2ARPF

Activin a in complex with fs12 fragment of follistatin
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
148
structure length
148
Chain Sequence
TCENVDCGPGKKCRMNKKNKPRCVCAPDCSNITWKGPVCGLDGKTYRNECALLKARCKEQPELEVQYQGKCKKTCRDVFCPGSSTCVVDQTNNAYCVTCNRICPEPSSSEQSLCGNDGVTYSSACHLRKATCLLGRSIGLAYEGKCIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Inhibin beta A chain
publication title Structural basis for the inhibition of activin signalling by follistatin
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hormone/growth factor
total genus 30
structure length 148
sequence length 148
ec nomenclature
pdb deposition date 2005-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF07648 Kazal_2 Kazal-type serine protease inhibitor domain
F PF09289 FOLN Follistatin/Osteonectin-like EGF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2arpF01
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2arpF02
1DS3I 1PPFI 1YU6C 2SGPI 1CT0I 1SGEI 2BUSA 2NU3I 2NU4I 1KMAA 1CT4I 2N17A 2JXDA 2QQCA 2WCYA 4HGUA 2XRCA 5JHWC 1Z7KB 3TJQA 1SGNI 1PJUA 1CHOI 1IY5A 2OVOA 1Y1BA 1TGSI 1UVGA 2JZMA 2M5XA 2SGEI 1YTPA 2V53A 2KMPA 1CSOI 1LR8A 2NU1I 2ERWA 2LEOA 1SGYI 3OVOA 1DS2I 1MT1A 2SGDI 1BMOA 4OVOA 3SGBI 1N13A 2F3CI 1HJAI 2SGQI 1CT2I 1AN1I 2N71A 3SEKC 1Y1CA 4SGBI 1SGDI 1FYBA 2P6AC 2JYYA 1OVOA 3HH2C 1LR9A 1NUBA 1HDLA 1SGRI 2N52A 1IW4A 1H0ZA 1CGII 1R0RI 1CGJI 2KMRA 2KCXA 2GKTI 4GI3C 2SGFI 1HPTA 1PCEA 5DAEA 1UVFA 2NU2I 1LR7A 1TUSA 1OMUA 1M8BA 1TBQR 1UUCA 2KMQA 2B0UC 1TIHA 2ARPF 3QTLD 1CE3A 1M8CA 1OYVI 2QQDA 2GKVA 2NU0I 1OMTA 1SGQI 1TBRR 2GKRI 1TURA 1SGPI 3SGQI 1IY6A 3B4VC 2KMOA 1BUSA
chains in the Genus database with same CATH superfamily
1DS3I 1PPFI 1YU6C 2ROWA 1CT0I 1MJ9A 1SGEI 1Z2IA 2BUSA 2NU4I 2NU3I 1CT4I 2N17A 2JXDA 3UEYA 1XA6A 2W0TA 2N1AB 2QQCA 2WCYA 1MJAA 2WGCA 3OXGA 1XX6A 4HGUA 2XRCA 1S20A 5JHWC 1Z7KB 3TJQA 2GIVA 1SGNI 1ULNA 1PJUA 1TBOA 1CHOI 1RFHA 1IY5A 2FNFX 2OVOA 2CWGA 1PTQA 1Y1BA 1TGSI 3R5CA 1UVGA 2Y0MA 2JZMA 1WGTA 5FUYA 3TOAA 1MJBA 1UHAA 3FC3A 1V1IA 2ORVA 5E3RA 2UVOA 2YQPA 2PQ8A 1ULKA 4L9MA 3UGIA 2M5XA 1K7VA 1W4RA 2K9HA 2SGEI 2V1CC 3UGDA 2OZUA 2X3TA 2DIPA 1YTPA 2OD1A 2ORWA 2V53A 2KMPA 5FUWA 1X4SA 3PDNA 1CSOI 2L8EA 1LR8A 1TBNA 2NU1I 2ERWA 2QPOA 3CXLA 2YUUA 3R5DA 2LEOA 1SGYI 3OVOA 1DS2I 1HEVA 1MT1A 2SGDI 3VE5A 2RC4A 1BMOA 5FUVA 3OXLA 4OVOA 2V1CA 2ENZA 3SGBI 1N13A 2F3CI 1WGCA 1P9ZA 2X52A 1HJAI 2LB7A 3QAHA 4UXJA 2SGQI 1CT2I 2E5RA 3GOXA 1AN1I 2A20A 1V1HA 2N71A 1Y8FA 2DB6A 1K7UA 3RU0A 3SEKC 2ENNA 1FY7A 1Y1CA 1R79A 2CJSC 5J8CA 4SGBI 1SGDI 3D00A 1KMAA 1FYBA 2P6AC 2JYYA 3VDUA 2GVIA 1FARA 1OVOA 3HH2C 2E73A 1LR9A 2J9RA 1NUBA 1ULMA 2B8TA 1SGRI 3TO7A 3TOBA 5J8FA 4E1PA 3UGLA 2LUYA 1HDLA 2N52A 4E1RA 1IW4A 2VRWB 4B6DA 2ODDA 2QQ0A 1KBEA 5EX3A 1CGII 5EX0A 3E59A 1H0ZA 1R0RI 1CGJI 1WKXA 2KCXA 2KMRA 5HI7A 2GKTI 4GI3C 2SGPI 3UFFA 4FKDA 1KBFA 9WGAA 2SGFI 1HPTA 1TOTA 2JA1A 5E3PA 1PCEA 7WGAA 5DAEA 1Q9BA 1UVFA 1XBTA 2NU2I 5CCMA 1LR7A 2DKVA 1NXUA 1P9GA 1TUSA 1OMUA 3QWPA 2J87A 3FSXA 1M8BA 1TBQR 2QQEA 1UUCA 3E2IA 3VDPA 1FAQA 3TO6A 3OXFA 2KMQA 2B0UC 3FSYA 1TIHA 1X74A 3BJIA 4UXHA 2ELIA 3OL0A 5E3QA 2CWHA 2JW6A 2ARPF 4UXIA 4AMLA 3QTLD 5CCLA 2L7XA 1VDDA 1CE3A 3TO9A 1M8CA 1OYVI 2CWFA 5HQ8A 1K7TA 1PTRA 1U5KA 2RIJA 1WTJA 4MPIA 4DNCA 2QQDA 4WP4A 5FUXA 2GKVA 2NU0I 2WVJA 3MEKA 1OMTA 2OU2A 3KY9A 3R5AA 4A24A 1SGQI 1TBRR 1W3SA 1TURA 1SGPI 2GKRI 3SGQI 1IY6A 3B4VC 3UOEA 2KMOA 1BUSA 3R5BA 3UEJA 4JCVE 2UZ3A
chains in the Genus database with same CATH topology
1DS3I 1PPFI 1YU6C 2ROWA 1CT0I 1SGEI 2BUSA 2NU4I 2NU3I 2SGPI 1CT4I 2N17A 2JXDA 3UEYA 1XA6A 2W0TA 2N1AB 2QQCA 2WCYA 3OXGA 1XX6A 4HGUA 2XRCA 5JHWC 1Z7KB 3TJQA 1SGNI 1PJUA 1TBOA 1CHOI 1RFHA 1IY5A 2FNFX 2OVOA 1PTQA 1Y1BA 1TGSI 1UVGA 2JZMA 5FUYA 3FC3A 1V1IA 2ORVA 2YQPA 4L9MA 3UGIA 2M5XA 1W4RA 2K9HA 3UGDA 2SGEI 2V1CC 2DIPA 1YTPA 2OD1A 2ORWA 2V53A 2KMPA 5FUWA 1X4SA 3PDNA 1CSOI 2L8EA 1LR8A 1TBNA 2NU1I 2ERWA 2QPOA 3CXLA 2YUUA 2LEOA 1SGYI 3OVOA 1DS2I 1MT1A 2SGDI 3VE5A 1BMOA 5FUVA 3OXLA 4OVOA 2V1CA 2ENZA 3SGBI 1N13A 2F3CI 4UXJA 1HJAI 2SGQI 1CT2I 2E5RA 3GOXA 1AN1I 2A20A 1V1HA 2N71A 1Y8FA 2DB6A 3RU0A 3SEKC 2ENNA 1Y1CA 2CJSC 1R79A 4SGBI 1SGDI 3D00A 1KMAA 1FYBA 2P6AC 2JYYA 3VDUA 2GVIA 1FARA 1OVOA 3HH2C 2E73A 1LR9A 2J9RA 1NUBA 2B8TA 1HDLA 1SGRI 4E1PA 3UGLA 2LUYA 2N52A 4E1RA 1IW4A 2VRWB 4B6DA 2ODDA 2QQ0A 1KBEA 5EX3A 1CGII 5EX0A 3E59A 1H0ZA 1R0RI 1CGJI 2KMRA 2KCXA 5HI7A 2GKTI 4GI3C 3UFFA 4FKDA 1KBFA 2SGFI 1HPTA 1TOTA 2JA1A 1PCEA 5DAEA 1UVFA 1XBTA 2NU2I 5CCMA 1LR7A 1TUSA 1OMUA 3QWPA 2J87A 1M8BA 1TBQR 2QQEA 1UUCA 3E2IA 3VDPA 1FAQA 3OXFA 2KMQA 2B0UC 1TIHA 1X74A 3BJIA 4UXHA 2ELIA 3OL0A 2JW6A 2ARPF 4UXIA 3QTLD 5CCLA 2L7XA 1VDDA 1CE3A 1M8CA 1OYVI 5HQ8A 1PTRA 1U5KA 2QQDA 5FUXA 2GKVA 2NU0I 2WVJA 3MEKA 1OMTA 3KY9A 4A24A 1SGQI 1TBRR 1W3SA 1TURA 1SGPI 2GKRI 3SGQI 1IY6A 3B4VC 2KMOA 1BUSA 3UEJA 4JCVE 2UZ3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DS3 I;  1PPF I;  1YU6 C;  2SGP I;  1CT0 I;  1SGE I;  2BUS A;  2NU3 I;  2NU4 I;  1KMA A;  1CT4 I;  2N17 A;  2JXD A;  2QQC A;  2WCY A;  4HGU A;  2XRC A;  5JHW C;  1Z7K B;  3TJQ A;  1SGN I;  1PJU A;  1CHO I;  1IY5 A;  2OVO A;  1Y1B A;  1TGS I;  1UVG A;  2JZM A;  2M5X A;  2SGE I;  1YTP A;  2V53 A;  2KMP A;  1CSO I;  1LR8 A;  2NU1 I;  2ERW A;  2LEO A;  1SGY I;  3OVO A;  1DS2 I;  1MT1 A;  2SGD I;  1BMO A;  4OVO A;  3SGB I;  1N13 A;  2F3C I;  1HJA I;  2SGQ I;  1CT2 I;  1AN1 I;  2N71 A;  3SEK C;  1Y1C A;  4SGB I;  1SGD I;  1FYB A;  2P6A C;  2JYY A;  1OVO A;  3HH2 C;  1LR9 A;  1NUB A;  1HDL A;  1SGR I;  2N52 A;  1IW4 A;  1H0Z A;  1CGI I;  1R0R I;  1CGJ I;  2KMR A;  2KCX A;  2GKT I;  4GI3 C;  2SGF I;  1HPT A;  1PCE A;  5DAE A;  1UVF A;  2NU2 I;  1LR7 A;  1TUS A;  1OMU A;  1M8B A;  1TBQ R;  1UUC A;  2KMQ A;  2B0U C;  1TIH A;  2ARP F;  3QTL D;  1CE3 A;  1M8C A;  1OYV I;  2QQD A;  2GKV A;  2NU0 I;  1OMT A;  1SGQ I;  1TBR R;  2GKR I;  1TUR A;  1SGP I;  3SGQ I;  1IY6 A;  3B4V C;  2KMO A;  1BUS A; 
#chains in the Genus database with same CATH topology
 1DS3 I;  1PPF I;  1YU6 C;  2ROW A;  1CT0 I;  1MJ9 A;  1SGE I;  1Z2I A;  2BUS A;  2NU4 I;  2NU3 I;  1CT4 I;  2N17 A;  2JXD A;  3UEY A;  1XA6 A;  2W0T A;  2N1A B;  2QQC A;  2WCY A;  1MJA A;  2WGC A;  3OXG A;  1XX6 A;  4HGU A;  2XRC A;  1S20 A;  5JHW C;  1Z7K B;  3TJQ A;  2GIV A;  1SGN I;  1ULN A;  1PJU A;  1TBO A;  1CHO I;  1RFH A;  1IY5 A;  2FNF X;  2OVO A;  2CWG A;  1PTQ A;  1Y1B A;  1TGS I;  3R5C A;  1UVG A;  2Y0M A;  2JZM A;  1WGT A;  5FUY A;  3TOA A;  1MJB A;  1UHA A;  3FC3 A;  1V1I A;  2ORV A;  5E3R A;  2UVO A;  2YQP A;  2PQ8 A;  1ULK A;  4L9M A;  3UGI A;  2M5X A;  1K7V A;  1W4R A;  2K9H A;  2SGE I;  2V1C C;  3UGD A;  2OZU A;  2X3T A;  2DIP A;  1YTP A;  2OD1 A;  2ORW A;  2V53 A;  2KMP A;  5FUW A;  1X4S A;  3PDN A;  1CSO I;  2L8E A;  1LR8 A;  1TBN A;  2NU1 I;  2ERW A;  2QPO A;  3CXL A;  2YUU A;  3R5D A;  2LEO A;  1SGY I;  3OVO A;  1DS2 I;  1HEV A;  1MT1 A;  2SGD I;  3VE5 A;  2RC4 A;  1BMO A;  5FUV A;  3OXL A;  4OVO A;  2V1C A;  2ENZ A;  3SGB I;  1N13 A;  2F3C I;  1WGC A;  1P9Z A;  2X52 A;  1HJA I;  2LB7 A;  3QAH A;  4UXJ A;  2SGQ I;  1CT2 I;  2E5R A;  3GOX A;  1AN1 I;  2A20 A;  1V1H A;  2N71 A;  1Y8F A;  2DB6 A;  1K7U A;  3RU0 A;  3SEK C;  2ENN A;  1FY7 A;  1Y1C A;  1R79 A;  2CJS C;  5J8C A;  4SGB I;  1SGD I;  3D00 A;  1KMA A;  1FYB A;  2P6A C;  2JYY A;  3VDU A;  2GVI A;  1FAR A;  1OVO A;  3HH2 C;  2E73 A;  1LR9 A;  2J9R A;  1NUB A;  1ULM A;  2B8T A;  1SGR I;  3TO7 A;  3TOB A;  5J8F A;  4E1P A;  3UGL A;  2LUY A;  1HDL A;  2N52 A;  4E1R A;  1IW4 A;  2VRW B;  4B6D A;  2ODD A;  2QQ0 A;  1KBE A;  5EX3 A;  1CGI I;  5EX0 A;  3E59 A;  1H0Z A;  1R0R I;  1CGJ I;  1WKX A;  2KCX A;  2KMR A;  5HI7 A;  2GKT I;  4GI3 C;  2SGP I;  3UFF A;  4FKD A;  1KBF A;  9WGA A;  2SGF I;  1HPT A;  1TOT A;  2JA1 A;  5E3P A;  1PCE A;  7WGA A;  5DAE A;  1Q9B A;  1UVF A;  1XBT A;  2NU2 I;  5CCM A;  1LR7 A;  2DKV A;  1NXU A;  1P9G A;  1TUS A;  1OMU A;  3QWP A;  2J87 A;  3FSX A;  1M8B A;  1TBQ R;  2QQE A;  1UUC A;  3E2I A;  3VDP A;  1FAQ A;  3TO6 A;  3OXF A;  2KMQ A;  2B0U C;  3FSY A;  1TIH A;  1X74 A;  3BJI A;  4UXH A;  2ELI A;  3OL0 A;  5E3Q A;  2CWH A;  2JW6 A;  2ARP F;  4UXI A;  4AML A;  3QTL D;  5CCL A;  2L7X A;  1VDD A;  1CE3 A;  3TO9 A;  1M8C A;  1OYV I;  2CWF A;  5HQ8 A;  1K7T A;  1PTR A;  1U5K A;  2RIJ A;  1WTJ A;  4MPI A;  4DNC A;  2QQD A;  4WP4 A;  5FUX A;  2GKV A;  2NU0 I;  2WVJ A;  3MEK A;  1OMT A;  2OU2 A;  3KY9 A;  3R5A A;  4A24 A;  1SGQ I;  1TBR R;  1W3S A;  1TUR A;  1SGP I;  2GKR I;  3SGQ I;  1IY6 A;  3B4V C;  3UOE A;  2KMO A;  1BUS A;  3R5B A;  3UEJ A;  4JCV E;  2UZ3 A; 
#chains in the Genus database with same CATH homology
 1DS3 I;  1PPF I;  1YU6 C;  2ROW A;  1CT0 I;  1SGE I;  2BUS A;  2NU4 I;  2NU3 I;  2SGP I;  1CT4 I;  2N17 A;  2JXD A;  3UEY A;  1XA6 A;  2W0T A;  2N1A B;  2QQC A;  2WCY A;  3OXG A;  1XX6 A;  4HGU A;  2XRC A;  5JHW C;  1Z7K B;  3TJQ A;  1SGN I;  1PJU A;  1TBO A;  1CHO I;  1RFH A;  1IY5 A;  2FNF X;  2OVO A;  1PTQ A;  1Y1B A;  1TGS I;  1UVG A;  2JZM A;  5FUY A;  3FC3 A;  1V1I A;  2ORV A;  2YQP A;  4L9M A;  3UGI A;  2M5X A;  1W4R A;  2K9H A;  3UGD A;  2SGE I;  2V1C C;  2DIP A;  1YTP A;  2OD1 A;  2ORW A;  2V53 A;  2KMP A;  5FUW A;  1X4S A;  3PDN A;  1CSO I;  2L8E A;  1LR8 A;  1TBN A;  2NU1 I;  2ERW A;  2QPO A;  3CXL A;  2YUU A;  2LEO A;  1SGY I;  3OVO A;  1DS2 I;  1MT1 A;  2SGD I;  3VE5 A;  1BMO A;  5FUV A;  3OXL A;  4OVO A;  2V1C A;  2ENZ A;  3SGB I;  1N13 A;  2F3C I;  4UXJ A;  1HJA I;  2SGQ I;  1CT2 I;  2E5R A;  3GOX A;  1AN1 I;  2A20 A;  1V1H A;  2N71 A;  1Y8F A;  2DB6 A;  3RU0 A;  3SEK C;  2ENN A;  1Y1C A;  2CJS C;  1R79 A;  4SGB I;  1SGD I;  3D00 A;  1KMA A;  1FYB A;  2P6A C;  2JYY A;  3VDU A;  2GVI A;  1FAR A;  1OVO A;  3HH2 C;  2E73 A;  1LR9 A;  2J9R A;  1NUB A;  2B8T A;  1HDL A;  1SGR I;  4E1P A;  3UGL A;  2LUY A;  2N52 A;  4E1R A;  1IW4 A;  2VRW B;  4B6D A;  2ODD A;  2QQ0 A;  1KBE A;  5EX3 A;  1CGI I;  5EX0 A;  3E59 A;  1H0Z A;  1R0R I;  1CGJ I;  2KMR A;  2KCX A;  5HI7 A;  2GKT I;  4GI3 C;  3UFF A;  4FKD A;  1KBF A;  2SGF I;  1HPT A;  1TOT A;  2JA1 A;  1PCE A;  5DAE A;  1UVF A;  1XBT A;  2NU2 I;  5CCM A;  1LR7 A;  1TUS A;  1OMU A;  3QWP A;  2J87 A;  1M8B A;  1TBQ R;  2QQE A;  1UUC A;  3E2I A;  3VDP A;  1FAQ A;  3OXF A;  2KMQ A;  2B0U C;  1TIH A;  1X74 A;  3BJI A;  4UXH A;  2ELI A;  3OL0 A;  2JW6 A;  2ARP F;  4UXI A;  3QTL D;  5CCL A;  2L7X A;  1VDD A;  1CE3 A;  1M8C A;  1OYV I;  5HQ8 A;  1PTR A;  1U5K A;  2QQD A;  5FUX A;  2GKV A;  2NU0 I;  2WVJ A;  3MEK A;  1OMT A;  3KY9 A;  4A24 A;  1SGQ I;  1TBR R;  1W3S A;  1TUR A;  1SGP I;  2GKR I;  3SGQ I;  1IY6 A;  3B4V C;  2KMO A;  1BUS A;  3UEJ A;  4JCV E;  2UZ3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...