2ASTB

Crystal structure of skp1-skp2-cks1 in complex with a p27 peptide
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
325
structure length
325
Chain Sequence
b'VSWDSLPDELLLGIFSCLCLPELLKVSGVCKRWYRLASDESLWQTLDLTGKNLHPDVTGRLLSQGVIAFRCPRSFMDQPLAEHFSPFRVQHMDLSNSVIEVSTLHGILSQCSKLQNLSLEGLRLSDPIVNTLAKNSNLVRLNLSGCSGFSEFALQTLLSSCSRLDELNLSWCFDFTEKHVQVAVAHVSETITQLNLSGYRKNLQKSDLSTLVRRCPNLVHLDLSDSVMLKNDCFQEFFQLNYLQHLSLSRCYDIIPETLLELGEIPTLKTLQVFGIVPDGTLQLLKEALPHLQINCSHFTTIARPTIGNKKNQEIWGIKCRLTLQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords S-phase kinase-associated protein 1A
publication title Structural Basis of the Cks1-Dependent Recognition of p27(Kip1) by the SCF(Skp2) Ubiquitin Ligase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase/ligase inhibitor
total genus 116
structure length 325
sequence length 325
ec nomenclature
pdb deposition date 2005-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF12937 F-box-like F-box-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 2astB00
1P8TA 5AZ5A 4XSQA 4U06A 2OMUA 4Z94G 5GQRK 4C2AB 4R58A 4I6JB 4R07A 1DFJI 4WP6A 5GMFA 4ARNA 4LSXA 5GMGA 4CNCA 5IJDA 2XOTA 1IO0A 3WPEA 3WPFA 2OMVA 4TZHA 1H6UA 4QBZA 3VQ1A 2WQVA 4FHOA 3E4GA 3E3ZA 3GOZA 4XGOA 4R6FA 5B0TA 2ELLA 2R9UA 4NKHA 3ZYNA 4R6GA 1OZNA 1A9NA 1K5GC 4R09A 2O6RA 2BEXA 2OMYA 3VQ2A 4CILA 4L3AA 4R5DA 4Q3GA 2V9TB 4R0AA 4BSSA 4PERA 1WWLA 4CNMA 2Z65A 2JE0A 4XOSA 3W3NA 2UZYA 2Z64A 4IM6A 1KOHA 1OGQA 4L3FA 4U7LA 4LI2A 5IJBA 4FDWA 3G39A 4RWTC 4GT6A 1QYYA 4U09A 4AY9X 5B0NA 4LSCA 3BZ5A 4R5CA 3UL7A 4QC0A 2RA8A 3C6OB 3W3GA 4Z8GA 5IYXC 1GWBA 1FS2A 4LSAA 2O6SA 3W3KA 4AW4A 4U08A 3RGZA 4FCGA 3ZYIA 5AWDA 3RW7A 4C2BB 5GMHA 4LSXC 4Z64C 4UFRA 3WPDA 4J4LA 5AWBA 1M0ZA 1JL5A 3E6JA 3SB4A 2IFGA 3OJAA 4M7EC 4GLPA 1M9SA 4PEQB 2P1MB 1K5DC 2ASSB 3E2JA 3WN4A 1OTOA 4ECOA 4BV4R 4KT1A 1OTMA 4Q3IA 5CMNA 2FT3A 3C6PB 5GS2B 1XWDC 1O6SA 2UZXA 3RIZA 5B4PA 2O6QA 4Z79A 1DS9A 4PQ8A 3OJAB 4Y61B 2WQUA 1Z7XW 3FXIA 5AWCA 3O53A 2V9SA 2RR6A 3CIYA 2WQWA 5HZLB 1M10B 3G3AA 3JB9j 3W3MA 5HDHA 3UL8A 5CMPA 1XKUA 2Z63A 3WPIA 2BNHA 4V2DA 4OQTA 4NKGA 3ULUA 4QXEA 3A79B 2Z7XA 5A5CA 2OMZA 3RFSA 3ULAA 1O6VA 3CIGA 4MN8B 3RFJA 5LFNA 1FO1A 4FS7A 2WFHA 4CC4C 4MQWX 1H6TA 3RGXA 4WYKA 5FTTB 4Z61C 4ARRA 4RCAB 4P91A 3OGMB 1P8VA 3RJ0A 4R6JA 4BSUA 3C6NB 2Z66A 1OOKG 4Q62A 4FMZA 2XWTC 4LXSA 4PKIG 3WPGA 4LXRA 2WQXA 3WPHA 4R6AA 2OMXA 3G06A 4KXFB 1A4YA 2Y5QA 2CA6A 1G9UA 5D3IA 1W8AA 3REZA 1ZIWA 4RCWA 3P72A 4BSRA 4HQ1A 2Z62A 2Z82A 1PGVA 3DZEA 1OTNA 4G8AA 4M7EA 3O6NA 3RFEA 3WPBA 3CVRA 4KNGA 3G3BA 4YEBB 3G04C 3M18A 3UN9A 4P8SA 3UL9A 1LTXA 3RW6A 2P1QB 5AWAA 3TSRE 3PMHG 2OMWA 3OGLB 1O6TA 3M19A 4PSJA 5IJCA 4CP6A 2Z81A 5GS0A 1P9AG 2A0ZA 2OMTA 4LI1A 3WPCA 3ZYJA 3W3LA 1DCEA 2V70A 2ASTB 1XCDA 4R08A 4V2EA 1XEUA 3KJ4A 1D0BA 1SQ0B 1XECA 2JQDA 1KOOA 4ECNA 1YRGA 1U0ND 3W3JA 4FD0A 3OGKB 4B8CD 4K17A 2Q4GW 2P1NB 1FQVA 3ZYOA 4J0MA 4V2CA 1M9LA 2JE1A 2Z7XB 1FT8A 4EZGA 2ID5A 3ULVA 4CC4A 2P1PB 4H09A 2P1OB
chains in the Genus database with same CATH superfamily
1P8TA 5AZ5A 4XSQA 4U06A 2OMUA 4Z94G 5GQRK 4C2AB 4R58A 4I6JB 4R07A 1DFJI 4WP6A 5GMFA 4ARNA 4LSXA 5GMGA 4CNCA 5IJDA 2XOTA 1IO0A 3WPEA 3WPFA 2OMVA 4TZHA 1H6UA 4QBZA 3VQ1A 2WQVA 4FHOA 3E4GA 3E3ZA 3GOZA 4XGOA 4R6FA 5B0TA 2ELLA 2R9UA 4NKHA 3ZYNA 4R6GA 1OZNA 1A9NA 1K5GC 4R09A 2O6RA 2BEXA 2OMYA 3VQ2A 4CILA 4L3AA 4R5DA 4Q3GA 2V9TB 4R0AA 4BSSA 4PERA 1WWLA 4CNMA 2Z65A 2JE0A 4XOSA 3W3NA 2UZYA 2Z64A 4IM6A 1KOHA 1OGQA 4L3FA 4U7LA 4LI2A 5IJBA 4FDWA 3G39A 4RWTC 4GT6A 1QYYA 4U09A 4AY9X 5B0NA 4LSCA 3BZ5A 4R5CA 3UL7A 4QC0A 2RA8A 3C6OB 3W3GA 4Z8GA 5IYXC 1GWBA 1FS2A 4LSAA 2O6SA 3W3KA 4AW4A 4U08A 3RGZA 4FCGA 3ZYIA 5AWDA 3RW7A 4C2BB 5GMHA 4LSXC 4Z64C 4UFRA 3WPDA 4J4LA 5AWBA 1M0ZA 1JL5A 3E6JA 3SB4A 2IFGA 3OJAA 4M7EC 4GLPA 1M9SA 4PEQB 2P1MB 1K5DC 2ASSB 3E2JA 3WN4A 1OTOA 4ECOA 4BV4R 4KT1A 1OTMA 4Q3IA 5CMNA 2FT3A 3C6PB 5GS2B 1XWDC 1O6SA 2UZXA 3RIZA 5B4PA 2O6QA 4Z79A 1DS9A 4PQ8A 3OJAB 4Y61B 2WQUA 1Z7XW 3FXIA 5AWCA 3O53A 2V9SA 2RR6A 3CIYA 2WQWA 5HZLB 1M10B 3G3AA 3JB9j 3W3MA 5HDHA 3UL8A 5CMPA 1XKUA 2Z63A 3WPIA 2BNHA 4V2DA 4OQTA 4NKGA 3ULUA 4QXEA 3A79B 2Z7XA 5A5CA 2OMZA 3RFSA 3ULAA 1O6VA 3CIGA 4MN8B 3RFJA 4NZTM 5LFNA 1FO1A 4FS7A 2WFHA 4CC4C 4MQWX 1H6TA 3RGXA 4WYKA 5FTTB 4Z61C 4ARRA 4RCAB 4P91A 3OGMB 1P8VA 3RJ0A 4R6JA 4BSUA 3C6NB 2Z66A 1OOKG 4Q62A 4FMZA 2XWTC 4LXSA 4PKIG 3WPGA 4LXRA 2WQXA 3WPHA 4R6AA 2OMXA 3G06A 4KXFB 1A4YA 2Y5QA 2CA6A 1G9UA 5D3IA 1W8AA 3REZA 1ZIWA 4RCWA 3P72A 4BSRA 4HQ1A 2Z62A 4NZRM 2Z82A 1PGVA 3DZEA 1OTNA 4G8AA 4M7EA 3O6NA 3RFEA 3WPBA 3CVRA 4KNGA 3G3BA 4YEBB 3G04C 3M18A 3UN9A 4P8SA 3UL9A 1LTXA 3RW6A 2P1QB 5AWAA 3TSRE 3PMHG 2OMWA 3OGLB 1O6TA 3M19A 4PSJA 5IJCA 4CP6A 2Z81A 5GS0A 1P9AG 2A0ZA 2OMTA 4LI1A 3WPCA 3ZYJA 3W3LA 1DCEA 2V70A 2ASTB 1XCDA 4R08A 4V2EA 1XEUA 3KJ4A 1D0BA 1SQ0B 1XECA 2JQDA 1KOOA 4ECNA 1YRGA 1U0ND 3W3JA 4FD0A 3OGKB 4B8CD 4K17A 2Q4GW 2P1NB 1FQVA 3ZYOA 4J0MA 4V2CA 1M9LA 2JE1A 2Z7XB 1FT8A 4EZGA 2ID5A 3ULVA 4CC4A 2P1PB 4H09A 2P1OB
chains in the Genus database with same CATH topology
1P8TA 5AZ5A 4XSQA 4U06A 2OMUA 4Z94G 5GQRK 4C2AB 4R58A 4I6JB 4R07A 1DFJI 4WP6A 5GMFA 4ARNA 4LSXA 5GMGA 4CNCA 5IJDA 2XOTA 1IO0A 3WPEA 3WPFA 2OMVA 4TZHA 1H6UA 4QBZA 3VQ1A 2WQVA 4FHOA 3E4GA 3E3ZA 3GOZA 4XGOA 4R6FA 5B0TA 2ELLA 2R9UA 4NKHA 3ZYNA 4R6GA 1OZNA 1A9NA 1K5GC 4R09A 2O6RA 2BEXA 2OMYA 3VQ2A 4CILA 4L3AA 4R5DA 4Q3GA 2V9TB 4R0AA 4BSSA 4PERA 1WWLA 4CNMA 2Z65A 2JE0A 4XOSA 3W3NA 2UZYA 2Z64A 4IM6A 1KOHA 1OGQA 4L3FA 4U7LA 4LI2A 5IJBA 4FDWA 3G39A 4RWTC 4GT6A 1QYYA 4U09A 4AY9X 5B0NA 4LSCA 3BZ5A 4R5CA 3UL7A 4QC0A 2RA8A 3C6OB 3W3GA 4Z8GA 5IYXC 1GWBA 1FS2A 4LSAA 2O6SA 3W3KA 4AW4A 4U08A 3RGZA 4FCGA 3ZYIA 5AWDA 3RW7A 4C2BB 5GMHA 4LSXC 4Z64C 4UFRA 3WPDA 4J4LA 5AWBA 1M0ZA 1JL5A 3E6JA 3SB4A 2IFGA 3OJAA 4M7EC 4GLPA 1M9SA 4PEQB 2P1MB 1K5DC 2ASSB 3E2JA 3WN4A 1OTOA 4ECOA 4BV4R 4KT1A 1OTMA 4Q3IA 5CMNA 2FT3A 3C6PB 5GS2B 1XWDC 1O6SA 2UZXA 3RIZA 5B4PA 2O6QA 4Z79A 1DS9A 4PQ8A 3OJAB 4Y61B 2WQUA 1Z7XW 3FXIA 5AWCA 3O53A 2V9SA 2RR6A 3CIYA 2WQWA 5HZLB 1M10B 3G3AA 3JB9j 3W3MA 5HDHA 3UL8A 5CMPA 1XKUA 2Z63A 3WPIA 2BNHA 4V2DA 4OQTA 4NKGA 3ULUA 4QXEA 3A79B 2Z7XA 5A5CA 2OMZA 3RFSA 3ULAA 1O6VA 3CIGA 4MN8B 3RFJA 5LFNA 1FO1A 4FS7A 2WFHA 4CC4C 4MQWX 1H6TA 3RGXA 4WYKA 5FTTB 4Z61C 4ARRA 4RCAB 4P91A 3OGMB 1P8VA 3RJ0A 4R6JA 4BSUA 3C6NB 2Z66A 1OOKG 4Q62A 4FMZA 2XWTC 4LXSA 4PKIG 3WPGA 4LXRA 2WQXA 3WPHA 4R6AA 2OMXA 3G06A 4KXFB 1A4YA 2Y5QA 2CA6A 1G9UA 5D3IA 1W8AA 3REZA 1ZIWA 4RCWA 3P72A 4BSRA 4HQ1A 2Z62A 2Z82A 1PGVA 3DZEA 1OTNA 4G8AA 4M7EA 3O6NA 3RFEA 3WPBA 3CVRA 4KNGA 3G3BA 4YEBB 3G04C 3M18A 3UN9A 4P8SA 3UL9A 1LTXA 3RW6A 2P1QB 5AWAA 3TSRE 3PMHG 2OMWA 3OGLB 1O6TA 3M19A 4PSJA 5IJCA 4CP6A 2Z81A 5GS0A 1P9AG 2A0ZA 2OMTA 4LI1A 3WPCA 3ZYJA 3W3LA 1DCEA 2V70A 2ASTB 1XCDA 4R08A 4V2EA 1XEUA 3KJ4A 1D0BA 1SQ0B 1XECA 2JQDA 1KOOA 4ECNA 1YRGA 1U0ND 3W3JA 4FD0A 3OGKB 4B8CD 4K17A 2Q4GW 2P1NB 1FQVA 3ZYOA 4J0MA 4V2CA 1M9LA 2JE1A 2Z7XB 1FT8A 4EZGA 2ID5A 3ULVA 4CC4A 2P1PB 4H09A 2P1OB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P8T A;  5AZ5 A;  4XSQ A;  4U06 A;  2OMU A;  4Z94 G;  5GQR K;  4C2A B;  4R58 A;  4I6J B;  4R07 A;  1DFJ I;  4WP6 A;  5GMF A;  4ARN A;  4LSX A;  5GMG A;  4CNC A;  5IJD A;  2XOT A;  1IO0 A;  3WPE A;  3WPF A;  2OMV A;  4TZH A;  1H6U A;  4QBZ A;  3VQ1 A;  2WQV A;  4FHO A;  3E4G A;  3E3Z A;  3GOZ A;  4XGO A;  4R6F A;  5B0T A;  2ELL A;  2R9U A;  4NKH A;  3ZYN A;  4R6G A;  1OZN A;  1A9N A;  1K5G C;  4R09 A;  2O6R A;  2BEX A;  2OMY A;  3VQ2 A;  4CIL A;  4L3A A;  4R5D A;  4Q3G A;  2V9T B;  4R0A A;  4BSS A;  4PER A;  1WWL A;  4CNM A;  2Z65 A;  2JE0 A;  4XOS A;  3W3N A;  2UZY A;  2Z64 A;  4IM6 A;  1KOH A;  1OGQ A;  4L3F A;  4U7L A;  4LI2 A;  5IJB A;  4FDW A;  3G39 A;  4RWT C;  4GT6 A;  1QYY A;  4U09 A;  4AY9 X;  5B0N A;  4LSC A;  3BZ5 A;  4R5C A;  3UL7 A;  4QC0 A;  2RA8 A;  3C6O B;  3W3G A;  4Z8G A;  5IYX C;  1GWB A;  1FS2 A;  4LSA A;  2O6S A;  3W3K A;  4AW4 A;  4U08 A;  3RGZ A;  4FCG A;  3ZYI A;  5AWD A;  3RW7 A;  4C2B B;  5GMH A;  4LSX C;  4Z64 C;  4UFR A;  3WPD A;  4J4L A;  5AWB A;  1M0Z A;  1JL5 A;  3E6J A;  3SB4 A;  2IFG A;  3OJA A;  4M7E C;  4GLP A;  1M9S A;  4PEQ B;  2P1M B;  1K5D C;  2ASS B;  3E2J A;  3WN4 A;  1OTO A;  4ECO A;  4BV4 R;  4KT1 A;  1OTM A;  4Q3I A;  5CMN A;  2FT3 A;  3C6P B;  5GS2 B;  1XWD C;  1O6S A;  2UZX A;  3RIZ A;  5B4P A;  2O6Q A;  4Z79 A;  1DS9 A;  4PQ8 A;  3OJA B;  4Y61 B;  2WQU A;  1Z7X W;  3FXI A;  5AWC A;  3O53 A;  2V9S A;  2RR6 A;  3CIY A;  2WQW A;  5HZL B;  1M10 B;  3G3A A;  3JB9 j;  3W3M A;  5HDH A;  3UL8 A;  5CMP A;  1XKU A;  2Z63 A;  3WPI A;  2BNH A;  4V2D A;  4OQT A;  4NKG A;  3ULU A;  4QXE A;  3A79 B;  2Z7X A;  5A5C A;  2OMZ A;  3RFS A;  3ULA A;  1O6V A;  3CIG A;  4MN8 B;  3RFJ A;  5LFN A;  1FO1 A;  4FS7 A;  2WFH A;  4CC4 C;  4MQW X;  1H6T A;  3RGX A;  4WYK A;  5FTT B;  4Z61 C;  4ARR A;  4RCA B;  4P91 A;  3OGM B;  1P8V A;  3RJ0 A;  4R6J A;  4BSU A;  3C6N B;  2Z66 A;  1OOK G;  4Q62 A;  4FMZ A;  2XWT C;  4LXS A;  4PKI G;  3WPG A;  4LXR A;  2WQX A;  3WPH A;  4R6A A;  2OMX A;  3G06 A;  4KXF B;  1A4Y A;  2Y5Q A;  2CA6 A;  1G9U A;  5D3I A;  1W8A A;  3REZ A;  1ZIW A;  4RCW A;  3P72 A;  4BSR A;  4HQ1 A;  2Z62 A;  2Z82 A;  1PGV A;  3DZE A;  1OTN A;  4G8A A;  4M7E A;  3O6N A;  3RFE A;  3WPB A;  3CVR A;  4KNG A;  3G3B A;  4YEB B;  3G04 C;  3M18 A;  3UN9 A;  4P8S A;  3UL9 A;  1LTX A;  3RW6 A;  2P1Q B;  5AWA A;  3TSR E;  3PMH G;  2OMW A;  3OGL B;  1O6T A;  3M19 A;  4PSJ A;  5IJC A;  4CP6 A;  2Z81 A;  5GS0 A;  1P9A G;  2A0Z A;  2OMT A;  4LI1 A;  3WPC A;  3ZYJ A;  3W3L A;  1DCE A;  2V70 A;  2AST B;  1XCD A;  4R08 A;  4V2E A;  1XEU A;  3KJ4 A;  1D0B A;  1SQ0 B;  1XEC A;  2JQD A;  1KOO A;  4ECN A;  1YRG A;  1U0N D;  3W3J A;  4FD0 A;  3OGK B;  4B8C D;  4K17 A;  2Q4G W;  2P1N B;  1FQV A;  3ZYO A;  4J0M A;  4V2C A;  1M9L A;  2JE1 A;  2Z7X B;  1FT8 A;  4EZG A;  2ID5 A;  3ULV A;  4CC4 A;  2P1P B;  4H09 A;  2P1O B; 
#chains in the Genus database with same CATH topology
 1P8T A;  5AZ5 A;  4XSQ A;  4U06 A;  2OMU A;  4Z94 G;  5GQR K;  4C2A B;  4R58 A;  4I6J B;  4R07 A;  1DFJ I;  4WP6 A;  5GMF A;  4ARN A;  4LSX A;  5GMG A;  4CNC A;  5IJD A;  2XOT A;  1IO0 A;  3WPE A;  3WPF A;  2OMV A;  4TZH A;  1H6U A;  4QBZ A;  3VQ1 A;  2WQV A;  4FHO A;  3E4G A;  3E3Z A;  3GOZ A;  4XGO A;  4R6F A;  5B0T A;  2ELL A;  2R9U A;  4NKH A;  3ZYN A;  4R6G A;  1OZN A;  1A9N A;  1K5G C;  4R09 A;  2O6R A;  2BEX A;  2OMY A;  3VQ2 A;  4CIL A;  4L3A A;  4R5D A;  4Q3G A;  2V9T B;  4R0A A;  4BSS A;  4PER A;  1WWL A;  4CNM A;  2Z65 A;  2JE0 A;  4XOS A;  3W3N A;  2UZY A;  2Z64 A;  4IM6 A;  1KOH A;  1OGQ A;  4L3F A;  4U7L A;  4LI2 A;  5IJB A;  4FDW A;  3G39 A;  4RWT C;  4GT6 A;  1QYY A;  4U09 A;  4AY9 X;  5B0N A;  4LSC A;  3BZ5 A;  4R5C A;  3UL7 A;  4QC0 A;  2RA8 A;  3C6O B;  3W3G A;  4Z8G A;  5IYX C;  1GWB A;  1FS2 A;  4LSA A;  2O6S A;  3W3K A;  4AW4 A;  4U08 A;  3RGZ A;  4FCG A;  3ZYI A;  5AWD A;  3RW7 A;  4C2B B;  5GMH A;  4LSX C;  4Z64 C;  4UFR A;  3WPD A;  4J4L A;  5AWB A;  1M0Z A;  1JL5 A;  3E6J A;  3SB4 A;  2IFG A;  3OJA A;  4M7E C;  4GLP A;  1M9S A;  4PEQ B;  2P1M B;  1K5D C;  2ASS B;  3E2J A;  3WN4 A;  1OTO A;  4ECO A;  4BV4 R;  4KT1 A;  1OTM A;  4Q3I A;  5CMN A;  2FT3 A;  3C6P B;  5GS2 B;  1XWD C;  1O6S A;  2UZX A;  3RIZ A;  5B4P A;  2O6Q A;  4Z79 A;  1DS9 A;  4PQ8 A;  3OJA B;  4Y61 B;  2WQU A;  1Z7X W;  3FXI A;  5AWC A;  3O53 A;  2V9S A;  2RR6 A;  3CIY A;  2WQW A;  5HZL B;  1M10 B;  3G3A A;  3JB9 j;  3W3M A;  5HDH A;  3UL8 A;  5CMP A;  1XKU A;  2Z63 A;  3WPI A;  2BNH A;  4V2D A;  4OQT A;  4NKG A;  3ULU A;  4QXE A;  3A79 B;  2Z7X A;  5A5C A;  2OMZ A;  3RFS A;  3ULA A;  1O6V A;  3CIG A;  4MN8 B;  3RFJ A;  4NZT M;  5LFN A;  1FO1 A;  4FS7 A;  2WFH A;  4CC4 C;  4MQW X;  1H6T A;  3RGX A;  4WYK A;  5FTT B;  4Z61 C;  4ARR A;  4RCA B;  4P91 A;  3OGM B;  1P8V A;  3RJ0 A;  4R6J A;  4BSU A;  3C6N B;  2Z66 A;  1OOK G;  4Q62 A;  4FMZ A;  2XWT C;  4LXS A;  4PKI G;  3WPG A;  4LXR A;  2WQX A;  3WPH A;  4R6A A;  2OMX A;  3G06 A;  4KXF B;  1A4Y A;  2Y5Q A;  2CA6 A;  1G9U A;  5D3I A;  1W8A A;  3REZ A;  1ZIW A;  4RCW A;  3P72 A;  4BSR A;  4HQ1 A;  2Z62 A;  4NZR M;  2Z82 A;  1PGV A;  3DZE A;  1OTN A;  4G8A A;  4M7E A;  3O6N A;  3RFE A;  3WPB A;  3CVR A;  4KNG A;  3G3B A;  4YEB B;  3G04 C;  3M18 A;  3UN9 A;  4P8S A;  3UL9 A;  1LTX A;  3RW6 A;  2P1Q B;  5AWA A;  3TSR E;  3PMH G;  2OMW A;  3OGL B;  1O6T A;  3M19 A;  4PSJ A;  5IJC A;  4CP6 A;  2Z81 A;  5GS0 A;  1P9A G;  2A0Z A;  2OMT A;  4LI1 A;  3WPC A;  3ZYJ A;  3W3L A;  1DCE A;  2V70 A;  2AST B;  1XCD A;  4R08 A;  4V2E A;  1XEU A;  3KJ4 A;  1D0B A;  1SQ0 B;  1XEC A;  2JQD A;  1KOO A;  4ECN A;  1YRG A;  1U0N D;  3W3J A;  4FD0 A;  3OGK B;  4B8C D;  4K17 A;  2Q4G W;  2P1N B;  1FQV A;  3ZYO A;  4J0M A;  4V2C A;  1M9L A;  2JE1 A;  2Z7X B;  1FT8 A;  4EZG A;  2ID5 A;  3ULV A;  4CC4 A;  2P1P B;  4H09 A;  2P1O B; 
#chains in the Genus database with same CATH homology
 1P8T A;  5AZ5 A;  4XSQ A;  4U06 A;  2OMU A;  4Z94 G;  5GQR K;  4C2A B;  4R58 A;  4I6J B;  4R07 A;  1DFJ I;  4WP6 A;  5GMF A;  4ARN A;  4LSX A;  5GMG A;  4CNC A;  5IJD A;  2XOT A;  1IO0 A;  3WPE A;  3WPF A;  2OMV A;  4TZH A;  1H6U A;  4QBZ A;  3VQ1 A;  2WQV A;  4FHO A;  3E4G A;  3E3Z A;  3GOZ A;  4XGO A;  4R6F A;  5B0T A;  2ELL A;  2R9U A;  4NKH A;  3ZYN A;  4R6G A;  1OZN A;  1A9N A;  1K5G C;  4R09 A;  2O6R A;  2BEX A;  2OMY A;  3VQ2 A;  4CIL A;  4L3A A;  4R5D A;  4Q3G A;  2V9T B;  4R0A A;  4BSS A;  4PER A;  1WWL A;  4CNM A;  2Z65 A;  2JE0 A;  4XOS A;  3W3N A;  2UZY A;  2Z64 A;  4IM6 A;  1KOH A;  1OGQ A;  4L3F A;  4U7L A;  4LI2 A;  5IJB A;  4FDW A;  3G39 A;  4RWT C;  4GT6 A;  1QYY A;  4U09 A;  4AY9 X;  5B0N A;  4LSC A;  3BZ5 A;  4R5C A;  3UL7 A;  4QC0 A;  2RA8 A;  3C6O B;  3W3G A;  4Z8G A;  5IYX C;  1GWB A;  1FS2 A;  4LSA A;  2O6S A;  3W3K A;  4AW4 A;  4U08 A;  3RGZ A;  4FCG A;  3ZYI A;  5AWD A;  3RW7 A;  4C2B B;  5GMH A;  4LSX C;  4Z64 C;  4UFR A;  3WPD A;  4J4L A;  5AWB A;  1M0Z A;  1JL5 A;  3E6J A;  3SB4 A;  2IFG A;  3OJA A;  4M7E C;  4GLP A;  1M9S A;  4PEQ B;  2P1M B;  1K5D C;  2ASS B;  3E2J A;  3WN4 A;  1OTO A;  4ECO A;  4BV4 R;  4KT1 A;  1OTM A;  4Q3I A;  5CMN A;  2FT3 A;  3C6P B;  5GS2 B;  1XWD C;  1O6S A;  2UZX A;  3RIZ A;  5B4P A;  2O6Q A;  4Z79 A;  1DS9 A;  4PQ8 A;  3OJA B;  4Y61 B;  2WQU A;  1Z7X W;  3FXI A;  5AWC A;  3O53 A;  2V9S A;  2RR6 A;  3CIY A;  2WQW A;  5HZL B;  1M10 B;  3G3A A;  3JB9 j;  3W3M A;  5HDH A;  3UL8 A;  5CMP A;  1XKU A;  2Z63 A;  3WPI A;  2BNH A;  4V2D A;  4OQT A;  4NKG A;  3ULU A;  4QXE A;  3A79 B;  2Z7X A;  5A5C A;  2OMZ A;  3RFS A;  3ULA A;  1O6V A;  3CIG A;  4MN8 B;  3RFJ A;  5LFN A;  1FO1 A;  4FS7 A;  2WFH A;  4CC4 C;  4MQW X;  1H6T A;  3RGX A;  4WYK A;  5FTT B;  4Z61 C;  4ARR A;  4RCA B;  4P91 A;  3OGM B;  1P8V A;  3RJ0 A;  4R6J A;  4BSU A;  3C6N B;  2Z66 A;  1OOK G;  4Q62 A;  4FMZ A;  2XWT C;  4LXS A;  4PKI G;  3WPG A;  4LXR A;  2WQX A;  3WPH A;  4R6A A;  2OMX A;  3G06 A;  4KXF B;  1A4Y A;  2Y5Q A;  2CA6 A;  1G9U A;  5D3I A;  1W8A A;  3REZ A;  1ZIW A;  4RCW A;  3P72 A;  4BSR A;  4HQ1 A;  2Z62 A;  2Z82 A;  1PGV A;  3DZE A;  1OTN A;  4G8A A;  4M7E A;  3O6N A;  3RFE A;  3WPB A;  3CVR A;  4KNG A;  3G3B A;  4YEB B;  3G04 C;  3M18 A;  3UN9 A;  4P8S A;  3UL9 A;  1LTX A;  3RW6 A;  2P1Q B;  5AWA A;  3TSR E;  3PMH G;  2OMW A;  3OGL B;  1O6T A;  3M19 A;  4PSJ A;  5IJC A;  4CP6 A;  2Z81 A;  5GS0 A;  1P9A G;  2A0Z A;  2OMT A;  4LI1 A;  3WPC A;  3ZYJ A;  3W3L A;  1DCE A;  2V70 A;  2AST B;  1XCD A;  4R08 A;  4V2E A;  1XEU A;  3KJ4 A;  1D0B A;  1SQ0 B;  1XEC A;  2JQD A;  1KOO A;  4ECN A;  1YRG A;  1U0N D;  3W3J A;  4FD0 A;  3OGK B;  4B8C D;  4K17 A;  2Q4G W;  2P1N B;  1FQV A;  3ZYO A;  4J0M A;  4V2C A;  1M9L A;  2JE1 A;  2Z7X B;  1FT8 A;  4EZG A;  2ID5 A;  3ULV A;  4CC4 A;  2P1P B;  4H09 A;  2P1O B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...