LJAC 1U35A 5B1MD 1P3PD 3P5JB 4KUDB 3X1VD 5B24C 3C1BD 3AZFB 3W97D 3AYWD 1P3AB 3UT9D 2UWXA 3MNND 3WAAA 2NQBB 4H9QB 3AZLB 2FJ7B 4X23D 1M1AC 4Z66B 3MGQA 3KXBD 4WZSB 3REKB 1P3FA 3MGSD 4R8PA 3AZHC 5AV6C 2Y2LA 4G92C 3AZKC 2XD5A 5F99B 4QLCD 3UTBB 5DNMD 1P34B 5G49B 3LJAA 4JJND 3AV2D 5B2ID 4WU8B 3AZMB 3FDDA 5AV8D 5B24A 4J8XB 3AZEA 5B1LB 1P3AC 4LD9A 4WU9B 5B31C 2ZY2A 5CPKD 2NQBC 1P3LB 2CWEA 3AZLC 2FJ7C 3REID 3AZND 3B6GB 1N1JA 4EO5B 4YM6B 5GT0D 5B40D 3REKC 4KGCB 5CP6A 3AZHA 5AV6A 5BT1C 3AZKA 5JA4A 4XUJB 3AZIB 1P3GB 2JSSA 2HUEC 4H9RB 1P3ID 3X1TA 5CPIB 3NQUA 1P3OA 4WU8C 3C1CC 4CAYA 3MVDD 5B31A 3AV1D 2PYOB 5B2JA 4J8WD 2NQBA 4UPKA 5AY8A 5B32B 1BFMA 1AOIC 2JCHA 4G91B 3KSYA 2Y2IA 5BNXB 3B6GC 5CHLB 3LZ1B 3REJD 1BH9B 3X1SB 1ID3B 2F8NB 4EO5C 3NQJA 4YM6C 3A6NB 3AN2D 4KGCC 3RELB 5JRGB 5E5AA 4ZUXB 4DRAA 2L5AA 3AZIC 5B33D 5AV5C 3WA9D 2NZDB 3UTAC 3C1CA 3W98B 1EQZB 1F1EA 1P3MB 1F66A 4J8UB 4YS3B 3AZGC 2PYOC 5B32C 3R45A 3O62A 3EG5B 1P3BB 1AOIA 5AV9B 4E45A 5GT3D 4G91C 2BYKA 3B0CT 4Z5TB 1U35B 3B6GA 1KX4C 3X1SC 1ID3C 4Z2MG 1HQ3C 4KUDD 4J8VA 3RELC 3AZFD 5DNND 1P3AD 3LELA 3WAAB 3B0DB 5AV5A 3AZLD 2FJ7D 1Q9CA 4Z66D 3W96D 3MGQB 3UTAA 1EQZC 1P3MC 4KHAA 5AVCD 3AZGA 4CSRA 1P3FB 4AWLC 4R8PB 2PYOA 4WJ3C 1P3BC 5F99D 3TU4A 3UTBD 1M19A 1P34D 2Y2MA 4UUZA 4Z5TC 3LJAB 1KX4A 1BH9A 4WU8D 1HQ3A 3F6TA 3AZMD 4J8XD 5B24B 3WTPC 3AZEB 5B1LD 3LZ0C 4LD9B 4WU9D 2HIOA 3KUYA 1P3LD 1M18C 2Y2PA 3H0RC 3VH6W 2LY8A 3C1BA 2BG1A 1N1JB 4KGCD 3WKJD 5CP6B 1WWIA 2CV5C 3AZHB 5AV6B 4G92B 2YFWA 4X23A 1P3BA 5JA4B 4XUJD 1P3GD 2ZY4A 4H9OA 5CPID 3X1TB 3NQUB 1P3OB 3MGPC 4CAYB 3WTPA 3AZEC 3LZ0A 4NFTA 2Y2JA 5CPJC 5B31B 4LD9C 1T3UA 3B6FC 5B2JB 5BS7C 5AY8B 3REHD 1M18A 3AV2A 1ZLAC 3X1UA 3VH6T 3LZ1D 1S32B 3AZJD 2F8ND 3A6ND 3NQJB 5C3IC 3RELD 5CP6C 5B0YC 4DQYB 5JRGD 2CV5A 5E5AB 4ZUXD 1JFIA 2HUEB 2NZDD 3X1TC 1P3OC 3AFAB 3C1CB 3MGPA 3W98D 1F66B 4J8UD 2DF4C 4YS3D 5CPJA 5GSUC 3B6FA 5B2JC 5BS7A 2RVQC 5AY8C 3R45B 3O62B 1A7WA 1BH8A 5AV9D 1AOIB 1ZLAA 2Y2HA 4Z5TD 2BYKB 1U35D 1S32C 4J8WA 4J8VB 5B0YA 3KFUG 5E5AC 3LELB 1W2EA 5B31G 3WAAD 3EPHA 4E44A 5AV5B 5BO0A 3MGQD 3UTAB 1P3KC 3AFAC 1F66C 4KHAB 1P3FD 3AZGB 4CSRB 5GSUA 1ULYA 3W99C 4R8PD 3O62C 1TZYB 3B0CW 3IP4C 3TU4B 2F2AC 1M19B 4UUZB 3LJAD 1S32A 3KWQC 1KX4B 1HQ3B 5B24D 4J8VC 3AZED 3LELC 2HIOB 3KUYB 1B67A 1M1AD 5B1MB 5AVBC 3EPLA 4NE6A 1KX3C 1P3KA 3AFAA 5DNNA 3C1BB 4XZQC 1PZRA 1KX5C 4AWLB 5CP6D 3W99A 4HGAB 2ZM5A 3AZHD 5AV6D 3AZKD 5GXQC 2YFWB 4X23B 1TZYC 2AROC 3TU4C 3V9RA 1M19C 3MGRA 5AVCA 4H9OB 3KWQA 1TAFA 3WTPB 1B6WA 5B0ZC 3LZ0B 5B31D 2HIOC 3KUYC 2NQBD 5AY8D 1M18B 5B32G 3AV2B 3WTPE 5B1MC 5AVBA 3X1UB 1P3PC 1KX3A 3B0BA 3C1BC 4XZQA 3W97C 3AYWC 5FUGA 3UT9C 2F8NG 3REKD 1KX5A 1KU5A 4HGAC 2CV5B 5BT1D 5GXQA 4X23C 1TZYA 2AROA 3KXBC 1JFIB 2RIQA 3MGSC 3C1CD 3MGPB 1F66D 3VH5W 5B0ZA 5CPJB 4QLCC 3B6FB 4JJNC 1AOID 3H0MC 1BH8B 3AV2C 1ZLAB 5B1MA 3X1UC 1P3PA 4H9NA 3X1VA 2Y2KA 4H9PA 3B6GD 3AL0C 3W97A 3MVDB 3AYWA 3UT9A 4YM6D 5C3IB 3MNNA 4J8WB 5CPKC 5B0YB 3KXBA 3AZID 5AV5D 5BO0B 5GT0C 5B40C 3UTAD 3MGSA 4DRBA 4ZBJC 2DQNC 1H3OA 3AZGD 3VH5T 5GSUB 1WWSA 4Z2MH 4QLCA 2PYOD 5DNMA 5B32D 4JJNA 2FFFB 5BNVA 1P3IC 3TU4D 5B2IA 2ZY3A 5AV8A 5KDMA 3MVDC 1KX4D 3X1SD 1ID3D 3A1IA 1HQ3D 3AV1C 4J8WC 5CPKA 2IO5C 3EPJA 2Y2GA 3KUYD 5GT3B 3REIA 3AZNA 3REJC 5GT0A 3AN2C 5B40A 1HTAA 1P3KB 5DNNB 1EQZD 1P3MD 3W99B 5B33C 1P3BD 3WA9C 3W96B 1P3IA 3V9RB 3A1KA 4WNNA 3MGRB 5AVCB 3MVDA 3KWQB 2W8SA 3AV1A 1TAFB 3WTPD 3LZ0D 4H9SA 5GT3C 2Y2NA
chains in the Genus database with same CATH topology
1M18D 3REJA 4NE3A 3X1UD 5AVBB 3AN2A 1KX3B 4KUDC 2J8PA 3AZFC 5DNNC 4XZQB 5FUGB 1KX5B 2CV5D 5B33A 2G5HC 5GXQB 1M1AA 3WA9A 4Z66C 3W96C 2AROB 2YFVA 3MGRC 5AVCC 2Y2QA 3WKJB 3MGPD 2BYMB 5CPJD 5B0ZB 5F99C 4LD9D 3UTBC 3B6FD 5GT3A 1P34C 1ZLAD 1P3PB 3AZMC 4H9NB 4KUDA 4J8XC 3X1VB 4H9PB 3AZFA 3W97B 4NE5A 5B1LC 3AYWB 1P3AA 4WU9C 3UT9B 3MNNB 4H9QA 5B0YD 3REHB 1P3LC 3AZLA 2G5IC 2FJ7A 4Z66A 3W96A 3KXBB 3AZJB 3REKA 3X1TD 3WKJC 1P3OD 3MGSB 1H3OB 5F99A 5GSUD 4XUJC 4QLCB 3UTBA 5B2JD 1P3GC 2F8NK 5DNMB 1P34A 5G49A 2RVQD 4JJNB 5BNVB 5CPIC 5B2IB 4WU8A 3AZMA 4J8XA 5AV8B 3X1VC 5KDMB 1S32D 5B1LA 3EPKA 4WU9A 2ZY5A 3MNNC 5CPKB 1P3LA 3REHC 3VH5A 5E5AD 1Z2CB 3REIB 4M6BA 2Y2OA 3AZNB 3LZ1C 1R4VA 3AZJC 5GT0B 4YM6A 3A6NC 4KGCA 5B40B 3WKJA 1P3KD 3VH6A 3AFAD 5JRGC 4ZBJB 4ZUXC 2BYMA 3W99D 4XUJA 3AZIA 1P3GA 5DNMC 3O62D 2JE5A 4H9RA 2NZDC 1P3IB 5CPIA 5B2IC 3W98C 5AV8C 2XD1A 4WNNB 3MGRD 4J8UC 4YS3C 3KWQD 3AV1B 4J8VD 2IO5B 5B32A 3REHA 5AV9C 3LELD 3REIC 3H0LC 5BNXA 1U35C 3AZNC 3LZ1A 3REJB 3X1SA 3AZJA 5AVBD 1ID3A 3A6NA 2F8NA 3AN2B 1KX3D 3RELA 5JRGA 4XZQD 4ZUXA 1KX5D 3WAAC 2VQRA 5B33B 3B0DC 5GXQD 1M1AB 3WA9B 1TZYD 2AROD 2NZDA 3MGQC 2YFVB 1M19D 3W98A 1EQZA 1P3MA 4J8UA 4YS3A 1P3FC 4R8PC 3AZKB 5B0ZD 4H9SC 5AV9A 2F8NH 2HIOD 4WV4B 4Z5TA 3LJAC 1U35A 5B1MD 1P3PD 3P5JB 4KUDB 3X1VD 5B24C 3C1BD 3AZFB 3W97D 3AYWD 1P3AB 3UT9D 2UWXA 3MNND 3WAAA 2NQBB 4H9QB 3AZLB 2FJ7B 4X23D 1M1AC 4Z66B 3MGQA 3KXBD 4WZSB 3REKB 1P3FA 3MGSD 4R8PA 3AZHC 5AV6C 2Y2LA 4G92C 3AZKC 2XD5A 5F99B 4QLCD 3UTBB 5DNMD 1P34B 5G49B 3LJAA 4JJND 3AV2D 5B2ID 4WU8B 3AZMB 3FDDA 5AV8D 5B24A 4J8XB 3AZEA 5B1LB 1P3AC 4LD9A 4WU9B 5B31C 2ZY2A 5CPKD 2NQBC 1P3LB 2CWEA 3AZLC 2FJ7C 3REID 3AZND 3B6GB 1N1JA 4EO5B 4YM6B 5GT0D 5B40D 3REKC 4KGCB 5CP6A 3AZHA 5AV6A 5BT1C 3AZKA 5JA4A 4XUJB 3AZIB 1P3GB 2JSSA 2HUEC 4H9RB 1P3ID 3X1TA 5CPIB 3NQUA 1P3OA 4WU8C 3C1CC 4CAYA 3MVDD 5B31A 3AV1D 2PYOB 5B2JA 4J8WD 2NQBA 4UPKA 5AY8A 5B32B 1BFMA 1AOIC 2JCHA 4G91B 3KSYA 2Y2IA 5BNXB 3B6GC 5CHLB 3LZ1B 3REJD 1BH9B 3X1SB 1ID3B 2F8NB 4EO5C 3NQJA 4YM6C 3A6NB 3AN2D 4KGCC 3RELB 5JRGB 5E5AA 4ZUXB 4DRAA 2L5AA 3AZIC 5B33D 5AV5C 3WA9D 2NZDB 3UTAC 3C1CA 3W98B 1EQZB 1F1EA 1P3MB 1F66A 4J8UB 4YS3B 3AZGC 2PYOC 5B32C 3R45A 3O62A 3EG5B 1P3BB 1AOIA 5AV9B 4E45A 5GT3D 4G91C 2BYKA 3B0CT 4Z5TB 1U35B 3B6GA 1KX4C 3X1SC 1ID3C 4Z2MG 1HQ3C 4KUDD 4J8VA 3RELC 3AZFD 5DNND 1P3AD 3LELA 3WAAB 3B0DB 5AV5A 3AZLD 2FJ7D 1Q9CA 4Z66D 3W96D 3MGQB 3UTAA 1EQZC 1P3MC 4KHAA 5AVCD 3AZGA 4CSRA 1P3FB 4AWLC 4R8PB 2PYOA 4WJ3C 1P3BC 5F99D 3TU4A 3UTBD 1M19A 1P34D 2Y2MA 4UUZA 4Z5TC 3LJAB 1KX4A 1BH9A 4WU8D 1HQ3A 3F6TA 3AZMD 4J8XD 5B24B 3WTPC 3AZEB 5B1LD 3LZ0C 4LD9B 4WU9D 2HIOA 3KUYA 1P3LD 1M18C 2Y2PA 3H0RC 3VH6W 2LY8A 3C1BA 2BG1A 1N1JB 4KGCD 3WKJD 5CP6B 1WWIA 2CV5C 3AZHB 5AV6B 4G92B 2YFWA 4X23A 1P3BA 5JA4B 4XUJD 1P3GD 2ZY4A 4H9OA 5CPID 3X1TB 3NQUB 1P3OB 3MGPC 4CAYB 3WTPA 3AZEC 3LZ0A 4NFTA 2Y2JA 5CPJC 5B31B 4LD9C 1T3UA 3B6FC 5B2JB 5BS7C 5AY8B 3REHD 1M18A 3AV2A 1ZLAC 3X1UA 3VH6T 3LZ1D 1S32B 3AZJD 2F8ND 3A6ND 3NQJB 5C3IC 3RELD 5CP6C 5B0YC 4DQYB 5JRGD 2CV5A 5E5AB 4ZUXD 1JFIA 2HUEB 2NZDD 3X1TC 1P3OC 3AFAB 3C1CB 3MGPA 3W98D 1F66B 4J8UD 2DF4C 4YS3D 5CPJA 5GSUC 3B6FA 5B2JC 5BS7A 2RVQC 5AY8C 3R45B 3O62B 1A7WA 1BH8A 5AV9D 1AOIB 1ZLAA 2Y2HA 4Z5TD 2BYKB 1U35D 1S32C 4J8WA 4J8VB 5B0YA 3KFUG 5E5AC 3LELB 1W2EA 5B31G 3WAAD 3EPHA 4E44A 5AV5B 5BO0A 3MGQD 3UTAB 1P3KC 3AFAC 1F66C 4KHAB 1P3FD 3AZGB 4CSRB 5GSUA 1ULYA 3W99C 4R8PD 3O62C 1TZYB 3B0CW 3IP4C 3TU4B 2F2AC 1M19B 4UUZB 3LJAD 1S32A 3KWQC 1KX4B 1HQ3B 5B24D 4J8VC 3AZED 3LELC 2HIOB 3KUYB 1B67A 1M1AD 5B1MB 5AVBC 3EPLA 4NE6A 1KX3C 1P3KA 3AFAA 5DNNA 3C1BB 4XZQC 1PZRA 1KX5C 4AWLB 5CP6D 3W99A 4HGAB 2ZM5A 3AZHD 5AV6D 3AZKD 5GXQC 2YFWB 4X23B 1TZYC 2AROC 3TU4C 3V9RA 1M19C 3MGRA 5AVCA 4H9OB 3KWQA 1TAFA 3WTPB 1B6WA 5B0ZC 3LZ0B 5B31D 2HIOC 3KUYC 2NQBD 5AY8D 1M18B 5B32G 3AV2B 3WTPE 5B1MC 5AVBA 3X1UB 1P3PC 1KX3A 3B0BA 3C1BC 4XZQA 3W97C 3AYWC 5FUGA 3UT9C 2F8NG 3REKD 1KX5A 1KU5A 4HGAC 2CV5B 5BT1D 5GXQA 4X23C 1TZYA 2AROA 3KXBC 1JFIB 2RIQA 3MGSC 3C1CD 3MGPB 1F66D 3VH5W 5B0ZA 5CPJB 4QLCC 3B6FB 4JJNC 1AOID 3H0MC 1BH8B 3AV2C 1ZLAB 5B1MA 3X1UC 1P3PA 4H9NA 3X1VA 2Y2KA 4H9PA 3B6GD 3AL0C 3W97A 3MVDB 3AYWA 3UT9A 4YM6D 5C3IB 3MNNA 4J8WB 5CPKC 5B0YB 3KXBA 3AZID 5AV5D 5BO0B 5GT0C 5B40C 3UTAD 3MGSA 4DRBA 4ZBJC 2DQNC 1H3OA 3AZGD 3VH5T 5GSUB 1WWSA 4Z2MH 4QLCA 2PYOD 5DNMA 5B32D 4JJNA 2FFFB 5BNVA 1P3IC 3TU4D 5B2IA 2ZY3A 5AV8A 5KDMA 3MVDC 1KX4D 3X1SD 1ID3D 3A1IA 1HQ3D 3AV1C 4J8WC 5CPKA 2IO5C 3EPJA 2Y2GA 3KUYD 5GT3B 3REIA 3AZNA 3REJC 5GT0A 3AN2C 5B40A 1HTAA 1P3KB 5DNNB 1EQZD 1P3MD 3W99B 5B33C 1P3BD 3WA9C 3W96B 1P3IA 3V9RB 3A1KA 4WNNA 3MGRB 5AVCB 3MVDA 3KWQB 2W8SA 3AV1A 1TAFB 3WTPD 3LZ0D 4H9SA 5GT3C 2Y2NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M18 D;  3REJ A;  4NE3 A;  3X1U D;  5AVB B;  3AN2 A;  1KX3 B;  4KUD C;  3AZF C;  5DNN C;  4XZQ B;  5FUG B;  1KX5 B;  2CV5 D;  5B33 A;  5GXQ B;  1M1A A;  3WA9 A;  4Z66 C;  3W96 C;  2ARO B;  2YFV A;  3MGR C;  5AVC C;  3WKJ B;  3MGP D;  2BYM B;  5CPJ D;  5B0Z B;  5F99 C;  4LD9 D;  3UTB C;  3B6F D;  5GT3 A;  1P34 C;  1ZLA D;  1P3P B;  3AZM C;  4H9N B;  4KUD A;  4J8X C;  3X1V B;  4H9P B;  3AZF A;  3W97 B;  4NE5 A;  5B1L C;  3AYW B;  1P3A A;  4WU9 C;  3UT9 B;  3MNN B;  4H9Q A;  5B0Y D;  3REH B;  1P3L C;  3AZL A;  2FJ7 A;  4Z66 A;  3W96 A;  3KXB B;  3AZJ B;  3REK A;  3X1T D;  3WKJ C;  1P3O D;  3MGS B;  1H3O B;  5F99 A;  5GSU D;  4XUJ C;  4QLC B;  3UTB A;  5B2J D;  1P3G C;  2F8N K;  5DNM B;  1P34 A;  5G49 A;  2RVQ D;  4JJN B;  5BNV B;  5CPI C;  5B2I B;  4WU8 A;  3AZM A;  4J8X A;  5AV8 B;  3X1V C;  5KDM B;  1S32 D;  5B1L A;  4WU9 A;  3MNN C;  5CPK B;  1P3L A;  3REH C;  3VH5 A;  5E5A D;  3REI B;  4M6B A;  3AZN B;  3LZ1 C;  1R4V A;  3AZJ C;  4YM6 A;  5GT0 B;  3A6N C;  4KGC A;  5B40 B;  3WKJ A;  1P3K D;  3VH6 A;  3AFA D;  4ZBJ B;  5JRG C;  4ZUX C;  2BYM A;  3W99 D;  4XUJ A;  3AZI A;  1P3G A;  5DNM C;  3O62 D;  4H9R A;  2NZD C;  1P3I B;  5CPI A;  5B2I C;  3W98 C;  5AV8 C;  4WNN B;  3MGR D;  4J8U C;  4YS3 C;  3KWQ D;  3AV1 B;  4J8V D;  2IO5 B;  5B32 A;  3REH A;  5AV9 C;  3LEL D;  3REI C;  5BNX A;  1U35 C;  3AZN C;  3LZ1 A;  3REJ B;  3X1S A;  3AZJ A;  5AVB D;  1ID3 A;  3A6N A;  2F8N A;  3AN2 B;  1KX3 D;  3REL A;  5JRG A;  4XZQ D;  4ZUX A;  1KX5 D;  3WAA C;  5B33 B;  3B0D C;  5GXQ D;  1M1A B;  3WA9 B;  1TZY D;  2ARO D;  2NZD A;  3MGQ C;  2YFV B;  1M19 D;  3W98 A;  1EQZ A;  1P3M A;  4J8U A;  4YS3 A;  1P3F C;  4R8P C;  3AZK B;  5B0Z D;  4H9S C;  5AV9 A;  2F8N H;  2HIO D;  4WV4 B;  4Z5T A;  3LJA C;  1U35 A;  5B1M D;  1P3P D;  4KUD B;  3X1V D;  5B24 C;  3C1B D;  3AZF B;  3W97 D;  3AYW D;  1P3A B;  3UT9 D;  3MNN D;  3WAA A;  2NQB B;  4H9Q B;  3AZL B;  2FJ7 B;  4X23 D;  1M1A C;  4Z66 B;  3MGQ A;  3KXB D;  4WZS B;  3REK B;  1P3F A;  3MGS D;  4R8P A;  3AZH C;  5AV6 C;  4G92 C;  3AZK C;  5F99 B;  4QLC D;  3UTB B;  5DNM D;  1P34 B;  5G49 B;  3LJA A;  4JJN D;  3AV2 D;  5B2I D;  4WU8 B;  3AZM B;  5AV8 D;  5B24 A;  4J8X B;  3AZE A;  5B1L B;  1P3A C;  4LD9 A;  4WU9 B;  5B31 C;  5CPK D;  2NQB C;  1P3L B;  2CWE A;  3AZL C;  2FJ7 C;  3REI D;  3AZN D;  3B6G B;  1N1J A;  4EO5 B;  4YM6 B;  5GT0 D;  5B40 D;  3REK C;  4KGC B;  5CP6 A;  3AZH A;  5AV6 A;  5BT1 C;  3AZK A;  5JA4 A;  4XUJ B;  3AZI B;  1P3G B;  2JSS A;  2HUE C;  4H9R B;  1P3I D;  3X1T A;  5CPI B;  3NQU A;  1P3O A;  4WU8 C;  3C1C C;  4CAY A;  3MVD D;  5B31 A;  3AV1 D;  2PYO B;  5B2J A;  4J8W D;  2NQB A;  5AY8 A;  5B32 B;  1BFM A;  1AOI C;  4G91 B;  3KSY A;  5BNX B;  3B6G C;  5CHL B;  3LZ1 B;  3REJ D;  1BH9 B;  3X1S B;  1ID3 B;  2F8N B;  4EO5 C;  3NQJ A;  4YM6 C;  3A6N B;  3AN2 D;  4KGC C;  3REL B;  5JRG B;  5E5A A;  4ZUX B;  4DRA A;  2L5A A;  3AZI C;  5B33 D;  5AV5 C;  3WA9 D;  2NZD B;  3UTA C;  3C1C A;  3W98 B;  1EQZ B;  1F1E A;  1P3M B;  1F66 A;  4J8U B;  4YS3 B;  3AZG C;  2PYO C;  5B32 C;  3R45 A;  3O62 A;  1P3B B;  1AOI A;  5AV9 B;  4E45 A;  5GT3 D;  4G91 C;  2BYK A;  3B0C T;  4Z5T B;  1U35 B;  3B6G A;  1KX4 C;  3X1S C;  1ID3 C;  4Z2M G;  1HQ3 C;  4KUD D;  4J8V A;  3REL C;  3AZF D;  5DNN D;  1P3A D;  3LEL A;  3WAA B;  3B0D B;  5AV5 A;  3AZL D;  2FJ7 D;  1Q9C A;  4Z66 D;  3W96 D;  3MGQ B;  3UTA A;  1EQZ C;  1P3M C;  4KHA A;  5AVC D;  3AZG A;  4CSR A;  1P3F B;  4AWL C;  4R8P B;  2PYO A;  1P3B C;  5F99 D;  3TU4 A;  3UTB D;  1M19 A;  1P34 D;  4UUZ A;  4Z5T C;  3LJA B;  1KX4 A;  1BH9 A;  4WU8 D;  1HQ3 A;  3AZM D;  4J8X D;  5B24 B;  3WTP C;  3AZE B;  5B1L D;  3LZ0 C;  4LD9 B;  4WU9 D;  2HIO A;  3KUY A;  1P3L D;  1M18 C;  3VH6 W;  2LY8 A;  3C1B A;  1N1J B;  4KGC D;  3WKJ D;  5CP6 B;  1WWI A;  2CV5 C;  3AZH B;  5AV6 B;  4G92 B;  2YFW A;  4X23 A;  1P3B A;  5JA4 B;  4XUJ D;  1P3G D;  4H9O A;  5CPI D;  3X1T B;  3NQU B;  1P3O B;  3MGP C;  4CAY B;  3WTP A;  3AZE C;  3LZ0 A;  4NFT A;  5CPJ C;  4LD9 C;  5B31 B;  3B6F C;  5B2J B;  5BS7 C;  5AY8 B;  3REH D;  1M18 A;  3AV2 A;  1ZLA C;  3X1U A;  3VH6 T;  3LZ1 D;  1S32 B;  3AZJ D;  2F8N D;  3A6N D;  3NQJ B;  5C3I C;  3REL D;  5CP6 C;  5B0Y C;  5JRG D;  2CV5 A;  5E5A B;  4ZUX D;  1JFI A;  2HUE B;  2NZD D;  3X1T C;  1P3O C;  3AFA B;  3C1C B;  3MGP A;  3W98 D;  1F66 B;  4J8U D;  4YS3 D;  5CPJ A;  5GSU C;  3B6F A;  5B2J C;  5BS7 A;  2RVQ C;  5AY8 C;  3R45 B;  3O62 B;  1A7W A;  5AV9 D;  1BH8 A;  1AOI B;  1ZLA A;  4Z5T D;  2BYK B;  1U35 D;  1S32 C;  4J8W A;  4J8V B;  5B0Y A;  5E5A C;  3LEL B;  5B31 G;  3WAA D;  4E44 A;  5AV5 B;  5BO0 A;  3MGQ D;  3UTA B;  1P3K C;  3AFA C;  1F66 C;  4KHA B;  1P3F D;  3AZG B;  4CSR B;  5GSU A;  1ULY A;  3W99 C;  4R8P D;  3O62 C;  1TZY B;  3B0C W;  3TU4 B;  1M19 B;  4UUZ B;  3LJA D;  1S32 A;  3KWQ C;  1KX4 B;  1HQ3 B;  5B24 D;  4J8V C;  3AZE D;  3LEL C;  2HIO B;  3KUY B;  1B67 A;  1M1A D;  5B1M B;  5AVB C;  4NE6 A;  1KX3 C;  1P3K A;  3AFA A;  5DNN A;  3C1B B;  4XZQ C;  1KX5 C;  4AWL B;  5CP6 D;  3W99 A;  4HGA B;  3AZH D;  5AV6 D;  3AZK D;  5GXQ C;  2YFW B;  4X23 B;  1TZY C;  2ARO C;  3TU4 C;  3V9R A;  1M19 C;  3MGR A;  5AVC A;  4H9O B;  3KWQ A;  1TAF A;  3WTP B;  1B6W A;  5B0Z C;  3LZ0 B;  5B31 D;  2HIO C;  3KUY C;  2NQB D;  5AY8 D;  1M18 B;  5B32 G;  3AV2 B;  3WTP E;  5B1M C;  5AVB A;  3X1U B;  1P3P C;  1KX3 A;  3B0B A;  3C1B C;  4XZQ A;  3W97 C;  3AYW C;  5FUG A;  3UT9 C;  2F8N G;  3REK D;  1KX5 A;  1KU5 A;  4HGA C;  2CV5 B;  5BT1 D;  5GXQ A;  4X23 C;  1TZY A;  2ARO A;  3KXB C;  1JFI B;  3MGS C;  3C1C D;  3MGP B;  1F66 D;  3VH5 W;  5B0Z A;  5CPJ B;  4QLC C;  3B6F B;  4JJN C;  1AOI D;  3AV2 C;  1BH8 B;  1ZLA B;  5B1M A;  3X1U C;  1P3P A;  4H9N A;  3X1V A;  4H9P A;  3B6G D;  3W97 A;  3MVD B;  3AYW A;  3UT9 A;  4YM6 D;  5C3I B;  3MNN A;  4J8W B;  5CPK C;  5B0Y B;  3KXB A;  3AZI D;  5AV5 D;  5BO0 B;  5GT0 C;  5B40 C;  3UTA D;  3MGS A;  4DRB A;  4ZBJ C;  1H3O A;  3AZG D;  3VH5 T;  5GSU B;  1WWS A;  4Z2M H;  4QLC A;  2PYO D;  5DNM A;  5B32 D;  4JJN A;  5BNV A;  1P3I C;  3TU4 D;  5B2I A;  5AV8 A;  5KDM A;  3MVD C;  1KX4 D;  3X1S D;  1ID3 D;  1HQ3 D;  3AV1 C;  4J8W C;  5CPK A;  2IO5 C;  3KUY D;  5GT3 B;  3REI A;  3AZN A;  3REJ C;  5GT0 A;  3AN2 C;  5B40 A;  1HTA A;  1P3K B;  5DNN B;  1EQZ D;  1P3M D;  3W99 B;  5B33 C;  1P3B D;  3WA9 C;  3W96 B;  1P3I A;  3V9R B;  4WNN A;  3MGR B;  5AVC B;  3MVD A;  3KWQ B;  3AV1 A;  1TAF B;  3WTP D;  3LZ0 D;  4H9S A;  5GT3 C; 
#chains in the Genus database with same CATH topology
 1M18 D;  3REJ A;  4NE3 A;  3X1U D;  5AVB B;  3AN2 A;  1KX3 B;  4KUD C;  2J8P A;  3AZF C;  5DNN C;  4XZQ B;  5FUG B;  1KX5 B;  2CV5 D;  5B33 A;  2G5H C;  5GXQ B;  1M1A A;  3WA9 A;  4Z66 C;  3W96 C;  2ARO B;  2YFV A;  3MGR C;  5AVC C;  2Y2Q A;  3WKJ B;  3MGP D;  2BYM B;  5CPJ D;  5B0Z B;  5F99 C;  4LD9 D;  3UTB C;  3B6F D;  5GT3 A;  1P34 C;  1ZLA D;  1P3P B;  3AZM C;  4H9N B;  4KUD A;  4J8X C;  3X1V B;  4H9P B;  3AZF A;  3W97 B;  4NE5 A;  5B1L C;  3AYW B;  1P3A A;  4WU9 C;  3UT9 B;  3MNN B;  4H9Q A;  5B0Y D;  3REH B;  1P3L C;  3AZL A;  2G5I C;  2FJ7 A;  4Z66 A;  3W96 A;  3KXB B;  3AZJ B;  3REK A;  3X1T D;  3WKJ C;  1P3O D;  3MGS B;  1H3O B;  5F99 A;  5GSU D;  4XUJ C;  4QLC B;  3UTB A;  5B2J D;  1P3G C;  2F8N K;  5DNM B;  1P34 A;  5G49 A;  2RVQ D;  4JJN B;  5BNV B;  5CPI C;  5B2I B;  4WU8 A;  3AZM A;  4J8X A;  5AV8 B;  3X1V C;  5KDM B;  1S32 D;  5B1L A;  3EPK A;  4WU9 A;  2ZY5 A;  3MNN C;  5CPK B;  1P3L A;  3REH C;  3VH5 A;  5E5A D;  1Z2C B;  3REI B;  4M6B A;  2Y2O A;  3AZN B;  3LZ1 C;  1R4V A;  3AZJ C;  5GT0 B;  4YM6 A;  3A6N C;  4KGC A;  5B40 B;  3WKJ A;  1P3K D;  3VH6 A;  3AFA D;  5JRG C;  4ZBJ B;  4ZUX C;  2BYM A;  3W99 D;  4XUJ A;  3AZI A;  1P3G A;  5DNM C;  3O62 D;  2JE5 A;  4H9R A;  2NZD C;  1P3I B;  5CPI A;  5B2I C;  3W98 C;  5AV8 C;  2XD1 A;  4WNN B;  3MGR D;  4J8U C;  4YS3 C;  3KWQ D;  3AV1 B;  4J8V D;  2IO5 B;  5B32 A;  3REH A;  5AV9 C;  3LEL D;  3REI C;  3H0L C;  5BNX A;  1U35 C;  3AZN C;  3LZ1 A;  3REJ B;  3X1S A;  3AZJ A;  5AVB D;  1ID3 A;  3A6N A;  2F8N A;  3AN2 B;  1KX3 D;  3REL A;  5JRG A;  4XZQ D;  4ZUX A;  1KX5 D;  3WAA C;  2VQR A;  5B33 B;  3B0D C;  5GXQ D;  1M1A B;  3WA9 B;  1TZY D;  2ARO D;  2NZD A;  3MGQ C;  2YFV B;  1M19 D;  3W98 A;  1EQZ A;  1P3M A;  4J8U A;  4YS3 A;  1P3F C;  4R8P C;  3AZK B;  5B0Z D;  4H9S C;  5AV9 A;  2F8N H;  2HIO D;  4WV4 B;  4Z5T A;  3LJA C;  1U35 A;  5B1M D;  1P3P D;  3P5J B;  4KUD B;  3X1V D;  5B24 C;  3C1B D;  3AZF B;  3W97 D;  3AYW D;  1P3A B;  3UT9 D;  2UWX A;  3MNN D;  3WAA A;  2NQB B;  4H9Q B;  3AZL B;  2FJ7 B;  4X23 D;  1M1A C;  4Z66 B;  3MGQ A;  3KXB D;  4WZS B;  3REK B;  1P3F A;  3MGS D;  4R8P A;  3AZH C;  5AV6 C;  2Y2L A;  4G92 C;  3AZK C;  2XD5 A;  5F99 B;  4QLC D;  3UTB B;  5DNM D;  1P34 B;  5G49 B;  3LJA A;  4JJN D;  3AV2 D;  5B2I D;  4WU8 B;  3AZM B;  3FDD A;  5AV8 D;  5B24 A;  4J8X B;  3AZE A;  5B1L B;  1P3A C;  4LD9 A;  4WU9 B;  5B31 C;  2ZY2 A;  5CPK D;  2NQB C;  1P3L B;  2CWE A;  3AZL C;  2FJ7 C;  3REI D;  3AZN D;  3B6G B;  1N1J A;  4EO5 B;  4YM6 B;  5GT0 D;  5B40 D;  3REK C;  4KGC B;  5CP6 A;  3AZH A;  5AV6 A;  5BT1 C;  3AZK A;  5JA4 A;  4XUJ B;  3AZI B;  1P3G B;  2JSS A;  2HUE C;  4H9R B;  1P3I D;  3X1T A;  5CPI B;  3NQU A;  1P3O A;  4WU8 C;  3C1C C;  4CAY A;  3MVD D;  5B31 A;  3AV1 D;  2PYO B;  5B2J A;  4J8W D;  2NQB A;  4UPK A;  5AY8 A;  5B32 B;  1BFM A;  1AOI C;  2JCH A;  4G91 B;  3KSY A;  2Y2I A;  5BNX B;  3B6G C;  5CHL B;  3LZ1 B;  3REJ D;  1BH9 B;  3X1S B;  1ID3 B;  2F8N B;  4EO5 C;  3NQJ A;  4YM6 C;  3A6N B;  3AN2 D;  4KGC C;  3REL B;  5JRG B;  5E5A A;  4ZUX B;  4DRA A;  2L5A A;  3AZI C;  5B33 D;  5AV5 C;  3WA9 D;  2NZD B;  3UTA C;  3C1C A;  3W98 B;  1EQZ B;  1F1E A;  1P3M B;  1F66 A;  4J8U B;  4YS3 B;  3AZG C;  2PYO C;  5B32 C;  3R45 A;  3O62 A;  3EG5 B;  1P3B B;  1AOI A;  5AV9 B;  4E45 A;  5GT3 D;  4G91 C;  2BYK A;  3B0C T;  4Z5T B;  1U35 B;  3B6G A;  1KX4 C;  3X1S C;  1ID3 C;  4Z2M G;  1HQ3 C;  4KUD D;  4J8V A;  3REL C;  3AZF D;  5DNN D;  1P3A D;  3LEL A;  3WAA B;  3B0D B;  5AV5 A;  3AZL D;  2FJ7 D;  1Q9C A;  4Z66 D;  3W96 D;  3MGQ B;  3UTA A;  1EQZ C;  1P3M C;  4KHA A;  5AVC D;  3AZG A;  4CSR A;  1P3F B;  4AWL C;  4R8P B;  2PYO A;  4WJ3 C;  1P3B C;  5F99 D;  3TU4 A;  3UTB D;  1M19 A;  1P34 D;  2Y2M A;  4UUZ A;  4Z5T C;  3LJA B;  1KX4 A;  1BH9 A;  4WU8 D;  1HQ3 A;  3F6T A;  3AZM D;  4J8X D;  5B24 B;  3WTP C;  3AZE B;  5B1L D;  3LZ0 C;  4LD9 B;  4WU9 D;  2HIO A;  3KUY A;  1P3L D;  1M18 C;  2Y2P A;  3H0R C;  3VH6 W;  2LY8 A;  3C1B A;  2BG1 A;  1N1J B;  4KGC D;  3WKJ D;  5CP6 B;  1WWI A;  2CV5 C;  3AZH B;  5AV6 B;  4G92 B;  2YFW A;  4X23 A;  1P3B A;  5JA4 B;  4XUJ D;  1P3G D;  2ZY4 A;  4H9O A;  5CPI D;  3X1T B;  3NQU B;  1P3O B;  3MGP C;  4CAY B;  3WTP A;  3AZE C;  3LZ0 A;  4NFT A;  2Y2J A;  5CPJ C;  5B31 B;  4LD9 C;  1T3U A;  3B6F C;  5B2J B;  5BS7 C;  5AY8 B;  3REH D;  1M18 A;  3AV2 A;  1ZLA C;  3X1U A;  3VH6 T;  3LZ1 D;  1S32 B;  3AZJ D;  2F8N D;  3A6N D;  3NQJ B;  5C3I C;  3REL D;  5CP6 C;  5B0Y C;  4DQY B;  5JRG D;  2CV5 A;  5E5A B;  4ZUX D;  1JFI A;  2HUE B;  2NZD D;  3X1T C;  1P3O C;  3AFA B;  3C1C B;  3MGP A;  3W98 D;  1F66 B;  4J8U D;  2DF4 C;  4YS3 D;  5CPJ A;  5GSU C;  3B6F A;  5B2J C;  5BS7 A;  2RVQ C;  5AY8 C;  3R45 B;  3O62 B;  1A7W A;  1BH8 A;  5AV9 D;  1AOI B;  1ZLA A;  2Y2H A;  4Z5T D;  2BYK B;  1U35 D;  1S32 C;  4J8W A;  4J8V B;  5B0Y A;  3KFU G;  5E5A C;  3LEL B;  1W2E A;  5B31 G;  3WAA D;  3EPH A;  4E44 A;  5AV5 B;  5BO0 A;  3MGQ D;  3UTA B;  1P3K C;  3AFA C;  1F66 C;  4KHA B;  1P3F D;  3AZG B;  4CSR B;  5GSU A;  1ULY A;  3W99 C;  4R8P D;  3O62 C;  1TZY B;  3B0C W;  3IP4 C;  3TU4 B;  2F2A C;  1M19 B;  4UUZ B;  3LJA D;  1S32 A;  3KWQ C;  1KX4 B;  1HQ3 B;  5B24 D;  4J8V C;  3AZE D;  3LEL C;  2HIO B;  3KUY B;  1B67 A;  1M1A D;  5B1M B;  5AVB C;  3EPL A;  4NE6 A;  1KX3 C;  1P3K A;  3AFA A;  5DNN A;  3C1B B;  4XZQ C;  1PZR A;  1KX5 C;  4AWL B;  5CP6 D;  3W99 A;  4HGA B;  2ZM5 A;  3AZH D;  5AV6 D;  3AZK D;  5GXQ C;  2YFW B;  4X23 B;  1TZY C;  2ARO C;  3TU4 C;  3V9R A;  1M19 C;  3MGR A;  5AVC A;  4H9O B;  3KWQ A;  1TAF A;  3WTP B;  1B6W A;  5B0Z C;  3LZ0 B;  5B31 D;  2HIO C;  3KUY C;  2NQB D;  5AY8 D;  1M18 B;  5B32 G;  3AV2 B;  3WTP E;  5B1M C;  5AVB A;  3X1U B;  1P3P C;  1KX3 A;  3B0B A;  3C1B C;  4XZQ A;  3W97 C;  3AYW C;  5FUG A;  3UT9 C;  2F8N G;  3REK D;  1KX5 A;  1KU5 A;  4HGA C;  2CV5 B;  5BT1 D;  5GXQ A;  4X23 C;  1TZY A;  2ARO A;  3KXB C;  1JFI B;  2RIQ A;  3MGS C;  3C1C D;  3MGP B;  1F66 D;  3VH5 W;  5B0Z A;  5CPJ B;  4QLC C;  3B6F B;  4JJN C;  1AOI D;  3H0M C;  1BH8 B;  3AV2 C;  1ZLA B;  5B1M A;  3X1U C;  1P3P A;  4H9N A;  3X1V A;  2Y2K A;  4H9P A;  3B6G D;  3AL0 C;  3W97 A;  3MVD B;  3AYW A;  3UT9 A;  4YM6 D;  5C3I B;  3MNN A;  4J8W B;  5CPK C;  5B0Y B;  3KXB A;  3AZI D;  5AV5 D;  5BO0 B;  5GT0 C;  5B40 C;  3UTA D;  3MGS A;  4DRB A;  4ZBJ C;  2DQN C;  1H3O A;  3AZG D;  3VH5 T;  5GSU B;  1WWS A;  4Z2M H;  4QLC A;  2PYO D;  5DNM A;  5B32 D;  4JJN A;  2FFF B;  5BNV A;  1P3I C;  3TU4 D;  5B2I A;  2ZY3 A;  5AV8 A;  5KDM A;  3MVD C;  1KX4 D;  3X1S D;  1ID3 D;  3A1I A;  1HQ3 D;  3AV1 C;  4J8W C;  5CPK A;  2IO5 C;  3EPJ A;  2Y2G A;  3KUY D;  5GT3 B;  3REI A;  3AZN A;  3REJ C;  5GT0 A;  3AN2 C;  5B40 A;  1HTA A;  1P3K B;  5DNN B;  1EQZ D;  1P3M D;  3W99 B;  5B33 C;  1P3B D;  3WA9 C;  3W96 B;  1P3I A;  3V9R B;  3A1K A;  4WNN A;  3MGR B;  5AVC B;  3MVD A;  3KWQ B;  2W8S A;  3AV1 A;  1TAF B;  3WTP D;  3LZ0 D;  4H9S A;  5GT3 C;  2Y2N A; 
#chains in the Genus database with same CATH homology
 1M18 D;  3REJ A;  4NE3 A;  3X1U D;  5AVB B;  3AN2 A;  1KX3 B;  4KUD C;  2J8P A;  3AZF C;  5DNN C;  4XZQ B;  5FUG B;  1KX5 B;  2CV5 D;  5B33 A;  2G5H C;  5GXQ B;  1M1A A;  3WA9 A;  4Z66 C;  3W96 C;  2ARO B;  2YFV A;  3MGR C;  5AVC C;  2Y2Q A;  3WKJ B;  3MGP D;  2BYM B;  5CPJ D;  5B0Z B;  5F99 C;  4LD9 D;  3UTB C;  3B6F D;  5GT3 A;  1P34 C;  1ZLA D;  1P3P B;  3AZM C;  4H9N B;  4KUD A;  4J8X C;  3X1V B;  4H9P B;  3AZF A;  3W97 B;  4NE5 A;  5B1L C;  3AYW B;  1P3A A;  4WU9 C;  3UT9 B;  3MNN B;  4H9Q A;  5B0Y D;  3REH B;  1P3L C;  3AZL A;  2G5I C;  2FJ7 A;  4Z66 A;  3W96 A;  3KXB B;  3AZJ B;  3REK A;  3X1T D;  3WKJ C;  1P3O D;  3MGS B;  1H3O B;  5F99 A;  5GSU D;  4XUJ C;  4QLC B;  3UTB A;  5B2J D;  1P3G C;  2F8N K;  5DNM B;  1P34 A;  5G49 A;  2RVQ D;  4JJN B;  5BNV B;  5CPI C;  5B2I B;  4WU8 A;  3AZM A;  4J8X A;  5AV8 B;  3X1V C;  5KDM B;  1S32 D;  5B1L A;  3EPK A;  4WU9 A;  2ZY5 A;  3MNN C;  5CPK B;  1P3L A;  3REH C;  3VH5 A;  5E5A D;  1Z2C B;  3REI B;  4M6B A;  2Y2O A;  3AZN B;  3LZ1 C;  1R4V A;  3AZJ C;  5GT0 B;  4YM6 A;  3A6N C;  4KGC A;  5B40 B;  3WKJ A;  1P3K D;  3VH6 A;  3AFA D;  5JRG C;  4ZBJ B;  4ZUX C;  2BYM A;  3W99 D;  4XUJ A;  3AZI A;  1P3G A;  5DNM C;  3O62 D;  2JE5 A;  4H9R A;  2NZD C;  1P3I B;  5CPI A;  5B2I C;  3W98 C;  5AV8 C;  2XD1 A;  4WNN B;  3MGR D;  4J8U C;  4YS3 C;  3KWQ D;  3AV1 B;  4J8V D;  2IO5 B;  5B32 A;  3REH A;  5AV9 C;  3LEL D;  3REI C;  3H0L C;  5BNX A;  1U35 C;  3AZN C;  3LZ1 A;  3REJ B;  3X1S A;  3AZJ A;  5AVB D;  1ID3 A;  3A6N A;  2F8N A;  3AN2 B;  1KX3 D;  3REL A;  5JRG A;  4XZQ D;  4ZUX A;  1KX5 D;  3WAA C;  2VQR A;  5B33 B;  3B0D C;  5GXQ D;  1M1A B;  3WA9 B;  1TZY D;  2ARO D;  2NZD A;  3MGQ C;  2YFV B;  1M19 D;  3W98 A;  1EQZ A;  1P3M A;  4J8U A;  4YS3 A;  1P3F C;  4R8P C;  3AZK B;  5B0Z D;  4H9S C;  5AV9 A;  2F8N H;  2HIO D;  4WV4 B;  4Z5T A;  3LJA C;  1U35 A;  5B1M D;  1P3P D;  3P5J B;  4KUD B;  3X1V D;  5B24 C;  3C1B D;  3AZF B;  3W97 D;  3AYW D;  1P3A B;  3UT9 D;  2UWX A;  3MNN D;  3WAA A;  2NQB B;  4H9Q B;  3AZL B;  2FJ7 B;  4X23 D;  1M1A C;  4Z66 B;  3MGQ A;  3KXB D;  4WZS B;  3REK B;  1P3F A;  3MGS D;  4R8P A;  3AZH C;  5AV6 C;  2Y2L A;  4G92 C;  3AZK C;  2XD5 A;  5F99 B;  4QLC D;  3UTB B;  5DNM D;  1P34 B;  5G49 B;  3LJA A;  4JJN D;  3AV2 D;  5B2I D;  4WU8 B;  3AZM B;  3FDD A;  5AV8 D;  5B24 A;  4J8X B;  3AZE A;  5B1L B;  1P3A C;  4LD9 A;  4WU9 B;  5B31 C;  2ZY2 A;  5CPK D;  2NQB C;  1P3L B;  2CWE A;  3AZL C;  2FJ7 C;  3REI D;  3AZN D;  3B6G B;  1N1J A;  4EO5 B;  4YM6 B;  5GT0 D;  5B40 D;  3REK C;  4KGC B;  5CP6 A;  3AZH A;  5AV6 A;  5BT1 C;  3AZK A;  5JA4 A;  4XUJ B;  3AZI B;  1P3G B;  2JSS A;  2HUE C;  4H9R B;  1P3I D;  3X1T A;  5CPI B;  3NQU A;  1P3O A;  4WU8 C;  3C1C C;  4CAY A;  3MVD D;  5B31 A;  3AV1 D;  2PYO B;  5B2J A;  4J8W D;  2NQB A;  4UPK A;  5AY8 A;  5B32 B;  1BFM A;  1AOI C;  2JCH A;  4G91 B;  3KSY A;  2Y2I A;  5BNX B;  3B6G C;  5CHL B;  3LZ1 B;  3REJ D;  1BH9 B;  3X1S B;  1ID3 B;  2F8N B;  4EO5 C;  3NQJ A;  4YM6 C;  3A6N B;  3AN2 D;  4KGC C;  3REL B;  5JRG B;  5E5A A;  4ZUX B;  4DRA A;  2L5A A;  3AZI C;  5B33 D;  5AV5 C;  3WA9 D;  2NZD B;  3UTA C;  3C1C A;  3W98 B;  1EQZ B;  1F1E A;  1P3M B;  1F66 A;  4J8U B;  4YS3 B;  3AZG C;  2PYO C;  5B32 C;  3R45 A;  3O62 A;  3EG5 B;  1P3B B;  1AOI A;  5AV9 B;  4E45 A;  5GT3 D;  4G91 C;  2BYK A;  3B0C T;  4Z5T B;  1U35 B;  3B6G A;  1KX4 C;  3X1S C;  1ID3 C;  4Z2M G;  1HQ3 C;  4KUD D;  4J8V A;  3REL C;  3AZF D;  5DNN D;  1P3A D;  3LEL A;  3WAA B;  3B0D B;  5AV5 A;  3AZL D;  2FJ7 D;  1Q9C A;  4Z66 D;  3W96 D;  3MGQ B;  3UTA A;  1EQZ C;  1P3M C;  4KHA A;  5AVC D;  3AZG A;  4CSR A;  1P3F B;  4AWL C;  4R8P B;  2PYO A;  4WJ3 C;  1P3B C;  5F99 D;  3TU4 A;  3UTB D;  1M19 A;  1P34 D;  2Y2M A;  4UUZ A;  4Z5T C;  3LJA B;  1KX4 A;  1BH9 A;  4WU8 D;  1HQ3 A;  3F6T A;  3AZM D;  4J8X D;  5B24 B;  3WTP C;  3AZE B;  5B1L D;  3LZ0 C;  4LD9 B;  4WU9 D;  2HIO A;  3KUY A;  1P3L D;  1M18 C;  2Y2P A;  3H0R C;  3VH6 W;  2LY8 A;  3C1B A;  2BG1 A;  1N1J B;  4KGC D;  3WKJ D;  5CP6 B;  1WWI A;  2CV5 C;  3AZH B;  5AV6 B;  4G92 B;  2YFW A;  4X23 A;  1P3B A;  5JA4 B;  4XUJ D;  1P3G D;  2ZY4 A;  4H9O A;  5CPI D;  3X1T B;  3NQU B;  1P3O B;  3MGP C;  4CAY B;  3WTP A;  3AZE C;  3LZ0 A;  4NFT A;  2Y2J A;  5CPJ C;  5B31 B;  4LD9 C;  1T3U A;  3B6F C;  5B2J B;  5BS7 C;  5AY8 B;  3REH D;  1M18 A;  3AV2 A;  1ZLA C;  3X1U A;  3VH6 T;  3LZ1 D;  1S32 B;  3AZJ D;  2F8N D;  3A6N D;  3NQJ B;  5C3I C;  3REL D;  5CP6 C;  5B0Y C;  4DQY B;  5JRG D;  2CV5 A;  5E5A B;  4ZUX D;  1JFI A;  2HUE B;  2NZD D;  3X1T C;  1P3O C;  3AFA B;  3C1C B;  3MGP A;  3W98 D;  1F66 B;  4J8U D;  2DF4 C;  4YS3 D;  5CPJ A;  5GSU C;  3B6F A;  5B2J C;  5BS7 A;  2RVQ C;  5AY8 C;  3R45 B;  3O62 B;  1A7W A;  1BH8 A;  5AV9 D;  1AOI B;  1ZLA A;  2Y2H A;  4Z5T D;  2BYK B;  1U35 D;  1S32 C;  4J8W A;  4J8V B;  5B0Y A;  3KFU G;  5E5A C;  3LEL B;  1W2E A;  5B31 G;  3WAA D;  3EPH A;  4E44 A;  5AV5 B;  5BO0 A;  3MGQ D;  3UTA B;  1P3K C;  3AFA C;  1F66 C;  4KHA B;  1P3F D;  3AZG B;  4CSR B;  5GSU A;  1ULY A;  3W99 C;  4R8P D;  3O62 C;  1TZY B;  3B0C W;  3IP4 C;  3TU4 B;  2F2A C;  1M19 B;  4UUZ B;  3LJA D;  1S32 A;  3KWQ C;  1KX4 B;  1HQ3 B;  5B24 D;  4J8V C;  3AZE D;  3LEL C;  2HIO B;  3KUY B;  1B67 A;  1M1A D;  5B1M B;  5AVB C;  3EPL A;  4NE6 A;  1KX3 C;  1P3K A;  3AFA A;  5DNN A;  3C1B B;  4XZQ C;  1PZR A;  1KX5 C;  4AWL B;  5CP6 D;  3W99 A;  4HGA B;  2ZM5 A;  3AZH D;  5AV6 D;  3AZK D;  5GXQ C;  2YFW B;  4X23 B;  1TZY C;  2ARO C;  3TU4 C;  3V9R A;  1M19 C;  3MGR A;  5AVC A;  4H9O B;  3KWQ A;  1TAF A;  3WTP B;  1B6W A;  5B0Z C;  3LZ0 B;  5B31 D;  2HIO C;  3KUY C;  2NQB D;  5AY8 D;  1M18 B;  5B32 G;  3AV2 B;  3WTP E;  5B1M C;  5AVB A;  3X1U B;  1P3P C;  1KX3 A;  3B0B A;  3C1B C;  4XZQ A;  3W97 C;  3AYW C;  5FUG A;  3UT9 C;  2F8N G;  3REK D;  1KX5 A;  1KU5 A;  4HGA C;  2CV5 B;  5BT1 D;  5GXQ A;  4X23 C;  1TZY A;  2ARO A;  3KXB C;  1JFI B;  2RIQ A;  3MGS C;  3C1C D;  3MGP B;  1F66 D;  3VH5 W;  5B0Z A;  5CPJ B;  4QLC C;  3B6F B;  4JJN C;  1AOI D;  3H0M C;  1BH8 B;  3AV2 C;  1ZLA B;  5B1M A;  3X1U C;  1P3P A;  4H9N A;  3X1V A;  2Y2K A;  4H9P A;  3B6G D;  3AL0 C;  3W97 A;  3MVD B;  3AYW A;  3UT9 A;  4YM6 D;  5C3I B;  3MNN A;  4J8W B;  5CPK C;  5B0Y B;  3KXB A;  3AZI D;  5AV5 D;  5BO0 B;  5GT0 C;  5B40 C;  3UTA D;  3MGS A;  4DRB A;  4ZBJ C;  2DQN C;  1H3O A;  3AZG D;  3VH5 T;  5GSU B;  1WWS A;  4Z2M H;  4QLC A;  2PYO D;  5DNM A;  5B32 D;  4JJN A;  2FFF B;  5BNV A;  1P3I C;  3TU4 D;  5B2I A;  2ZY3 A;  5AV8 A;  5KDM A;  3MVD C;  1KX4 D;  3X1S D;  1ID3 D;  3A1I A;  1HQ3 D;  3AV1 C;  4J8W C;  5CPK A;  2IO5 C;  3EPJ A;  2Y2G A;  3KUY D;  5GT3 B;  3REI A;  3AZN A;  3REJ C;  5GT0 A;  3AN2 C;  5B40 A;  1HTA A;  1P3K B;  5DNN B;  1EQZ D;  1P3M D;  3W99 B;  5B33 C;  1P3B D;  3WA9 C;  3W96 B;  1P3I A;  3V9R B;  3A1K A;  4WNN A;  3MGR B;  5AVC B;  3MVD A;  3KWQ B;  2W8S A;  3AV1 A;  1TAF B;  3WTP D;  3LZ0 D;  4H9S A;  5GT3 C;  2Y2N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...