2AROA

Crystal structure of the native histone octamer to 2.1 angstrom resolution, crystalised in the presence of s-nitrosoglutathione
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
106
structure length
106
Chain Sequence
KAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H2A-IV
publication title The oxidised histone octamer does not form a H3 disulphide bond.
pubmed doi rcsb
molecule tags Structural protein
total genus 31
structure length 106
sequence length 106
chains with identical sequence E
ec nomenclature
pdb deposition date 2005-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00125 Histone Core histone H2A/H2B/H3/H4
A PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2aroA00
2CWEA 5B32D 3UTAC 1M19B 2PYOC 2NZDA 3WTPC 3LELA 3UT9C 2NQBD 3A6NA 4NE5A 2F8NG 3R45A 4J8WB 4Z5TD 3KWQD 2F8NK 1P3AD 1M19A 5AV9B 3W96A 1P34D 3LZ0B 5E5AD 3LJAA 1M1AD 3AZHC 1P3IB 5DNMD 4CSRA 4QLCC 1P3KD 3B0CT 1KX3B 3AYWD 5B0YB 5AV9A 3X1SB 1B67A 3LZ0A 4KHAB 3AFAB 5B32C 3AZJD 2FJ7D 3MGSD 3AV2A 2BYMB 3AN2D 3KUYD 5FUGB 2NQBC 5B0YA 5CPIB 4XUJB 1P3OD 4E44A 1F66B 5B31D 3B0DC 3UTBB 4Z5TC 5CPJC 4YM6D 2AROB 4CAYB 1AOID 4HGAC 3WAAB 2BYMA 3AZKD 1N1JA 5E5AC 1KU5A 1M1AC 1BFMA 5CPIA 4XUJA 3VH6A 3UTBA 3AYWC 5AV8D 1HQ3D 2AROA 3TU4A 3W99D 5B0ZD 3VH5A 3C1BC 3WAAA 3B6GA 5JA4A 3AZJC 2FJ7C 1U35B 1ZLAD 5CHLB 5B2JB 5AVBD 3AN2C 2CV5B 3KUYC 5GT0B 4G92B 3B0BA 5AV6C 5AVCD 1P3OC 4EO5B 1KX4C 5B31C 4DRBA 4H9PB 5B40D 4M6BA 4KGCD 1AOIC 3WTPA 4JJNB 3AZKC 3RELB 4WU8D 2CV5A 3W97C 3WKJD 1TZYD 2RVQC 4J8XB 5GSUD 3C1CB 4Z2MG 4DRAA 4X23D 1S32D 3MGPB 5AV8C 1HQ3C 4R8PD 4JJNA 5C3IB 3RELA 5DNNC 1P3LD 5GT3B 5B24C 1ZLAC 4QLCA 3B6FB 3NQUB 3MGPA 5F99D 4J8UA 5AY8B 5GXQA 5CPKB 1ID3D 1EQZD 5B40C 3MGQB 5B33C 5B32A 4KGCC 5B2ID 4WU8C 3WKJC 2HIOD 4Z66D 3O62D 1P3PB 3REKB 5CPKA 4XZQD 4X23C 3AZLD 3KXBB 3AZEB 3AZMB 4YS3B 3KWQA 1P3AA 4AWLC 2PYOD 1P34A 1M1AA 3AZGB 3VH6W 5DNMA 3X1VD 1P3PA 5B1MD 1P3KA 3AYWA 4H9QB 1P3GB 3VH5W 1H3OB 3W98D 1ID3C 1P3IC 1EQZC 1M18D 3AZJA 5B2IC 3MGSA 5BS7A 2L5AA 3AN2A 5CP6D 3LELB 3KUYA 3AZID 3AZFB 3O62C 4H9QA 3A6NB 1P3GA 1H3OA 3R45B 1KX5D 3AZND 4YM6A 4H9OA 3LZ1B 3X1UD 3REIB 3B0CW 3W96B 1F66C 5JRGD 4E45A 3LJAB 4H9RA 3AZFA 3X1VC 5B1MC 1TAFA 4J8VD 4CSRB 3MVDD 3X1TB 5CPJD 2F8ND 3W98C 3LZ1A 3REIA 3W99A 5B0ZA 1M18C 2YFWA 1P3MD 5B32G 1ZLAA 5AVBA 3AV2B 5CP6C 3AZIC 4WU9B 3X1TA 5AVCA 5GSUB 5B40A 1KX5C 3C1BD 3REJD 3AZNC 4KGCA 5GT0C 1P3BB 3X1UC 1P3FB 4EO5C 5JRGC 1N1JB 4WU9A 3REHB 2IO5B 3AV1D 1TZYA 4LD9B 5AV6D 4J8VC 5GSUA 1KX4D 4ZBJB 3WA9B 4G91B 1S32A 3MVDC 5F99B 3TU4B 1P3BA 1P3FA 4R8PA 4J8XC 3MNND 3C1CC 3B6GB 1P3LA 1P3MC 3W97D 5JA4B 3REHA 4KUDD 5AV5D 4LD9A 2RVQD 3WA9A 5F99A 5GT3C 2F8NH 2BYKB 1EQZA 3REJC 5DNND 4ZUXD 3UTAB 3KSYA 5B24D 3WTPB 5AY8C 2HIOA 3UT9B 3MGQC 4Z66A 3O62A 3AV1C 5B1LD 2BYKA 4XZQA 3MGRD 3AZLA 2NZDD 5B33D 3UTAA 2PYOA 3REKC 3MNNC 3UT9A 3KXBC 3AZHB 3AZMC 4KUDC 4YS3C 5AV5C 1M19D 4QLCB 4J8UB 3AZGC 1JFIA 5GXQB 4NE6A 1WWSA 3AZHA 5B32B 4ZUXC 4J8WD 1R4VA 5AV9D 3LZ0D 2NQBB 5B1LC 1P3ID 3MGRC 3B0DB 1KX5A 3AZNA 2NZDC 4Z5TB 1KX3D 3KWQB 1P3AB 5B0YD 4HGAB 1P34B 5E5AB 1M1AB 3X1SD 2NQBA 3AFAD 5DNMB 1M19C 1P3KB 4NE3A 3W96C 3AYWB 4Z5TA 5CPJA 4UUZB 5CPID 1F66D 5E5AA 3UTBD 3AZJB 4J8WC 2FJ7B 3MGSB 2AROD 3AN2B 5AV9C 3KUYB 2JSSA 4H9NA 5G49A 3WAAD 3LZ0C 5BNXB 4UUZA 1P3OB 1BH8A 5B31B 4Z2MH 3C1BA 3AV2C 4YM6B 1KX3C 4H9OB 2FJ7A 5B0YC 1AOIB 3AZKB 4NFTA 5BNVA 3W97B 4H9RB 3X1SC 3AFAC 5BNXA 5AV6A 1P3OA 1TAFB 1KX4A 5B31A 1U35D 5B2JD 2CV5D 5AV8B 1HQ3B 5GT0D 5CPIC 1AOIA 3W99B 4XUJC 5KDMB 5B0ZB 3AZKA 2YFWB 3W97A 1WWIA 3UTBC 4KUDA 5AV5A 5B24B 1ZLAB 2AROC 5AVBB 3TU4C 4JJND 3WAAC 3RELD 5AVCB 5AV8A 1HQ3A 5KDMA 5B40B 4J8XD 3C1CD 5DNNA 4ZUXA 4KGCB 5B24A 3MGPD 3VH6T 4WU8B 3WKJB 1TZYB 5B1LA 5GT3D 3VH5T 3MGRA 1U35C 4X23B 1S32B 5B2JC 2CV5C 5B33A 4AWLB 3B6FD 4G92C 4R8PB 5AY8D 5CPKD 4WU8A 3WKJA 1P3LB 3MGQD 4X23A 4JJNC 4WV4B 3RELC 1ID3B 1P3PD 3REKD 4H9SC 1EQZB 1ULYA 3KXBD 3V9RB 5BT1D 5B2IB 4YS3D 4J8WA 3AZMD 3MGPC 3AZED 4J8UC 5GXQC 2HIOB 2HUEB 4Z66B 5C3IC 3O62B 3AZGD 1ID3A 1P3IA 4XZQB 3AZLB 5B31G 1KX3A 3V9RA 5B2IA 3B6FC 2PYOB 1P3GD 5CPKC 4WZSB 3X1SA 1B6WA 4KHAA 3AFAA 3X1VB 5B1MB 3KWQC 1P3AC 1P34C 3LELD 5FUGA 1JFIB 3W98B 3AZFD 5DNMC 1P3PC 3A6ND 1M18B 1F66A 1P3KC 3AZEC 5BT1C 3X1VA 1HTAA 5B1MA 5CP6B 4CAYA 3LZ1D 4WNNB 3REID 3AZIB 3W96D 3LJAD 3W98A 3MGSC 2LY8A 5BS7C 1KX5B 3AZNB 1M18A 3X1TD 3X1UB 1P3GC 5JRGB 5CP6A 4WNNA 3AZIA 3WTPE 4YM6C 4J8VB 1U35A 5B2JA 3AV2D 3MVDB 3LELC 5CPJB 4WU9D 5GT0A 2F8NB 3AZFC 3X1UA 3A6NC 5JRGA 4H9PA 1P3MB 4J8VA 3LZ1C 1P3BD 3W99C 3REIC 5B0ZC 4H9NB 1P3FD 5G49B 3MVDA 3LJAC 2F8NA 1BH8B 1A7WA 3REHD 4LD9D 4H9SA 4J8XA 4XUJD 5AVBC 3C1BB 3REJB 3C1CA 3WA9D 1P3MA 5BO0B 3X1TC 1Q9CA 5AVCC 3TU4D 5BNVB 3B6GD 3AV1B 5AV6B 5GT3A 1KX4B 3NQJB 3REJA 4WU9C 5BO0A 3NQUA 3B6FA 1TZYC 5AY8A 3MNNB 5GSUC 1S32C 3MGQA 4KUDB 5AV5B 3AV1A 3UTAD 3NQJA 1P3BC 1P3FC 4R8PC 3WTPD 1P3LC 3UT9D 3REHC 2IO5C 3REKA 4LD9C 1F1EA 3MNNA 2YFVB 4ZBJC 3WA9C 5DNNB 4G91C 3KXBA 4ZUXB 3AZEA 3AZMA 4YS3A 1BH9B 5F99C 3B6GC 3AZGA 3AZHD 5B1LB 3MGRB 2NZDB 2YFVA 4QLCD 2HIOC 5B33B 2HUEC 4Z66C 1BH9A 4J8UD 5GXQD 4XZQC 3AZLC
chains in the Genus database with same CATH superfamily
2CWEA 1Z2CB 5B32D 3UTAC 1M19B 2PYOC 2NZDA 3WTPC 3LELA 3UT9C 2NQBD 3A6NA 4NE5A 2F8NG 3R45A 4J8WB 4Z5TD 3KWQD 2F8NK 1P3AD 1M19A 5AV9B 3W96A 1P34D 3LZ0B 5E5AD 3LJAA 3EG5B 3AZHC 1M1AD 2DF4C 1P3IB 5DNMD 4CSRA 4QLCC 1P3KD 3B0CT 1KX3B 3AYWD 5B0YB 5AV9A 3X1SB 1B67A 3LZ0A 4KHAB 3AFAB 5B32C 3AZJD 2FJ7D 3MGSD 3AV2A 2BYMB 3AN2D 3KUYD 5FUGB 2NQBC 5B0YA 5CPIB 4XUJB 1P3OD 4E44A 2Y2OA 5B31D 1F66B 2ZY2A 3B0DC 3UTBB 4Z5TC 5CPJC 4YM6D 2AROB 4CAYB 1AOID 4HGAC 3WAAB 2BYMA 3AZKD 1N1JA 5E5AC 1KU5A 1M1AC 1BFMA 5CPIA 4XUJA 3VH6A 3UTBA 3AYWC 2J8PA 2G5IC 5AV8D 1HQ3D 2AROA 3TU4A 3W99D 5B0ZD 3VH5A 3C1BC 3WAAA 3B6GA 5JA4A 1PZRA 3AZJC 2FJ7C 1U35B 1ZLAD 5CHLB 5B2JB 5AVBD 3AN2C 2CV5B 3KUYC 5GT0B 4G92B 3B0BA 1T3UA 5AV6C 5AVCD 4EO5B 1P3OC 5B31C 4DRBA 1KX4C 4H9PB 5B40D 3KFUG 4M6BA 4KGCD 2Y2QA 1AOIC 3WTPA 4JJNB 3AZKC 3RELB 4WU8D 2CV5A 3W97C 3WKJD 1TZYD 2RVQC 4J8XB 5GSUD 3C1CB 4Z2MG 4DRAA 4X23D 1S32D 3MGPB 5AV8C 1HQ3C 2F2AC 4R8PD 4JJNA 5C3IB 3RELA 5DNNC 1P3LD 5GT3B 5B24C 1ZLAC 4QLCA 3B6FB 3NQUB 3MGPA 5F99D 4J8UA 5AY8B 5GXQA 5CPKB 1ID3D 1EQZD 5B40C 3MGQB 5B33C 5B32A 4KGCC 5B2ID 1W2EA 4WU8C 3WKJC 2HIOD 2G5HC 4Z66D 3O62D 1P3PB 3REKB 5CPKA 4XZQD 3H0MC 4X23C 3KXBB 3AZEB 3AZLD 3AZMB 4YS3B 3KWQA 1P3AA 4AWLC 3AL0C 2PYOD 1P34A 1M1AA 3AZGB 2XD1A 3VH6W 5DNMA 3X1VD 1P3PA 5B1MD 1P3KA 3AYWA 4H9QB 1P3GB 3VH5W 1H3OB 3W98D 1ID3C 1P3IC 1EQZC 1M18D 3A1KA 5B2IC 3AZJA 3MGSA 5BS7A 2L5AA 3AN2A 5CP6D 3LELB 3KUYA 3AZID 2ZY5A 3AZFB 3O62C 4H9QA 3A6NB 1P3GA 1H3OA 3R45B 1KX5D 3AZND 4YM6A 4H9OA 3LZ1B 3X1UD 3REIB 3B0CW 3W96B 1F66C 5JRGD 4E45A 2Y2NA 3LJAB 4H9RA 3AZFA 3X1VC 2Y2JA 1TAFA 5B1MC 4J8VD 4CSRB 3MVDD 3X1TB 5CPJD 2F8ND 3W98C 3LZ1A 2DQNC 3REIA 3W99A 2Y2HA 5B0ZA 1M18C 2YFWA 1P3MD 5B32G 1ZLAA 5AVBA 3AV2B 5CP6C 2Y2LA 3AZIC 4WU9B 3X1TA 5AVCA 5GSUB 2ZM5A 5B40A 1KX5C 3C1BD 3REJD 3AZNC 4KGCA 5GT0C 1P3BB 3X1UC 1P3FB 4EO5C 5JRGC 1N1JB 4WU9A 3REHB 2IO5B 3AV1D 1TZYA 4LD9B 5AV6D 4J8VC 5GSUA 2Y2KA 4ZBJB 1KX4D 3WA9B 4G91B 1S32A 3MVDC 5F99B 3TU4B 1P3BA 1P3FA 4R8PA 4J8XC 3MNND 3C1CC 3B6GB 1P3LA 1P3MC 3W97D 5JA4B 3REHA 4KUDD 5AV5D 4LD9A 4UPKA 2RVQD 3H0RC 3WA9A 3EPJA 5F99A 5GT3C 2F8NH 2BYKB 2W8SA 1EQZA 3REJC 5DNND 4ZUXD 3UTAB 3KSYA 5B24D 3EPHA 3WTPB 5AY8C 2HIOA 3UT9B 3MGQC 4Z66A 3O62A 3AV1C 5B1LD 2BYKA 4XZQA 3MGRD 3AZLA 2NZDD 5B33D 2Y2PA 3UTAA 3P5JB 2PYOA 3REKC 4DQYB 3MNNC 3UT9A 3KXBC 3AZHB 3AZMC 4KUDC 4YS3C 5AV5C 2UWXA 1M19D 4QLCB 4J8UB 3AZGC 1JFIA 5GXQB 4NE6A 1WWSA 2XD5A 3AZHA 5B32B 4ZUXC 4J8WD 1R4VA 5AV9D 3LZ0D 2NQBB 5B1LC 1P3ID 3MGRC 3B0DB 1KX5A 3AZNA 2NZDC 4Z5TB 1KX3D 3KWQB 1P3AB 5B0YD 4HGAB 1P34B 5E5AB 1M1AB 3X1SD 2ZY4A 2NQBA 3AFAD 5DNMB 1M19C 1P3KB 4NE3A 3W96C 3AYWB 4Z5TA 3EPKA 5CPJA 4UUZB 5CPID 1F66D 5E5AA 3UTBD 3AZJB 4J8WC 2FJ7B 3MGSB 2AROD 3AN2B 5AV9C 3KUYB 2JSSA 4H9NA 5G49A 3WAAD 3LZ0C 5BNXB 4UUZA 1P3OB 1BH8A 5B31B 4Z2MH 3C1BA 3AV2C 4YM6B 1KX3C 4H9OB 2FJ7A 5B0YC 1AOIB 3AZKB 4NFTA 5BNVA 3W97B 4H9RB 3X1SC 3AFAC 5BNXA 5AV6A 1P3OA 1TAFB 1KX4A 5B31A 1U35D 5B2JD 2CV5D 5AV8B 1HQ3B 5GT0D 5CPIC 1AOIA 3W99B 4XUJC 5KDMB 5B0ZB 3AZKA 2YFWB 3W97A 1WWIA 3UTBC 4KUDA 5AV5A 5B24B 1ZLAB 2AROC 5AVBB 3TU4C 4JJND 3WAAC 2JCHA 3RELD 5AVCB 5AV8A 1HQ3A 5KDMA 5B40B 4J8XD 3C1CD 5DNNA 4ZUXA 4KGCB 5B24A 3MGPD 3VH6T 2RIQA 4WU8B 3WKJB 1TZYB 5B1LA 5GT3D 3VH5T 3MGRA 1U35C 4X23B 1S32B 5B2JC 2CV5C 5B33A 4AWLB 3B6FD 4G92C 3A1IA 4R8PB 5AY8D 5CPKD 4WU8A 3WKJA 1P3LB 3MGQD 4X23A 4JJNC 4WV4B 3RELC 1ID3B 1P3PD 3REKD 4H9SC 1EQZB 4WJ3C 1ULYA 3KXBD 3V9RB 5BT1D 5B2IB 4YS3D 4J8WA 3AZMD 3MGPC 3AZED 4J8UC 5GXQC 2HIOB 2HUEB 4Z66B 5C3IC 3O62B 3AZGD 1ID3A 1P3IA 4XZQB 3AZLB 5B31G 1KX3A 3V9RA 5B2IA 3B6FC 2PYOB 1P3GD 5CPKC 4WZSB 3X1SA 1B6WA 4KHAA 3AFAA 3X1VB 5B1MB 3KWQC 1P3AC 1P34C 3LELD 5FUGA 1JFIB 3W98B 3AZFD 5DNMC 1P3PC 3A6ND 1M18B 1F66A 1P3KC 3AZEC 5BT1C 3X1VA 1HTAA 5B1MA 5CP6B 4CAYA 3LZ1D 4WNNB 3REID 3AZIB 3W96D 3LJAD 3W98A 3MGSC 2LY8A 2ZY3A 5BS7C 1KX5B 3AZNB 1M18A 3X1TD 3X1UB 1P3GC 5JRGB 5CP6A 4WNNA 3AZIA 3WTPE 2FFFB 2JE5A 4YM6C 4J8VB 1U35A 5B2JA 3AV2D 3MVDB 3LELC 5CPJB 4WU9D 5GT0A 2F8NB 3AZFC 3X1UA 3A6NC 5JRGA 4H9PA 1P3MB 4J8VA 3LZ1C 1P3BD 3EPLA 3W99C 3REIC 5B0ZC 4H9NB 1P3FD 5G49B 3MVDA 3LJAC 2F8NA 1BH8B 1A7WA 3REHD 4LD9D 4H9SA 4J8XA 4XUJD 5AVBC 3C1BB 3REJB 3C1CA 3WA9D 1P3MA 5BO0B 3X1TC 1Q9CA 5AVCC 3FDDA 3TU4D 5BNVB 3B6GD 3AV1B 5AV6B 5GT3A 1KX4B 2Y2IA 3NQJB 3REJA 2BG1A 4WU9C 2Y2MA 5BO0A 3NQUA 3B6FA 1TZYC 5AY8A 3MNNB 5GSUC 1S32C 3MGQA 4KUDB 5AV5B 3AV1A 3UTAD 3NQJA 2Y2GA 1P3BC 1P3FC 4R8PC 3WTPD 1P3LC 3UT9D 3REHC 2IO5C 3REKA 4LD9C 1F1EA 3MNNA 2YFVB 4ZBJC 3WA9C 5DNNB 4G91C 3KXBA 4ZUXB 3AZEA 3AZMA 4YS3A 1BH9B 5F99C 3IP4C 3B6GC 3H0LC 3AZGA 3AZHD 5B1LB 2VQRA 3MGRB 2NZDB 2YFVA 4QLCD 2HIOC 5B33B 2HUEC 4Z66C 1BH9A 4J8UD 5GXQD 4XZQC 3F6TA 3AZLC
chains in the Genus database with same CATH topology
2CWEA 1Z2CB 5B32D 3UTAC 1M19B 2PYOC 2NZDA 3WTPC 3LELA 3UT9C 2NQBD 3A6NA 4NE5A 2F8NG 3R45A 4J8WB 4Z5TD 3KWQD 2F8NK 1P3AD 1M19A 5AV9B 3W96A 1P34D 3LZ0B 5E5AD 3LJAA 3EG5B 3AZHC 1M1AD 2DF4C 1P3IB 5DNMD 4CSRA 4QLCC 1P3KD 3B0CT 1KX3B 3AYWD 5B0YB 5AV9A 3X1SB 1B67A 3LZ0A 4KHAB 3AFAB 5B32C 3AZJD 2FJ7D 3MGSD 3AV2A 2BYMB 3AN2D 3KUYD 5FUGB 2NQBC 5B0YA 5CPIB 4XUJB 1P3OD 4E44A 2Y2OA 5B31D 1F66B 2ZY2A 3B0DC 3UTBB 4Z5TC 5CPJC 4YM6D 2AROB 4CAYB 1AOID 4HGAC 3WAAB 2BYMA 3AZKD 1N1JA 5E5AC 1KU5A 1M1AC 1BFMA 5CPIA 4XUJA 3VH6A 3UTBA 3AYWC 2J8PA 2G5IC 5AV8D 1HQ3D 2AROA 3TU4A 3W99D 5B0ZD 3VH5A 3C1BC 3WAAA 3B6GA 5JA4A 1PZRA 3AZJC 2FJ7C 1U35B 1ZLAD 5CHLB 5B2JB 5AVBD 3AN2C 2CV5B 3KUYC 5GT0B 4G92B 3B0BA 1T3UA 5AV6C 5AVCD 4EO5B 1P3OC 5B31C 4DRBA 1KX4C 4H9PB 5B40D 3KFUG 4M6BA 4KGCD 2Y2QA 1AOIC 3WTPA 4JJNB 3AZKC 3RELB 4WU8D 2CV5A 3W97C 3WKJD 1TZYD 2RVQC 4J8XB 5GSUD 3C1CB 4Z2MG 4DRAA 4X23D 1S32D 3MGPB 5AV8C 1HQ3C 2F2AC 4R8PD 4JJNA 5C3IB 3RELA 5DNNC 1P3LD 5GT3B 5B24C 1ZLAC 4QLCA 3B6FB 3NQUB 3MGPA 5F99D 4J8UA 5AY8B 5GXQA 5CPKB 1ID3D 1EQZD 5B40C 3MGQB 5B33C 5B32A 4KGCC 5B2ID 1W2EA 4WU8C 3WKJC 2HIOD 2G5HC 4Z66D 3O62D 1P3PB 3REKB 5CPKA 4XZQD 3H0MC 4X23C 3KXBB 3AZEB 3AZLD 3AZMB 4YS3B 3KWQA 1P3AA 4AWLC 3AL0C 2PYOD 1P34A 1M1AA 3AZGB 2XD1A 3VH6W 5DNMA 3X1VD 1P3PA 5B1MD 1P3KA 3AYWA 4H9QB 1P3GB 3VH5W 1H3OB 3W98D 1ID3C 1P3IC 1EQZC 1M18D 3A1KA 5B2IC 3AZJA 3MGSA 5BS7A 2L5AA 3AN2A 5CP6D 3LELB 3KUYA 3AZID 2ZY5A 3AZFB 3O62C 4H9QA 3A6NB 1P3GA 1H3OA 3R45B 1KX5D 3AZND 4YM6A 4H9OA 3LZ1B 3X1UD 3REIB 3B0CW 3W96B 1F66C 5JRGD 4E45A 2Y2NA 3LJAB 4H9RA 3AZFA 3X1VC 2Y2JA 1TAFA 5B1MC 4J8VD 4CSRB 3MVDD 3X1TB 5CPJD 2F8ND 3W98C 3LZ1A 2DQNC 3REIA 3W99A 2Y2HA 5B0ZA 1M18C 2YFWA 1P3MD 5B32G 1ZLAA 5AVBA 3AV2B 5CP6C 2Y2LA 3AZIC 4WU9B 3X1TA 5AVCA 5GSUB 2ZM5A 5B40A 1KX5C 3C1BD 3REJD 3AZNC 4KGCA 5GT0C 1P3BB 3X1UC 1P3FB 4EO5C 5JRGC 1N1JB 4WU9A 3REHB 2IO5B 3AV1D 1TZYA 4LD9B 5AV6D 4J8VC 5GSUA 2Y2KA 4ZBJB 1KX4D 3WA9B 4G91B 1S32A 3MVDC 5F99B 3TU4B 1P3BA 1P3FA 4R8PA 4J8XC 3MNND 3C1CC 3B6GB 1P3LA 1P3MC 3W97D 5JA4B 3REHA 4KUDD 5AV5D 4LD9A 4UPKA 2RVQD 3H0RC 3WA9A 3EPJA 5F99A 5GT3C 2F8NH 2BYKB 2W8SA 1EQZA 3REJC 5DNND 4ZUXD 3UTAB 3KSYA 5B24D 3EPHA 3WTPB 5AY8C 2HIOA 3UT9B 3MGQC 4Z66A 3O62A 3AV1C 5B1LD 2BYKA 4XZQA 3MGRD 3AZLA 2NZDD 5B33D 2Y2PA 3UTAA 3P5JB 2PYOA 3REKC 4DQYB 3MNNC 3UT9A 3KXBC 3AZHB 3AZMC 4KUDC 4YS3C 5AV5C 2UWXA 1M19D 4QLCB 4J8UB 3AZGC 1JFIA 5GXQB 4NE6A 1WWSA 2XD5A 3AZHA 5B32B 4ZUXC 4J8WD 1R4VA 5AV9D 3LZ0D 2NQBB 5B1LC 1P3ID 3MGRC 3B0DB 1KX5A 3AZNA 2NZDC 4Z5TB 1KX3D 3KWQB 1P3AB 5B0YD 4HGAB 1P34B 5E5AB 1M1AB 3X1SD 2ZY4A 2NQBA 3AFAD 5DNMB 1M19C 1P3KB 4NE3A 3W96C 3AYWB 4Z5TA 3EPKA 5CPJA 4UUZB 5CPID 1F66D 5E5AA 3UTBD 3AZJB 4J8WC 2FJ7B 3MGSB 2AROD 3AN2B 5AV9C 3KUYB 2JSSA 4H9NA 5G49A 3WAAD 3LZ0C 5BNXB 4UUZA 1P3OB 1BH8A 5B31B 4Z2MH 3C1BA 3AV2C 4YM6B 1KX3C 4H9OB 2FJ7A 5B0YC 1AOIB 3AZKB 4NFTA 5BNVA 3W97B 4H9RB 3X1SC 3AFAC 5BNXA 5AV6A 1P3OA 1TAFB 1KX4A 5B31A 1U35D 5B2JD 2CV5D 5AV8B 1HQ3B 5GT0D 5CPIC 1AOIA 3W99B 4XUJC 5KDMB 5B0ZB 3AZKA 2YFWB 3W97A 1WWIA 3UTBC 4KUDA 5AV5A 5B24B 1ZLAB 2AROC 5AVBB 3TU4C 4JJND 3WAAC 2JCHA 3RELD 5AVCB 5AV8A 1HQ3A 5KDMA 5B40B 4J8XD 3C1CD 5DNNA 4ZUXA 4KGCB 5B24A 3MGPD 3VH6T 2RIQA 4WU8B 3WKJB 1TZYB 5B1LA 5GT3D 3VH5T 3MGRA 1U35C 4X23B 1S32B 5B2JC 2CV5C 5B33A 4AWLB 3B6FD 4G92C 3A1IA 4R8PB 5AY8D 5CPKD 4WU8A 3WKJA 1P3LB 3MGQD 4X23A 4JJNC 4WV4B 3RELC 1ID3B 1P3PD 3REKD 4H9SC 1EQZB 4WJ3C 1ULYA 3KXBD 3V9RB 5BT1D 5B2IB 4YS3D 4J8WA 3AZMD 3MGPC 3AZED 4J8UC 5GXQC 2HIOB 2HUEB 4Z66B 5C3IC 3O62B 3AZGD 1ID3A 1P3IA 4XZQB 3AZLB 5B31G 1KX3A 3V9RA 5B2IA 3B6FC 2PYOB 1P3GD 5CPKC 4WZSB 3X1SA 1B6WA 4KHAA 3AFAA 3X1VB 5B1MB 3KWQC 1P3AC 1P34C 3LELD 5FUGA 1JFIB 3W98B 3AZFD 5DNMC 1P3PC 3A6ND 1M18B 1F66A 1P3KC 3AZEC 5BT1C 3X1VA 1HTAA 5B1MA 5CP6B 4CAYA 3LZ1D 4WNNB 3REID 3AZIB 3W96D 3LJAD 3W98A 3MGSC 2LY8A 2ZY3A 5BS7C 1KX5B 3AZNB 1M18A 3X1TD 3X1UB 1P3GC 5JRGB 5CP6A 4WNNA 3AZIA 3WTPE 2FFFB 2JE5A 4YM6C 4J8VB 1U35A 5B2JA 3AV2D 3MVDB 3LELC 5CPJB 4WU9D 5GT0A 2F8NB 3AZFC 3X1UA 3A6NC 5JRGA 4H9PA 1P3MB 4J8VA 3LZ1C 1P3BD 3EPLA 3W99C 3REIC 5B0ZC 4H9NB 1P3FD 5G49B 3MVDA 3LJAC 2F8NA 1BH8B 1A7WA 3REHD 4LD9D 4H9SA 4J8XA 4XUJD 5AVBC 3C1BB 3REJB 3C1CA 3WA9D 1P3MA 5BO0B 3X1TC 1Q9CA 5AVCC 3FDDA 3TU4D 5BNVB 3B6GD 3AV1B 5AV6B 5GT3A 1KX4B 2Y2IA 3NQJB 3REJA 2BG1A 4WU9C 2Y2MA 5BO0A 3NQUA 3B6FA 1TZYC 5AY8A 3MNNB 5GSUC 1S32C 3MGQA 4KUDB 5AV5B 3AV1A 3UTAD 3NQJA 2Y2GA 1P3BC 1P3FC 4R8PC 3WTPD 1P3LC 3UT9D 3REHC 2IO5C 3REKA 4LD9C 1F1EA 3MNNA 2YFVB 4ZBJC 3WA9C 5DNNB 4G91C 3KXBA 4ZUXB 3AZEA 3AZMA 4YS3A 1BH9B 5F99C 3IP4C 3B6GC 3H0LC 3AZGA 3AZHD 5B1LB 2VQRA 3MGRB 2NZDB 2YFVA 4QLCD 2HIOC 5B33B 2HUEC 4Z66C 1BH9A 4J8UD 5GXQD 4XZQC 3F6TA 3AZLC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CWE A;  5B32 D;  3UTA C;  1M19 B;  2PYO C;  2NZD A;  3WTP C;  3LEL A;  3UT9 C;  2NQB D;  3A6N A;  4NE5 A;  2F8N G;  3R45 A;  4J8W B;  4Z5T D;  3KWQ D;  2F8N K;  1P3A D;  1M19 A;  5AV9 B;  3W96 A;  1P34 D;  3LZ0 B;  5E5A D;  3LJA A;  1M1A D;  3AZH C;  1P3I B;  5DNM D;  4CSR A;  4QLC C;  1P3K D;  3B0C T;  1KX3 B;  3AYW D;  5B0Y B;  5AV9 A;  3X1S B;  1B67 A;  3LZ0 A;  4KHA B;  3AFA B;  5B32 C;  3AZJ D;  2FJ7 D;  3MGS D;  3AV2 A;  2BYM B;  3AN2 D;  3KUY D;  5FUG B;  2NQB C;  5B0Y A;  5CPI B;  4XUJ B;  1P3O D;  4E44 A;  1F66 B;  5B31 D;  3B0D C;  3UTB B;  4Z5T C;  5CPJ C;  4YM6 D;  2ARO B;  4CAY B;  1AOI D;  4HGA C;  3WAA B;  2BYM A;  3AZK D;  1N1J A;  5E5A C;  1KU5 A;  1M1A C;  1BFM A;  5CPI A;  4XUJ A;  3VH6 A;  3UTB A;  3AYW C;  5AV8 D;  1HQ3 D;  2ARO A;  3TU4 A;  3W99 D;  5B0Z D;  3VH5 A;  3C1B C;  3WAA A;  3B6G A;  5JA4 A;  3AZJ C;  2FJ7 C;  1U35 B;  1ZLA D;  5CHL B;  5B2J B;  5AVB D;  3AN2 C;  2CV5 B;  3KUY C;  5GT0 B;  4G92 B;  3B0B A;  5AV6 C;  5AVC D;  1P3O C;  4EO5 B;  1KX4 C;  5B31 C;  4DRB A;  4H9P B;  5B40 D;  4M6B A;  4KGC D;  1AOI C;  3WTP A;  4JJN B;  3AZK C;  3REL B;  4WU8 D;  2CV5 A;  3W97 C;  3WKJ D;  1TZY D;  2RVQ C;  4J8X B;  5GSU D;  3C1C B;  4Z2M G;  4DRA A;  4X23 D;  1S32 D;  3MGP B;  5AV8 C;  1HQ3 C;  4R8P D;  4JJN A;  5C3I B;  3REL A;  5DNN C;  1P3L D;  5GT3 B;  5B24 C;  1ZLA C;  4QLC A;  3B6F B;  3NQU B;  3MGP A;  5F99 D;  4J8U A;  5AY8 B;  5GXQ A;  5CPK B;  1ID3 D;  1EQZ D;  5B40 C;  3MGQ B;  5B33 C;  5B32 A;  4KGC C;  5B2I D;  4WU8 C;  3WKJ C;  2HIO D;  4Z66 D;  3O62 D;  1P3P B;  3REK B;  5CPK A;  4XZQ D;  4X23 C;  3AZL D;  3KXB B;  3AZE B;  3AZM B;  4YS3 B;  3KWQ A;  1P3A A;  4AWL C;  2PYO D;  1P34 A;  1M1A A;  3AZG B;  3VH6 W;  5DNM A;  3X1V D;  1P3P A;  5B1M D;  1P3K A;  3AYW A;  4H9Q B;  1P3G B;  3VH5 W;  1H3O B;  3W98 D;  1ID3 C;  1P3I C;  1EQZ C;  1M18 D;  3AZJ A;  5B2I C;  3MGS A;  5BS7 A;  2L5A A;  3AN2 A;  5CP6 D;  3LEL B;  3KUY A;  3AZI D;  3AZF B;  3O62 C;  4H9Q A;  3A6N B;  1P3G A;  1H3O A;  3R45 B;  1KX5 D;  3AZN D;  4YM6 A;  4H9O A;  3LZ1 B;  3X1U D;  3REI B;  3B0C W;  3W96 B;  1F66 C;  5JRG D;  4E45 A;  3LJA B;  4H9R A;  3AZF A;  3X1V C;  5B1M C;  1TAF A;  4J8V D;  4CSR B;  3MVD D;  3X1T B;  5CPJ D;  2F8N D;  3W98 C;  3LZ1 A;  3REI A;  3W99 A;  5B0Z A;  1M18 C;  2YFW A;  1P3M D;  5B32 G;  1ZLA A;  5AVB A;  3AV2 B;  5CP6 C;  3AZI C;  4WU9 B;  3X1T A;  5AVC A;  5GSU B;  5B40 A;  1KX5 C;  3C1B D;  3REJ D;  3AZN C;  4KGC A;  5GT0 C;  1P3B B;  3X1U C;  1P3F B;  4EO5 C;  5JRG C;  1N1J B;  4WU9 A;  3REH B;  2IO5 B;  3AV1 D;  1TZY A;  4LD9 B;  5AV6 D;  4J8V C;  5GSU A;  1KX4 D;  4ZBJ B;  3WA9 B;  4G91 B;  1S32 A;  3MVD C;  5F99 B;  3TU4 B;  1P3B A;  1P3F A;  4R8P A;  4J8X C;  3MNN D;  3C1C C;  3B6G B;  1P3L A;  1P3M C;  3W97 D;  5JA4 B;  3REH A;  4KUD D;  5AV5 D;  4LD9 A;  2RVQ D;  3WA9 A;  5F99 A;  5GT3 C;  2F8N H;  2BYK B;  1EQZ A;  3REJ C;  5DNN D;  4ZUX D;  3UTA B;  3KSY A;  5B24 D;  3WTP B;  5AY8 C;  2HIO A;  3UT9 B;  3MGQ C;  4Z66 A;  3O62 A;  3AV1 C;  5B1L D;  2BYK A;  4XZQ A;  3MGR D;  3AZL A;  2NZD D;  5B33 D;  3UTA A;  2PYO A;  3REK C;  3MNN C;  3UT9 A;  3KXB C;  3AZH B;  3AZM C;  4KUD C;  4YS3 C;  5AV5 C;  1M19 D;  4QLC B;  4J8U B;  3AZG C;  1JFI A;  5GXQ B;  4NE6 A;  1WWS A;  3AZH A;  5B32 B;  4ZUX C;  4J8W D;  1R4V A;  5AV9 D;  3LZ0 D;  2NQB B;  5B1L C;  1P3I D;  3MGR C;  3B0D B;  1KX5 A;  3AZN A;  2NZD C;  4Z5T B;  1KX3 D;  3KWQ B;  1P3A B;  5B0Y D;  4HGA B;  1P34 B;  5E5A B;  1M1A B;  3X1S D;  2NQB A;  3AFA D;  5DNM B;  1M19 C;  1P3K B;  4NE3 A;  3W96 C;  3AYW B;  4Z5T A;  5CPJ A;  4UUZ B;  5CPI D;  1F66 D;  5E5A A;  3UTB D;  3AZJ B;  4J8W C;  2FJ7 B;  3MGS B;  2ARO D;  3AN2 B;  5AV9 C;  3KUY B;  2JSS A;  4H9N A;  5G49 A;  3WAA D;  3LZ0 C;  5BNX B;  4UUZ A;  1P3O B;  1BH8 A;  5B31 B;  4Z2M H;  3C1B A;  3AV2 C;  4YM6 B;  1KX3 C;  4H9O B;  2FJ7 A;  5B0Y C;  1AOI B;  3AZK B;  4NFT A;  5BNV A;  3W97 B;  4H9R B;  3X1S C;  3AFA C;  5BNX A;  5AV6 A;  1P3O A;  1TAF B;  1KX4 A;  5B31 A;  1U35 D;  5B2J D;  2CV5 D;  5AV8 B;  1HQ3 B;  5GT0 D;  5CPI C;  1AOI A;  3W99 B;  4XUJ C;  5KDM B;  5B0Z B;  3AZK A;  2YFW B;  3W97 A;  1WWI A;  3UTB C;  4KUD A;  5AV5 A;  5B24 B;  1ZLA B;  2ARO C;  5AVB B;  3TU4 C;  4JJN D;  3WAA C;  3REL D;  5AVC B;  5AV8 A;  1HQ3 A;  5KDM A;  5B40 B;  4J8X D;  3C1C D;  5DNN A;  4ZUX A;  4KGC B;  5B24 A;  3MGP D;  3VH6 T;  4WU8 B;  3WKJ B;  1TZY B;  5B1L A;  5GT3 D;  3VH5 T;  3MGR A;  1U35 C;  4X23 B;  1S32 B;  5B2J C;  2CV5 C;  5B33 A;  4AWL B;  3B6F D;  4G92 C;  4R8P B;  5AY8 D;  5CPK D;  4WU8 A;  3WKJ A;  1P3L B;  3MGQ D;  4X23 A;  4JJN C;  4WV4 B;  3REL C;  1ID3 B;  1P3P D;  3REK D;  4H9S C;  1EQZ B;  1ULY A;  3KXB D;  3V9R B;  5BT1 D;  5B2I B;  4YS3 D;  4J8W A;  3AZM D;  3MGP C;  3AZE D;  4J8U C;  5GXQ C;  2HIO B;  2HUE B;  4Z66 B;  5C3I C;  3O62 B;  3AZG D;  1ID3 A;  1P3I A;  4XZQ B;  3AZL B;  5B31 G;  1KX3 A;  3V9R A;  5B2I A;  3B6F C;  2PYO B;  1P3G D;  5CPK C;  4WZS B;  3X1S A;  1B6W A;  4KHA A;  3AFA A;  3X1V B;  5B1M B;  3KWQ C;  1P3A C;  1P34 C;  3LEL D;  5FUG A;  1JFI B;  3W98 B;  3AZF D;  5DNM C;  1P3P C;  3A6N D;  1M18 B;  1F66 A;  1P3K C;  3AZE C;  5BT1 C;  3X1V A;  1HTA A;  5B1M A;  5CP6 B;  4CAY A;  3LZ1 D;  4WNN B;  3REI D;  3AZI B;  3W96 D;  3LJA D;  3W98 A;  3MGS C;  2LY8 A;  5BS7 C;  1KX5 B;  3AZN B;  1M18 A;  3X1T D;  3X1U B;  1P3G C;  5JRG B;  5CP6 A;  4WNN A;  3AZI A;  3WTP E;  4YM6 C;  4J8V B;  1U35 A;  5B2J A;  3AV2 D;  3MVD B;  3LEL C;  5CPJ B;  4WU9 D;  5GT0 A;  2F8N B;  3AZF C;  3X1U A;  3A6N C;  5JRG A;  4H9P A;  1P3M B;  4J8V A;  3LZ1 C;  1P3B D;  3W99 C;  3REI C;  5B0Z C;  4H9N B;  1P3F D;  5G49 B;  3MVD A;  3LJA C;  2F8N A;  1BH8 B;  1A7W A;  3REH D;  4LD9 D;  4H9S A;  4J8X A;  4XUJ D;  5AVB C;  3C1B B;  3REJ B;  3C1C A;  3WA9 D;  1P3M A;  5BO0 B;  3X1T C;  1Q9C A;  5AVC C;  3TU4 D;  5BNV B;  3B6G D;  3AV1 B;  5AV6 B;  5GT3 A;  1KX4 B;  3NQJ B;  3REJ A;  4WU9 C;  5BO0 A;  3NQU A;  3B6F A;  1TZY C;  5AY8 A;  3MNN B;  5GSU C;  1S32 C;  3MGQ A;  4KUD B;  5AV5 B;  3AV1 A;  3UTA D;  3NQJ A;  1P3B C;  1P3F C;  4R8P C;  3WTP D;  1P3L C;  3UT9 D;  3REH C;  2IO5 C;  3REK A;  4LD9 C;  1F1E A;  3MNN A;  2YFV B;  4ZBJ C;  3WA9 C;  5DNN B;  4G91 C;  3KXB A;  4ZUX B;  3AZE A;  3AZM A;  4YS3 A;  1BH9 B;  5F99 C;  3B6G C;  3AZG A;  3AZH D;  5B1L B;  3MGR B;  2NZD B;  2YFV A;  4QLC D;  2HIO C;  5B33 B;  2HUE C;  4Z66 C;  1BH9 A;  4J8U D;  5GXQ D;  4XZQ C;  3AZL C; 
#chains in the Genus database with same CATH topology
 2CWE A;  1Z2C B;  5B32 D;  3UTA C;  1M19 B;  2PYO C;  2NZD A;  3WTP C;  3LEL A;  3UT9 C;  2NQB D;  3A6N A;  4NE5 A;  2F8N G;  3R45 A;  4J8W B;  4Z5T D;  3KWQ D;  2F8N K;  1P3A D;  1M19 A;  5AV9 B;  3W96 A;  1P34 D;  3LZ0 B;  5E5A D;  3LJA A;  3EG5 B;  3AZH C;  1M1A D;  2DF4 C;  1P3I B;  5DNM D;  4CSR A;  4QLC C;  1P3K D;  3B0C T;  1KX3 B;  3AYW D;  5B0Y B;  5AV9 A;  3X1S B;  1B67 A;  3LZ0 A;  4KHA B;  3AFA B;  5B32 C;  3AZJ D;  2FJ7 D;  3MGS D;  3AV2 A;  2BYM B;  3AN2 D;  3KUY D;  5FUG B;  2NQB C;  5B0Y A;  5CPI B;  4XUJ B;  1P3O D;  4E44 A;  2Y2O A;  5B31 D;  1F66 B;  2ZY2 A;  3B0D C;  3UTB B;  4Z5T C;  5CPJ C;  4YM6 D;  2ARO B;  4CAY B;  1AOI D;  4HGA C;  3WAA B;  2BYM A;  3AZK D;  1N1J A;  5E5A C;  1KU5 A;  1M1A C;  1BFM A;  5CPI A;  4XUJ A;  3VH6 A;  3UTB A;  3AYW C;  2J8P A;  2G5I C;  5AV8 D;  1HQ3 D;  2ARO A;  3TU4 A;  3W99 D;  5B0Z D;  3VH5 A;  3C1B C;  3WAA A;  3B6G A;  5JA4 A;  1PZR A;  3AZJ C;  2FJ7 C;  1U35 B;  1ZLA D;  5CHL B;  5B2J B;  5AVB D;  3AN2 C;  2CV5 B;  3KUY C;  5GT0 B;  4G92 B;  3B0B A;  1T3U A;  5AV6 C;  5AVC D;  4EO5 B;  1P3O C;  5B31 C;  4DRB A;  1KX4 C;  4H9P B;  5B40 D;  3KFU G;  4M6B A;  4KGC D;  2Y2Q A;  1AOI C;  3WTP A;  4JJN B;  3AZK C;  3REL B;  4WU8 D;  2CV5 A;  3W97 C;  3WKJ D;  1TZY D;  2RVQ C;  4J8X B;  5GSU D;  3C1C B;  4Z2M G;  4DRA A;  4X23 D;  1S32 D;  3MGP B;  5AV8 C;  1HQ3 C;  2F2A C;  4R8P D;  4JJN A;  5C3I B;  3REL A;  5DNN C;  1P3L D;  5GT3 B;  5B24 C;  1ZLA C;  4QLC A;  3B6F B;  3NQU B;  3MGP A;  5F99 D;  4J8U A;  5AY8 B;  5GXQ A;  5CPK B;  1ID3 D;  1EQZ D;  5B40 C;  3MGQ B;  5B33 C;  5B32 A;  4KGC C;  5B2I D;  1W2E A;  4WU8 C;  3WKJ C;  2HIO D;  2G5H C;  4Z66 D;  3O62 D;  1P3P B;  3REK B;  5CPK A;  4XZQ D;  3H0M C;  4X23 C;  3KXB B;  3AZE B;  3AZL D;  3AZM B;  4YS3 B;  3KWQ A;  1P3A A;  4AWL C;  3AL0 C;  2PYO D;  1P34 A;  1M1A A;  3AZG B;  2XD1 A;  3VH6 W;  5DNM A;  3X1V D;  1P3P A;  5B1M D;  1P3K A;  3AYW A;  4H9Q B;  1P3G B;  3VH5 W;  1H3O B;  3W98 D;  1ID3 C;  1P3I C;  1EQZ C;  1M18 D;  3A1K A;  5B2I C;  3AZJ A;  3MGS A;  5BS7 A;  2L5A A;  3AN2 A;  5CP6 D;  3LEL B;  3KUY A;  3AZI D;  2ZY5 A;  3AZF B;  3O62 C;  4H9Q A;  3A6N B;  1P3G A;  1H3O A;  3R45 B;  1KX5 D;  3AZN D;  4YM6 A;  4H9O A;  3LZ1 B;  3X1U D;  3REI B;  3B0C W;  3W96 B;  1F66 C;  5JRG D;  4E45 A;  2Y2N A;  3LJA B;  4H9R A;  3AZF A;  3X1V C;  2Y2J A;  1TAF A;  5B1M C;  4J8V D;  4CSR B;  3MVD D;  3X1T B;  5CPJ D;  2F8N D;  3W98 C;  3LZ1 A;  2DQN C;  3REI A;  3W99 A;  2Y2H A;  5B0Z A;  1M18 C;  2YFW A;  1P3M D;  5B32 G;  1ZLA A;  5AVB A;  3AV2 B;  5CP6 C;  2Y2L A;  3AZI C;  4WU9 B;  3X1T A;  5AVC A;  5GSU B;  2ZM5 A;  5B40 A;  1KX5 C;  3C1B D;  3REJ D;  3AZN C;  4KGC A;  5GT0 C;  1P3B B;  3X1U C;  1P3F B;  4EO5 C;  5JRG C;  1N1J B;  4WU9 A;  3REH B;  2IO5 B;  3AV1 D;  1TZY A;  4LD9 B;  5AV6 D;  4J8V C;  5GSU A;  2Y2K A;  4ZBJ B;  1KX4 D;  3WA9 B;  4G91 B;  1S32 A;  3MVD C;  5F99 B;  3TU4 B;  1P3B A;  1P3F A;  4R8P A;  4J8X C;  3MNN D;  3C1C C;  3B6G B;  1P3L A;  1P3M C;  3W97 D;  5JA4 B;  3REH A;  4KUD D;  5AV5 D;  4LD9 A;  4UPK A;  2RVQ D;  3H0R C;  3WA9 A;  3EPJ A;  5F99 A;  5GT3 C;  2F8N H;  2BYK B;  2W8S A;  1EQZ A;  3REJ C;  5DNN D;  4ZUX D;  3UTA B;  3KSY A;  5B24 D;  3EPH A;  3WTP B;  5AY8 C;  2HIO A;  3UT9 B;  3MGQ C;  4Z66 A;  3O62 A;  3AV1 C;  5B1L D;  2BYK A;  4XZQ A;  3MGR D;  3AZL A;  2NZD D;  5B33 D;  2Y2P A;  3UTA A;  3P5J B;  2PYO A;  3REK C;  4DQY B;  3MNN C;  3UT9 A;  3KXB C;  3AZH B;  3AZM C;  4KUD C;  4YS3 C;  5AV5 C;  2UWX A;  1M19 D;  4QLC B;  4J8U B;  3AZG C;  1JFI A;  5GXQ B;  4NE6 A;  1WWS A;  2XD5 A;  3AZH A;  5B32 B;  4ZUX C;  4J8W D;  1R4V A;  5AV9 D;  3LZ0 D;  2NQB B;  5B1L C;  1P3I D;  3MGR C;  3B0D B;  1KX5 A;  3AZN A;  2NZD C;  4Z5T B;  1KX3 D;  3KWQ B;  1P3A B;  5B0Y D;  4HGA B;  1P34 B;  5E5A B;  1M1A B;  3X1S D;  2ZY4 A;  2NQB A;  3AFA D;  5DNM B;  1M19 C;  1P3K B;  4NE3 A;  3W96 C;  3AYW B;  4Z5T A;  3EPK A;  5CPJ A;  4UUZ B;  5CPI D;  1F66 D;  5E5A A;  3UTB D;  3AZJ B;  4J8W C;  2FJ7 B;  3MGS B;  2ARO D;  3AN2 B;  5AV9 C;  3KUY B;  2JSS A;  4H9N A;  5G49 A;  3WAA D;  3LZ0 C;  5BNX B;  4UUZ A;  1P3O B;  1BH8 A;  5B31 B;  4Z2M H;  3C1B A;  3AV2 C;  4YM6 B;  1KX3 C;  4H9O B;  2FJ7 A;  5B0Y C;  1AOI B;  3AZK B;  4NFT A;  5BNV A;  3W97 B;  4H9R B;  3X1S C;  3AFA C;  5BNX A;  5AV6 A;  1P3O A;  1TAF B;  1KX4 A;  5B31 A;  1U35 D;  5B2J D;  2CV5 D;  5AV8 B;  1HQ3 B;  5GT0 D;  5CPI C;  1AOI A;  3W99 B;  4XUJ C;  5KDM B;  5B0Z B;  3AZK A;  2YFW B;  3W97 A;  1WWI A;  3UTB C;  4KUD A;  5AV5 A;  5B24 B;  1ZLA B;  2ARO C;  5AVB B;  3TU4 C;  4JJN D;  3WAA C;  2JCH A;  3REL D;  5AVC B;  5AV8 A;  1HQ3 A;  5KDM A;  5B40 B;  4J8X D;  3C1C D;  5DNN A;  4ZUX A;  4KGC B;  5B24 A;  3MGP D;  3VH6 T;  2RIQ A;  4WU8 B;  3WKJ B;  1TZY B;  5B1L A;  5GT3 D;  3VH5 T;  3MGR A;  1U35 C;  4X23 B;  1S32 B;  5B2J C;  2CV5 C;  5B33 A;  4AWL B;  3B6F D;  4G92 C;  3A1I A;  4R8P B;  5AY8 D;  5CPK D;  4WU8 A;  3WKJ A;  1P3L B;  3MGQ D;  4X23 A;  4JJN C;  4WV4 B;  3REL C;  1ID3 B;  1P3P D;  3REK D;  4H9S C;  1EQZ B;  4WJ3 C;  1ULY A;  3KXB D;  3V9R B;  5BT1 D;  5B2I B;  4YS3 D;  4J8W A;  3AZM D;  3MGP C;  3AZE D;  4J8U C;  5GXQ C;  2HIO B;  2HUE B;  4Z66 B;  5C3I C;  3O62 B;  3AZG D;  1ID3 A;  1P3I A;  4XZQ B;  3AZL B;  5B31 G;  1KX3 A;  3V9R A;  5B2I A;  3B6F C;  2PYO B;  1P3G D;  5CPK C;  4WZS B;  3X1S A;  1B6W A;  4KHA A;  3AFA A;  3X1V B;  5B1M B;  3KWQ C;  1P3A C;  1P34 C;  3LEL D;  5FUG A;  1JFI B;  3W98 B;  3AZF D;  5DNM C;  1P3P C;  3A6N D;  1M18 B;  1F66 A;  1P3K C;  3AZE C;  5BT1 C;  3X1V A;  1HTA A;  5B1M A;  5CP6 B;  4CAY A;  3LZ1 D;  4WNN B;  3REI D;  3AZI B;  3W96 D;  3LJA D;  3W98 A;  3MGS C;  2LY8 A;  2ZY3 A;  5BS7 C;  1KX5 B;  3AZN B;  1M18 A;  3X1T D;  3X1U B;  1P3G C;  5JRG B;  5CP6 A;  4WNN A;  3AZI A;  3WTP E;  2FFF B;  2JE5 A;  4YM6 C;  4J8V B;  1U35 A;  5B2J A;  3AV2 D;  3MVD B;  3LEL C;  5CPJ B;  4WU9 D;  5GT0 A;  2F8N B;  3AZF C;  3X1U A;  3A6N C;  5JRG A;  4H9P A;  1P3M B;  4J8V A;  3LZ1 C;  1P3B D;  3EPL A;  3W99 C;  3REI C;  5B0Z C;  4H9N B;  1P3F D;  5G49 B;  3MVD A;  3LJA C;  2F8N A;  1BH8 B;  1A7W A;  3REH D;  4LD9 D;  4H9S A;  4J8X A;  4XUJ D;  5AVB C;  3C1B B;  3REJ B;  3C1C A;  3WA9 D;  1P3M A;  5BO0 B;  3X1T C;  1Q9C A;  5AVC C;  3FDD A;  3TU4 D;  5BNV B;  3B6G D;  3AV1 B;  5AV6 B;  5GT3 A;  1KX4 B;  2Y2I A;  3NQJ B;  3REJ A;  2BG1 A;  4WU9 C;  2Y2M A;  5BO0 A;  3NQU A;  3B6F A;  1TZY C;  5AY8 A;  3MNN B;  5GSU C;  1S32 C;  3MGQ A;  4KUD B;  5AV5 B;  3AV1 A;  3UTA D;  3NQJ A;  2Y2G A;  1P3B C;  1P3F C;  4R8P C;  3WTP D;  1P3L C;  3UT9 D;  3REH C;  2IO5 C;  3REK A;  4LD9 C;  1F1E A;  3MNN A;  2YFV B;  4ZBJ C;  3WA9 C;  5DNN B;  4G91 C;  3KXB A;  4ZUX B;  3AZE A;  3AZM A;  4YS3 A;  1BH9 B;  5F99 C;  3IP4 C;  3B6G C;  3H0L C;  3AZG A;  3AZH D;  5B1L B;  2VQR A;  3MGR B;  2NZD B;  2YFV A;  4QLC D;  2HIO C;  5B33 B;  2HUE C;  4Z66 C;  1BH9 A;  4J8U D;  5GXQ D;  4XZQ C;  3F6T A;  3AZL C; 
#chains in the Genus database with same CATH homology
 2CWE A;  1Z2C B;  5B32 D;  3UTA C;  1M19 B;  2PYO C;  2NZD A;  3WTP C;  3LEL A;  3UT9 C;  2NQB D;  3A6N A;  4NE5 A;  2F8N G;  3R45 A;  4J8W B;  4Z5T D;  3KWQ D;  2F8N K;  1P3A D;  1M19 A;  5AV9 B;  3W96 A;  1P34 D;  3LZ0 B;  5E5A D;  3LJA A;  3EG5 B;  3AZH C;  1M1A D;  2DF4 C;  1P3I B;  5DNM D;  4CSR A;  4QLC C;  1P3K D;  3B0C T;  1KX3 B;  3AYW D;  5B0Y B;  5AV9 A;  3X1S B;  1B67 A;  3LZ0 A;  4KHA B;  3AFA B;  5B32 C;  3AZJ D;  2FJ7 D;  3MGS D;  3AV2 A;  2BYM B;  3AN2 D;  3KUY D;  5FUG B;  2NQB C;  5B0Y A;  5CPI B;  4XUJ B;  1P3O D;  4E44 A;  2Y2O A;  5B31 D;  1F66 B;  2ZY2 A;  3B0D C;  3UTB B;  4Z5T C;  5CPJ C;  4YM6 D;  2ARO B;  4CAY B;  1AOI D;  4HGA C;  3WAA B;  2BYM A;  3AZK D;  1N1J A;  5E5A C;  1KU5 A;  1M1A C;  1BFM A;  5CPI A;  4XUJ A;  3VH6 A;  3UTB A;  3AYW C;  2J8P A;  2G5I C;  5AV8 D;  1HQ3 D;  2ARO A;  3TU4 A;  3W99 D;  5B0Z D;  3VH5 A;  3C1B C;  3WAA A;  3B6G A;  5JA4 A;  1PZR A;  3AZJ C;  2FJ7 C;  1U35 B;  1ZLA D;  5CHL B;  5B2J B;  5AVB D;  3AN2 C;  2CV5 B;  3KUY C;  5GT0 B;  4G92 B;  3B0B A;  1T3U A;  5AV6 C;  5AVC D;  4EO5 B;  1P3O C;  5B31 C;  4DRB A;  1KX4 C;  4H9P B;  5B40 D;  3KFU G;  4M6B A;  4KGC D;  2Y2Q A;  1AOI C;  3WTP A;  4JJN B;  3AZK C;  3REL B;  4WU8 D;  2CV5 A;  3W97 C;  3WKJ D;  1TZY D;  2RVQ C;  4J8X B;  5GSU D;  3C1C B;  4Z2M G;  4DRA A;  4X23 D;  1S32 D;  3MGP B;  5AV8 C;  1HQ3 C;  2F2A C;  4R8P D;  4JJN A;  5C3I B;  3REL A;  5DNN C;  1P3L D;  5GT3 B;  5B24 C;  1ZLA C;  4QLC A;  3B6F B;  3NQU B;  3MGP A;  5F99 D;  4J8U A;  5AY8 B;  5GXQ A;  5CPK B;  1ID3 D;  1EQZ D;  5B40 C;  3MGQ B;  5B33 C;  5B32 A;  4KGC C;  5B2I D;  1W2E A;  4WU8 C;  3WKJ C;  2HIO D;  2G5H C;  4Z66 D;  3O62 D;  1P3P B;  3REK B;  5CPK A;  4XZQ D;  3H0M C;  4X23 C;  3KXB B;  3AZE B;  3AZL D;  3AZM B;  4YS3 B;  3KWQ A;  1P3A A;  4AWL C;  3AL0 C;  2PYO D;  1P34 A;  1M1A A;  3AZG B;  2XD1 A;  3VH6 W;  5DNM A;  3X1V D;  1P3P A;  5B1M D;  1P3K A;  3AYW A;  4H9Q B;  1P3G B;  3VH5 W;  1H3O B;  3W98 D;  1ID3 C;  1P3I C;  1EQZ C;  1M18 D;  3A1K A;  5B2I C;  3AZJ A;  3MGS A;  5BS7 A;  2L5A A;  3AN2 A;  5CP6 D;  3LEL B;  3KUY A;  3AZI D;  2ZY5 A;  3AZF B;  3O62 C;  4H9Q A;  3A6N B;  1P3G A;  1H3O A;  3R45 B;  1KX5 D;  3AZN D;  4YM6 A;  4H9O A;  3LZ1 B;  3X1U D;  3REI B;  3B0C W;  3W96 B;  1F66 C;  5JRG D;  4E45 A;  2Y2N A;  3LJA B;  4H9R A;  3AZF A;  3X1V C;  2Y2J A;  1TAF A;  5B1M C;  4J8V D;  4CSR B;  3MVD D;  3X1T B;  5CPJ D;  2F8N D;  3W98 C;  3LZ1 A;  2DQN C;  3REI A;  3W99 A;  2Y2H A;  5B0Z A;  1M18 C;  2YFW A;  1P3M D;  5B32 G;  1ZLA A;  5AVB A;  3AV2 B;  5CP6 C;  2Y2L A;  3AZI C;  4WU9 B;  3X1T A;  5AVC A;  5GSU B;  2ZM5 A;  5B40 A;  1KX5 C;  3C1B D;  3REJ D;  3AZN C;  4KGC A;  5GT0 C;  1P3B B;  3X1U C;  1P3F B;  4EO5 C;  5JRG C;  1N1J B;  4WU9 A;  3REH B;  2IO5 B;  3AV1 D;  1TZY A;  4LD9 B;  5AV6 D;  4J8V C;  5GSU A;  2Y2K A;  4ZBJ B;  1KX4 D;  3WA9 B;  4G91 B;  1S32 A;  3MVD C;  5F99 B;  3TU4 B;  1P3B A;  1P3F A;  4R8P A;  4J8X C;  3MNN D;  3C1C C;  3B6G B;  1P3L A;  1P3M C;  3W97 D;  5JA4 B;  3REH A;  4KUD D;  5AV5 D;  4LD9 A;  4UPK A;  2RVQ D;  3H0R C;  3WA9 A;  3EPJ A;  5F99 A;  5GT3 C;  2F8N H;  2BYK B;  2W8S A;  1EQZ A;  3REJ C;  5DNN D;  4ZUX D;  3UTA B;  3KSY A;  5B24 D;  3EPH A;  3WTP B;  5AY8 C;  2HIO A;  3UT9 B;  3MGQ C;  4Z66 A;  3O62 A;  3AV1 C;  5B1L D;  2BYK A;  4XZQ A;  3MGR D;  3AZL A;  2NZD D;  5B33 D;  2Y2P A;  3UTA A;  3P5J B;  2PYO A;  3REK C;  4DQY B;  3MNN C;  3UT9 A;  3KXB C;  3AZH B;  3AZM C;  4KUD C;  4YS3 C;  5AV5 C;  2UWX A;  1M19 D;  4QLC B;  4J8U B;  3AZG C;  1JFI A;  5GXQ B;  4NE6 A;  1WWS A;  2XD5 A;  3AZH A;  5B32 B;  4ZUX C;  4J8W D;  1R4V A;  5AV9 D;  3LZ0 D;  2NQB B;  5B1L C;  1P3I D;  3MGR C;  3B0D B;  1KX5 A;  3AZN A;  2NZD C;  4Z5T B;  1KX3 D;  3KWQ B;  1P3A B;  5B0Y D;  4HGA B;  1P34 B;  5E5A B;  1M1A B;  3X1S D;  2ZY4 A;  2NQB A;  3AFA D;  5DNM B;  1M19 C;  1P3K B;  4NE3 A;  3W96 C;  3AYW B;  4Z5T A;  3EPK A;  5CPJ A;  4UUZ B;  5CPI D;  1F66 D;  5E5A A;  3UTB D;  3AZJ B;  4J8W C;  2FJ7 B;  3MGS B;  2ARO D;  3AN2 B;  5AV9 C;  3KUY B;  2JSS A;  4H9N A;  5G49 A;  3WAA D;  3LZ0 C;  5BNX B;  4UUZ A;  1P3O B;  1BH8 A;  5B31 B;  4Z2M H;  3C1B A;  3AV2 C;  4YM6 B;  1KX3 C;  4H9O B;  2FJ7 A;  5B0Y C;  1AOI B;  3AZK B;  4NFT A;  5BNV A;  3W97 B;  4H9R B;  3X1S C;  3AFA C;  5BNX A;  5AV6 A;  1P3O A;  1TAF B;  1KX4 A;  5B31 A;  1U35 D;  5B2J D;  2CV5 D;  5AV8 B;  1HQ3 B;  5GT0 D;  5CPI C;  1AOI A;  3W99 B;  4XUJ C;  5KDM B;  5B0Z B;  3AZK A;  2YFW B;  3W97 A;  1WWI A;  3UTB C;  4KUD A;  5AV5 A;  5B24 B;  1ZLA B;  2ARO C;  5AVB B;  3TU4 C;  4JJN D;  3WAA C;  2JCH A;  3REL D;  5AVC B;  5AV8 A;  1HQ3 A;  5KDM A;  5B40 B;  4J8X D;  3C1C D;  5DNN A;  4ZUX A;  4KGC B;  5B24 A;  3MGP D;  3VH6 T;  2RIQ A;  4WU8 B;  3WKJ B;  1TZY B;  5B1L A;  5GT3 D;  3VH5 T;  3MGR A;  1U35 C;  4X23 B;  1S32 B;  5B2J C;  2CV5 C;  5B33 A;  4AWL B;  3B6F D;  4G92 C;  3A1I A;  4R8P B;  5AY8 D;  5CPK D;  4WU8 A;  3WKJ A;  1P3L B;  3MGQ D;  4X23 A;  4JJN C;  4WV4 B;  3REL C;  1ID3 B;  1P3P D;  3REK D;  4H9S C;  1EQZ B;  4WJ3 C;  1ULY A;  3KXB D;  3V9R B;  5BT1 D;  5B2I B;  4YS3 D;  4J8W A;  3AZM D;  3MGP C;  3AZE D;  4J8U C;  5GXQ C;  2HIO B;  2HUE B;  4Z66 B;  5C3I C;  3O62 B;  3AZG D;  1ID3 A;  1P3I A;  4XZQ B;  3AZL B;  5B31 G;  1KX3 A;  3V9R A;  5B2I A;  3B6F C;  2PYO B;  1P3G D;  5CPK C;  4WZS B;  3X1S A;  1B6W A;  4KHA A;  3AFA A;  3X1V B;  5B1M B;  3KWQ C;  1P3A C;  1P34 C;  3LEL D;  5FUG A;  1JFI B;  3W98 B;  3AZF D;  5DNM C;  1P3P C;  3A6N D;  1M18 B;  1F66 A;  1P3K C;  3AZE C;  5BT1 C;  3X1V A;  1HTA A;  5B1M A;  5CP6 B;  4CAY A;  3LZ1 D;  4WNN B;  3REI D;  3AZI B;  3W96 D;  3LJA D;  3W98 A;  3MGS C;  2LY8 A;  2ZY3 A;  5BS7 C;  1KX5 B;  3AZN B;  1M18 A;  3X1T D;  3X1U B;  1P3G C;  5JRG B;  5CP6 A;  4WNN A;  3AZI A;  3WTP E;  2FFF B;  2JE5 A;  4YM6 C;  4J8V B;  1U35 A;  5B2J A;  3AV2 D;  3MVD B;  3LEL C;  5CPJ B;  4WU9 D;  5GT0 A;  2F8N B;  3AZF C;  3X1U A;  3A6N C;  5JRG A;  4H9P A;  1P3M B;  4J8V A;  3LZ1 C;  1P3B D;  3EPL A;  3W99 C;  3REI C;  5B0Z C;  4H9N B;  1P3F D;  5G49 B;  3MVD A;  3LJA C;  2F8N A;  1BH8 B;  1A7W A;  3REH D;  4LD9 D;  4H9S A;  4J8X A;  4XUJ D;  5AVB C;  3C1B B;  3REJ B;  3C1C A;  3WA9 D;  1P3M A;  5BO0 B;  3X1T C;  1Q9C A;  5AVC C;  3FDD A;  3TU4 D;  5BNV B;  3B6G D;  3AV1 B;  5AV6 B;  5GT3 A;  1KX4 B;  2Y2I A;  3NQJ B;  3REJ A;  2BG1 A;  4WU9 C;  2Y2M A;  5BO0 A;  3NQU A;  3B6F A;  1TZY C;  5AY8 A;  3MNN B;  5GSU C;  1S32 C;  3MGQ A;  4KUD B;  5AV5 B;  3AV1 A;  3UTA D;  3NQJ A;  2Y2G A;  1P3B C;  1P3F C;  4R8P C;  3WTP D;  1P3L C;  3UT9 D;  3REH C;  2IO5 C;  3REK A;  4LD9 C;  1F1E A;  3MNN A;  2YFV B;  4ZBJ C;  3WA9 C;  5DNN B;  4G91 C;  3KXB A;  4ZUX B;  3AZE A;  3AZM A;  4YS3 A;  1BH9 B;  5F99 C;  3IP4 C;  3B6G C;  3H0L C;  3AZG A;  3AZH D;  5B1L B;  2VQR A;  3MGR B;  2NZD B;  2YFV A;  4QLC D;  2HIO C;  5B33 B;  2HUE C;  4Z66 C;  1BH9 A;  4J8U D;  5GXQ D;  4XZQ C;  3F6T A;  3AZL C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...