2ASTB

Crystal structure of skp1-skp2-cks1 in complex with a p27 peptide
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
325
structure length
325
Chain Sequence
VSWDSLPDELLLGIFSCLCLPELLKVSGVCKRWYRLASDESLWQTLDLTGKNLHPDVTGRLLSQGVIAFRCPRSFMDQPLAEHFSPFRVQHMDLSNSVIEVSTLHGILSQCSKLQNLSLEGLRLSDPIVNTLAKNSNLVRLNLSGCSGFSEFALQTLLSSCSRLDELNLSWCFDFTEKHVQVAVAHVSETITQLNLSGYRKNLQKSDLSTLVRRCPNLVHLDLSDSVMLKNDCFQEFFQLNYLQHLSLSRCYDIIPETLLELGEIPTLKTLQVFGIVPDGTLQLLKEALPHLQINCSHFTTIARPTIGNKKNQEIWGIKCRLTLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords S-phase kinase-associated protein 1A
publication title Structural Basis of the Cks1-Dependent Recognition of p27(Kip1) by the SCF(Skp2) Ubiquitin Ligase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase/ligase inhibitor
total genus 116
structure length 325
sequence length 325
ec nomenclature
pdb deposition date 2005-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF12937 F-box-like F-box-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 2astB00
2R9UA 4R6FA 3OGMB 3RFJA 4GLPA 4GT6A 1XKUA 4R09A 2OMZA 4PKIG 4MQWX 1D0BA 4V2CA 3VQ2A 1P8TA 4FCGA 1OTOA 1M0ZA 4V2DA 4KT1A 1OZNA 1KOHA 5CMNA 3UL8A 3M19A 1OTNA 3CIYA 4Z64C 3GOZA 3ULVA 4M7EC 4OQTA 4PEQB 3W3KA 4K17A 4YEBB 3WPCA 5GS0A 3C6PB 4U06A 4FD0A 3REZA 3ZYJA 3A79B 3RIZA 4V2EA 3JB9j 1XCDA 1K5GC 4WYKA 5IJCA 4KNGA 4BSUA 2OMUA 4HQ1A 4AY9X 4KXFB 4QBZA 2V70A 4Y61B 1IO0A 3ZYOA 3G3AA 3C6NB 1FS2A 1OGQA 4XGOA 5CMPA 4FHOA 1GWBA 4Z8GA 2ID5A 5HZLB 2CA6A 3CIGA 1KOOA 1U0ND 4ARRA 3VQ1A 5LFNA 2P1OB 3G39A 3W3JA 5B0TA 4C2AB 4CNCA 1OOKG 4LSXC 2JE1A 3BZ5A 5AZ5A 2O6SA 5GQRK 2Z63A 2OMWA 3WPDA 4R6GA 4CNMA 2WQWA 2RR6A 1K5DC 3O6NA 3WPFA 1FT8A 5IYXC 3ZYNA 4U08A 3WPHA 5B0NA 5GMHA 1H6TA 5A5CA 4ARNA 4PERA 3OJAA 4B8CD 1XECA 3G3BA 2XOTA 3E6JA 4FS7A 1DFJI 2Q4GW 3UL7A 3WPGA 2P1NB 4L3FA 2OMYA 4LSAA 1FO1A 2Z62A 4C2BB 1A9NA 4LI1A 2Z81A 4LSCA 4CC4C 2V9SA 1G9UA 1W8AA 2WQUA 4EZGA 4XOSA 4ECNA 3WPIA 3OJAB 3E2JA 5GMFA 4Q62A 1JL5A 4PQ8A 4CC4A 1M10B 3DZEA 1XWDC 5IJDA 4J4LA 4PSJA 3RFSA 4RCAB 1ZIWA 4BSRA 5GS2B 5HDHA 1WWLA 4G8AA 3ULAA 3G06A 3WN4A 4L3AA 5IJBA 1M9SA 3UL9A 5FTTB 1P9AG 3P72A 4Q3GA 2Z7XA 4CP6A 4CILA 1M9LA 3E3ZA 1P8VA 2JE0A 3RFEA 4Z79A 5AWDA 1DS9A 3CVRA 1O6SA 4MN8B 3SB4A 1O6VA 3FXIA 1A4YA 2O6RA 4IM6A 2Y5QA 4TZHA 2Z7XB 1Z7XW 4Z61C 3E4GA 3O53A 2IFGA 3RGXA 4RWTC 1O6TA 4R5DA 1FQVA 4NKGA 4AW4A 4R07A 1YRGA 2UZXA 3KJ4A 2RA8A 4FMZA 1LTXA 2Z82A 4R5CA 2JQDA 4R0AA 3G04C 2UZYA 4U7LA 4R6JA 2WQXA 1XEUA 3TSRE 2Z66A 2FT3A 4QXEA 3RGZA 4BV4R 3OGKB 4H09A 2P1PB 4QC0A 3ULUA 3C6OB 3M18A 2A0ZA 4BSSA 4R58A 4WP6A 4Z94G 1H6UA 2ELLA 4FDWA 3PMHG 5B4PA 3ZYIA 1SQ0B 4M7EA 4R08A 3RJ0A 4LXSA 2Z64A 3OGLB 2OMVA 1DCEA 1OTMA 3WPBA 4NKHA 5GMGA 2P1MB 5AWAA 2BEXA 3UN9A 4LXRA 4U09A 3W3LA 2P1QB 4XSQA 4J0MA 3WPEA 4P91A 4P8SA 4Q3IA 3W3GA 2OMXA 3W3NA 2V9TB 2ASSB 2ASTB 4R6AA 4RCWA 1PGVA 3RW6A 2WFHA 5AWCA 4I6JB 2OMTA 4UFRA 1QYYA 2O6QA 5AWBA 2BNHA 3W3MA 4LI2A 2WQVA 2XWTC 3RW7A 4ECOA 2Z65A 4LSXA 5D3IA
chains in the Genus database with same CATH superfamily
2R9UA 4R6FA 3OGMB 3RFJA 4GLPA 4GT6A 1XKUA 4R09A 2OMZA 4PKIG 4MQWX 1D0BA 4V2CA 3VQ2A 1P8TA 4FCGA 1OTOA 1M0ZA 4V2DA 4KT1A 1OZNA 1KOHA 5CMNA 3UL8A 3M19A 1OTNA 3CIYA 4Z64C 3GOZA 3ULVA 4M7EC 4OQTA 4PEQB 3W3KA 4K17A 4YEBB 3WPCA 5GS0A 3C6PB 4U06A 4FD0A 3REZA 3ZYJA 3A79B 3RIZA 4V2EA 3JB9j 1XCDA 1K5GC 4WYKA 5IJCA 4KNGA 4BSUA 2OMUA 4HQ1A 4AY9X 4KXFB 4QBZA 2V70A 4Y61B 1IO0A 3ZYOA 3G3AA 3C6NB 4NZTM 1FS2A 1OGQA 4XGOA 5CMPA 4FHOA 1GWBA 4Z8GA 2ID5A 5HZLB 2CA6A 3CIGA 1KOOA 1U0ND 4ARRA 3VQ1A 5LFNA 2P1OB 3G39A 3W3JA 5B0TA 4C2AB 4CNCA 1OOKG 4LSXC 2JE1A 3BZ5A 5AZ5A 2O6SA 5GQRK 2Z63A 2OMWA 3WPDA 4R6GA 4CNMA 2WQWA 2RR6A 1K5DC 3O6NA 3WPFA 1FT8A 5IYXC 3ZYNA 4U08A 3WPHA 5B0NA 5GMHA 1H6TA 5A5CA 4ARNA 4PERA 3OJAA 4B8CD 1XECA 3G3BA 2XOTA 3E6JA 4FS7A 1DFJI 2Q4GW 3UL7A 3WPGA 2P1NB 4L3FA 2OMYA 4LSAA 1FO1A 2Z62A 4C2BB 1A9NA 4LI1A 2Z81A 4LSCA 4CC4C 2V9SA 1G9UA 1W8AA 2WQUA 4EZGA 4XOSA 4ECNA 3WPIA 3OJAB 4NZRM 3E2JA 5GMFA 4Q62A 1JL5A 4PQ8A 4CC4A 1M10B 3DZEA 1XWDC 5IJDA 4J4LA 4PSJA 3RFSA 4RCAB 1ZIWA 4BSRA 5GS2B 5HDHA 1WWLA 4G8AA 3ULAA 3G06A 3WN4A 4L3AA 5IJBA 1M9SA 3UL9A 5FTTB 1P9AG 3P72A 4Q3GA 2Z7XA 4CP6A 4CILA 1M9LA 3E3ZA 1P8VA 2JE0A 3RFEA 4Z79A 5AWDA 1DS9A 3CVRA 1O6SA 4MN8B 3SB4A 1O6VA 3FXIA 1A4YA 2O6RA 4IM6A 2Y5QA 4TZHA 2Z7XB 1Z7XW 4Z61C 3E4GA 3O53A 2IFGA 3RGXA 4RWTC 1O6TA 4R5DA 1FQVA 4NKGA 4AW4A 4R07A 1YRGA 2UZXA 3KJ4A 2RA8A 4FMZA 1LTXA 2Z82A 4R5CA 2JQDA 4R0AA 3G04C 2UZYA 4U7LA 4R6JA 2WQXA 1XEUA 3TSRE 2Z66A 2FT3A 4QXEA 3RGZA 4BV4R 3OGKB 4H09A 2P1PB 4QC0A 3ULUA 3C6OB 3M18A 2A0ZA 4BSSA 4R58A 4WP6A 4Z94G 1H6UA 2ELLA 4FDWA 3PMHG 5B4PA 3ZYIA 1SQ0B 4M7EA 4R08A 3RJ0A 4LXSA 2Z64A 3OGLB 2OMVA 1DCEA 1OTMA 3WPBA 4NKHA 5GMGA 2P1MB 5AWAA 2BEXA 3UN9A 4LXRA 4U09A 3W3LA 2P1QB 4XSQA 4J0MA 3WPEA 4P91A 4P8SA 4Q3IA 3W3GA 2OMXA 3W3NA 2V9TB 2ASSB 2ASTB 4R6AA 4RCWA 1PGVA 3RW6A 2WFHA 5AWCA 4I6JB 2OMTA 4UFRA 1QYYA 2O6QA 5AWBA 2BNHA 3W3MA 4LI2A 2WQVA 2XWTC 3RW7A 4ECOA 2Z65A 4LSXA 5D3IA
chains in the Genus database with same CATH topology
2R9UA 4R6FA 3OGMB 3RFJA 4GLPA 4GT6A 1XKUA 4R09A 2OMZA 4PKIG 4MQWX 1D0BA 4V2CA 3VQ2A 1P8TA 4FCGA 1OTOA 1M0ZA 4V2DA 4KT1A 1OZNA 1KOHA 5CMNA 3UL8A 3M19A 1OTNA 3CIYA 4Z64C 3GOZA 3ULVA 4M7EC 4OQTA 4PEQB 3W3KA 4K17A 4YEBB 3WPCA 5GS0A 3C6PB 4U06A 4FD0A 3REZA 3ZYJA 3A79B 3RIZA 4V2EA 3JB9j 1XCDA 1K5GC 4WYKA 5IJCA 4KNGA 4BSUA 2OMUA 4HQ1A 4AY9X 4KXFB 4QBZA 2V70A 4Y61B 1IO0A 3ZYOA 3G3AA 3C6NB 1FS2A 1OGQA 4XGOA 5CMPA 4FHOA 1GWBA 4Z8GA 2ID5A 5HZLB 2CA6A 3CIGA 1KOOA 1U0ND 4ARRA 3VQ1A 5LFNA 2P1OB 3G39A 3W3JA 5B0TA 4C2AB 4CNCA 1OOKG 4LSXC 2JE1A 3BZ5A 5AZ5A 2O6SA 5GQRK 2Z63A 2OMWA 3WPDA 4R6GA 4CNMA 2WQWA 2RR6A 1K5DC 3O6NA 3WPFA 1FT8A 5IYXC 3ZYNA 4U08A 3WPHA 5B0NA 5GMHA 1H6TA 5A5CA 4ARNA 4PERA 3OJAA 4B8CD 1XECA 3G3BA 2XOTA 3E6JA 4FS7A 1DFJI 2Q4GW 3UL7A 3WPGA 2P1NB 4L3FA 2OMYA 4LSAA 1FO1A 2Z62A 4C2BB 1A9NA 4LI1A 2Z81A 4LSCA 4CC4C 2V9SA 1G9UA 1W8AA 2WQUA 4EZGA 4XOSA 4ECNA 3WPIA 3OJAB 3E2JA 5GMFA 4Q62A 1JL5A 4PQ8A 4CC4A 1M10B 3DZEA 1XWDC 5IJDA 4J4LA 4PSJA 3RFSA 4RCAB 1ZIWA 4BSRA 5GS2B 5HDHA 1WWLA 4G8AA 3ULAA 3G06A 3WN4A 4L3AA 5IJBA 1M9SA 3UL9A 5FTTB 1P9AG 3P72A 4Q3GA 2Z7XA 4CP6A 4CILA 1M9LA 3E3ZA 1P8VA 2JE0A 3RFEA 4Z79A 5AWDA 1DS9A 3CVRA 1O6SA 4MN8B 3SB4A 1O6VA 3FXIA 1A4YA 2O6RA 4IM6A 2Y5QA 4TZHA 2Z7XB 1Z7XW 4Z61C 3E4GA 3O53A 2IFGA 3RGXA 4RWTC 1O6TA 4R5DA 1FQVA 4NKGA 4AW4A 4R07A 1YRGA 2UZXA 3KJ4A 2RA8A 4FMZA 1LTXA 2Z82A 4R5CA 2JQDA 4R0AA 3G04C 2UZYA 4U7LA 4R6JA 2WQXA 1XEUA 3TSRE 2Z66A 2FT3A 4QXEA 3RGZA 4BV4R 3OGKB 4H09A 2P1PB 4QC0A 3ULUA 3C6OB 3M18A 2A0ZA 4BSSA 4R58A 4WP6A 4Z94G 1H6UA 2ELLA 4FDWA 3PMHG 5B4PA 3ZYIA 1SQ0B 4M7EA 4R08A 3RJ0A 4LXSA 2Z64A 3OGLB 2OMVA 1DCEA 1OTMA 3WPBA 4NKHA 5GMGA 2P1MB 5AWAA 2BEXA 3UN9A 4LXRA 4U09A 3W3LA 2P1QB 4XSQA 4J0MA 3WPEA 4P91A 4P8SA 4Q3IA 3W3GA 2OMXA 3W3NA 2V9TB 2ASSB 2ASTB 4R6AA 4RCWA 1PGVA 3RW6A 2WFHA 5AWCA 4I6JB 2OMTA 4UFRA 1QYYA 2O6QA 5AWBA 2BNHA 3W3MA 4LI2A 2WQVA 2XWTC 3RW7A 4ECOA 2Z65A 4LSXA 5D3IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R9U A;  4R6F A;  3OGM B;  3RFJ A;  4GLP A;  4GT6 A;  1XKU A;  4R09 A;  2OMZ A;  4PKI G;  4MQW X;  1D0B A;  4V2C A;  3VQ2 A;  1P8T A;  4FCG A;  1OTO A;  1M0Z A;  4V2D A;  4KT1 A;  1OZN A;  1KOH A;  5CMN A;  3UL8 A;  3M19 A;  1OTN A;  3CIY A;  4Z64 C;  3GOZ A;  3ULV A;  4M7E C;  4OQT A;  4PEQ B;  3W3K A;  4K17 A;  4YEB B;  3WPC A;  5GS0 A;  3C6P B;  4U06 A;  4FD0 A;  3REZ A;  3ZYJ A;  3A79 B;  3RIZ A;  4V2E A;  3JB9 j;  1XCD A;  1K5G C;  4WYK A;  5IJC A;  4KNG A;  4BSU A;  2OMU A;  4HQ1 A;  4AY9 X;  4KXF B;  4QBZ A;  2V70 A;  4Y61 B;  1IO0 A;  3ZYO A;  3G3A A;  3C6N B;  1FS2 A;  1OGQ A;  4XGO A;  5CMP A;  4FHO A;  1GWB A;  4Z8G A;  2ID5 A;  5HZL B;  2CA6 A;  3CIG A;  1KOO A;  1U0N D;  4ARR A;  3VQ1 A;  5LFN A;  2P1O B;  3G39 A;  3W3J A;  5B0T A;  4C2A B;  4CNC A;  1OOK G;  4LSX C;  2JE1 A;  3BZ5 A;  5AZ5 A;  2O6S A;  5GQR K;  2Z63 A;  2OMW A;  3WPD A;  4R6G A;  4CNM A;  2WQW A;  2RR6 A;  1K5D C;  3O6N A;  3WPF A;  1FT8 A;  5IYX C;  3ZYN A;  4U08 A;  3WPH A;  5B0N A;  5GMH A;  1H6T A;  5A5C A;  4ARN A;  4PER A;  3OJA A;  4B8C D;  1XEC A;  3G3B A;  2XOT A;  3E6J A;  4FS7 A;  1DFJ I;  2Q4G W;  3UL7 A;  3WPG A;  2P1N B;  4L3F A;  2OMY A;  4LSA A;  1FO1 A;  2Z62 A;  4C2B B;  1A9N A;  4LI1 A;  2Z81 A;  4LSC A;  4CC4 C;  2V9S A;  1G9U A;  1W8A A;  2WQU A;  4EZG A;  4XOS A;  4ECN A;  3WPI A;  3OJA B;  3E2J A;  5GMF A;  4Q62 A;  1JL5 A;  4PQ8 A;  4CC4 A;  1M10 B;  3DZE A;  1XWD C;  5IJD A;  4J4L A;  4PSJ A;  3RFS A;  4RCA B;  1ZIW A;  4BSR A;  5GS2 B;  5HDH A;  1WWL A;  4G8A A;  3ULA A;  3G06 A;  3WN4 A;  4L3A A;  5IJB A;  1M9S A;  3UL9 A;  5FTT B;  1P9A G;  3P72 A;  4Q3G A;  2Z7X A;  4CP6 A;  4CIL A;  1M9L A;  3E3Z A;  1P8V A;  2JE0 A;  3RFE A;  4Z79 A;  5AWD A;  1DS9 A;  3CVR A;  1O6S A;  4MN8 B;  3SB4 A;  1O6V A;  3FXI A;  1A4Y A;  2O6R A;  4IM6 A;  2Y5Q A;  4TZH A;  2Z7X B;  1Z7X W;  4Z61 C;  3E4G A;  3O53 A;  2IFG A;  3RGX A;  4RWT C;  1O6T A;  4R5D A;  1FQV A;  4NKG A;  4AW4 A;  4R07 A;  1YRG A;  2UZX A;  3KJ4 A;  2RA8 A;  4FMZ A;  1LTX A;  2Z82 A;  4R5C A;  2JQD A;  4R0A A;  3G04 C;  2UZY A;  4U7L A;  4R6J A;  2WQX A;  1XEU A;  3TSR E;  2Z66 A;  2FT3 A;  4QXE A;  3RGZ A;  4BV4 R;  3OGK B;  4H09 A;  2P1P B;  4QC0 A;  3ULU A;  3C6O B;  3M18 A;  2A0Z A;  4BSS A;  4R58 A;  4WP6 A;  4Z94 G;  1H6U A;  2ELL A;  4FDW A;  3PMH G;  5B4P A;  3ZYI A;  1SQ0 B;  4M7E A;  4R08 A;  3RJ0 A;  4LXS A;  2Z64 A;  3OGL B;  2OMV A;  1DCE A;  1OTM A;  3WPB A;  4NKH A;  5GMG A;  2P1M B;  5AWA A;  2BEX A;  3UN9 A;  4LXR A;  4U09 A;  3W3L A;  2P1Q B;  4XSQ A;  4J0M A;  3WPE A;  4P91 A;  4P8S A;  4Q3I A;  3W3G A;  2OMX A;  3W3N A;  2V9T B;  2ASS B;  2AST B;  4R6A A;  4RCW A;  1PGV A;  3RW6 A;  2WFH A;  5AWC A;  4I6J B;  2OMT A;  4UFR A;  1QYY A;  2O6Q A;  5AWB A;  2BNH A;  3W3M A;  4LI2 A;  2WQV A;  2XWT C;  3RW7 A;  4ECO A;  2Z65 A;  4LSX A;  5D3I A; 
#chains in the Genus database with same CATH topology
 2R9U A;  4R6F A;  3OGM B;  3RFJ A;  4GLP A;  4GT6 A;  1XKU A;  4R09 A;  2OMZ A;  4PKI G;  4MQW X;  1D0B A;  4V2C A;  3VQ2 A;  1P8T A;  4FCG A;  1OTO A;  1M0Z A;  4V2D A;  4KT1 A;  1OZN A;  1KOH A;  5CMN A;  3UL8 A;  3M19 A;  1OTN A;  3CIY A;  4Z64 C;  3GOZ A;  3ULV A;  4M7E C;  4OQT A;  4PEQ B;  3W3K A;  4K17 A;  4YEB B;  3WPC A;  5GS0 A;  3C6P B;  4U06 A;  4FD0 A;  3REZ A;  3ZYJ A;  3A79 B;  3RIZ A;  4V2E A;  3JB9 j;  1XCD A;  1K5G C;  4WYK A;  5IJC A;  4KNG A;  4BSU A;  2OMU A;  4HQ1 A;  4AY9 X;  4KXF B;  4QBZ A;  2V70 A;  4Y61 B;  1IO0 A;  3ZYO A;  3G3A A;  3C6N B;  4NZT M;  1FS2 A;  1OGQ A;  4XGO A;  5CMP A;  4FHO A;  1GWB A;  4Z8G A;  2ID5 A;  5HZL B;  2CA6 A;  3CIG A;  1KOO A;  1U0N D;  4ARR A;  3VQ1 A;  5LFN A;  2P1O B;  3G39 A;  3W3J A;  5B0T A;  4C2A B;  4CNC A;  1OOK G;  4LSX C;  2JE1 A;  3BZ5 A;  5AZ5 A;  2O6S A;  5GQR K;  2Z63 A;  2OMW A;  3WPD A;  4R6G A;  4CNM A;  2WQW A;  2RR6 A;  1K5D C;  3O6N A;  3WPF A;  1FT8 A;  5IYX C;  3ZYN A;  4U08 A;  3WPH A;  5B0N A;  5GMH A;  1H6T A;  5A5C A;  4ARN A;  4PER A;  3OJA A;  4B8C D;  1XEC A;  3G3B A;  2XOT A;  3E6J A;  4FS7 A;  1DFJ I;  2Q4G W;  3UL7 A;  3WPG A;  2P1N B;  4L3F A;  2OMY A;  4LSA A;  1FO1 A;  2Z62 A;  4C2B B;  1A9N A;  4LI1 A;  2Z81 A;  4LSC A;  4CC4 C;  2V9S A;  1G9U A;  1W8A A;  2WQU A;  4EZG A;  4XOS A;  4ECN A;  3WPI A;  3OJA B;  4NZR M;  3E2J A;  5GMF A;  4Q62 A;  1JL5 A;  4PQ8 A;  4CC4 A;  1M10 B;  3DZE A;  1XWD C;  5IJD A;  4J4L A;  4PSJ A;  3RFS A;  4RCA B;  1ZIW A;  4BSR A;  5GS2 B;  5HDH A;  1WWL A;  4G8A A;  3ULA A;  3G06 A;  3WN4 A;  4L3A A;  5IJB A;  1M9S A;  3UL9 A;  5FTT B;  1P9A G;  3P72 A;  4Q3G A;  2Z7X A;  4CP6 A;  4CIL A;  1M9L A;  3E3Z A;  1P8V A;  2JE0 A;  3RFE A;  4Z79 A;  5AWD A;  1DS9 A;  3CVR A;  1O6S A;  4MN8 B;  3SB4 A;  1O6V A;  3FXI A;  1A4Y A;  2O6R A;  4IM6 A;  2Y5Q A;  4TZH A;  2Z7X B;  1Z7X W;  4Z61 C;  3E4G A;  3O53 A;  2IFG A;  3RGX A;  4RWT C;  1O6T A;  4R5D A;  1FQV A;  4NKG A;  4AW4 A;  4R07 A;  1YRG A;  2UZX A;  3KJ4 A;  2RA8 A;  4FMZ A;  1LTX A;  2Z82 A;  4R5C A;  2JQD A;  4R0A A;  3G04 C;  2UZY A;  4U7L A;  4R6J A;  2WQX A;  1XEU A;  3TSR E;  2Z66 A;  2FT3 A;  4QXE A;  3RGZ A;  4BV4 R;  3OGK B;  4H09 A;  2P1P B;  4QC0 A;  3ULU A;  3C6O B;  3M18 A;  2A0Z A;  4BSS A;  4R58 A;  4WP6 A;  4Z94 G;  1H6U A;  2ELL A;  4FDW A;  3PMH G;  5B4P A;  3ZYI A;  1SQ0 B;  4M7E A;  4R08 A;  3RJ0 A;  4LXS A;  2Z64 A;  3OGL B;  2OMV A;  1DCE A;  1OTM A;  3WPB A;  4NKH A;  5GMG A;  2P1M B;  5AWA A;  2BEX A;  3UN9 A;  4LXR A;  4U09 A;  3W3L A;  2P1Q B;  4XSQ A;  4J0M A;  3WPE A;  4P91 A;  4P8S A;  4Q3I A;  3W3G A;  2OMX A;  3W3N A;  2V9T B;  2ASS B;  2AST B;  4R6A A;  4RCW A;  1PGV A;  3RW6 A;  2WFH A;  5AWC A;  4I6J B;  2OMT A;  4UFR A;  1QYY A;  2O6Q A;  5AWB A;  2BNH A;  3W3M A;  4LI2 A;  2WQV A;  2XWT C;  3RW7 A;  4ECO A;  2Z65 A;  4LSX A;  5D3I A; 
#chains in the Genus database with same CATH homology
 2R9U A;  4R6F A;  3OGM B;  3RFJ A;  4GLP A;  4GT6 A;  1XKU A;  4R09 A;  2OMZ A;  4PKI G;  4MQW X;  1D0B A;  4V2C A;  3VQ2 A;  1P8T A;  4FCG A;  1OTO A;  1M0Z A;  4V2D A;  4KT1 A;  1OZN A;  1KOH A;  5CMN A;  3UL8 A;  3M19 A;  1OTN A;  3CIY A;  4Z64 C;  3GOZ A;  3ULV A;  4M7E C;  4OQT A;  4PEQ B;  3W3K A;  4K17 A;  4YEB B;  3WPC A;  5GS0 A;  3C6P B;  4U06 A;  4FD0 A;  3REZ A;  3ZYJ A;  3A79 B;  3RIZ A;  4V2E A;  3JB9 j;  1XCD A;  1K5G C;  4WYK A;  5IJC A;  4KNG A;  4BSU A;  2OMU A;  4HQ1 A;  4AY9 X;  4KXF B;  4QBZ A;  2V70 A;  4Y61 B;  1IO0 A;  3ZYO A;  3G3A A;  3C6N B;  1FS2 A;  1OGQ A;  4XGO A;  5CMP A;  4FHO A;  1GWB A;  4Z8G A;  2ID5 A;  5HZL B;  2CA6 A;  3CIG A;  1KOO A;  1U0N D;  4ARR A;  3VQ1 A;  5LFN A;  2P1O B;  3G39 A;  3W3J A;  5B0T A;  4C2A B;  4CNC A;  1OOK G;  4LSX C;  2JE1 A;  3BZ5 A;  5AZ5 A;  2O6S A;  5GQR K;  2Z63 A;  2OMW A;  3WPD A;  4R6G A;  4CNM A;  2WQW A;  2RR6 A;  1K5D C;  3O6N A;  3WPF A;  1FT8 A;  5IYX C;  3ZYN A;  4U08 A;  3WPH A;  5B0N A;  5GMH A;  1H6T A;  5A5C A;  4ARN A;  4PER A;  3OJA A;  4B8C D;  1XEC A;  3G3B A;  2XOT A;  3E6J A;  4FS7 A;  1DFJ I;  2Q4G W;  3UL7 A;  3WPG A;  2P1N B;  4L3F A;  2OMY A;  4LSA A;  1FO1 A;  2Z62 A;  4C2B B;  1A9N A;  4LI1 A;  2Z81 A;  4LSC A;  4CC4 C;  2V9S A;  1G9U A;  1W8A A;  2WQU A;  4EZG A;  4XOS A;  4ECN A;  3WPI A;  3OJA B;  3E2J A;  5GMF A;  4Q62 A;  1JL5 A;  4PQ8 A;  4CC4 A;  1M10 B;  3DZE A;  1XWD C;  5IJD A;  4J4L A;  4PSJ A;  3RFS A;  4RCA B;  1ZIW A;  4BSR A;  5GS2 B;  5HDH A;  1WWL A;  4G8A A;  3ULA A;  3G06 A;  3WN4 A;  4L3A A;  5IJB A;  1M9S A;  3UL9 A;  5FTT B;  1P9A G;  3P72 A;  4Q3G A;  2Z7X A;  4CP6 A;  4CIL A;  1M9L A;  3E3Z A;  1P8V A;  2JE0 A;  3RFE A;  4Z79 A;  5AWD A;  1DS9 A;  3CVR A;  1O6S A;  4MN8 B;  3SB4 A;  1O6V A;  3FXI A;  1A4Y A;  2O6R A;  4IM6 A;  2Y5Q A;  4TZH A;  2Z7X B;  1Z7X W;  4Z61 C;  3E4G A;  3O53 A;  2IFG A;  3RGX A;  4RWT C;  1O6T A;  4R5D A;  1FQV A;  4NKG A;  4AW4 A;  4R07 A;  1YRG A;  2UZX A;  3KJ4 A;  2RA8 A;  4FMZ A;  1LTX A;  2Z82 A;  4R5C A;  2JQD A;  4R0A A;  3G04 C;  2UZY A;  4U7L A;  4R6J A;  2WQX A;  1XEU A;  3TSR E;  2Z66 A;  2FT3 A;  4QXE A;  3RGZ A;  4BV4 R;  3OGK B;  4H09 A;  2P1P B;  4QC0 A;  3ULU A;  3C6O B;  3M18 A;  2A0Z A;  4BSS A;  4R58 A;  4WP6 A;  4Z94 G;  1H6U A;  2ELL A;  4FDW A;  3PMH G;  5B4P A;  3ZYI A;  1SQ0 B;  4M7E A;  4R08 A;  3RJ0 A;  4LXS A;  2Z64 A;  3OGL B;  2OMV A;  1DCE A;  1OTM A;  3WPB A;  4NKH A;  5GMG A;  2P1M B;  5AWA A;  2BEX A;  3UN9 A;  4LXR A;  4U09 A;  3W3L A;  2P1Q B;  4XSQ A;  4J0M A;  3WPE A;  4P91 A;  4P8S A;  4Q3I A;  3W3G A;  2OMX A;  3W3N A;  2V9T B;  2ASS B;  2AST B;  4R6A A;  4RCW A;  1PGV A;  3RW6 A;  2WFH A;  5AWC A;  4I6J B;  2OMT A;  4UFR A;  1QYY A;  2O6Q A;  5AWB A;  2BNH A;  3W3M A;  4LI2 A;  2WQV A;  2XWT C;  3RW7 A;  4ECO A;  2Z65 A;  4LSX A;  5D3I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...