2AT0X

1.00 a crystal structure of l133v mutant of nitrophorin 4 from rhodnius prolixus complexed with nitric oxide at ph 5.6
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
184
structure length
184
Chain Sequence
b'ACTKNAIAQTGFNKDKYFNGDVWYVTDYLDLEPDDVPKRYCAALAAGTASGKLKEALYHYDPKTQDTFYDVSELQVESLGKYTANFKKVDKNGNVKVAVTAGNYYTFTVMYADDSSALIHTCLHKGNKDLGDVYAVLNRNKDAAAGDKVKSAVSAATLEFSKFISTKENNCAYDNDSLKSLLTK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrophorin 4
publication title Heme distortion in nitrophorin 4: high resolution structures of mutated positions L123V and L133V and heme altered proteins
rcsb
source organism Rhodnius prolixus
molecule tags Transport protein
total genus 49
structure length 184
sequence length 184
ec nomenclature ec 1.7.6.1: Nitrite dismutase.
pdb deposition date 2005-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF02087 Nitrophorin Nitrophorin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 2at0X00
2AKQA 4TKJA 4TLJA 3HWGA 3EMMA 5EPQA 2AT5X 4ORYA 1DZKA 3B2JA 1QY2A 3NADA 4GH7A 1ERXA 1BBPA 3BU1A 4QZTA 3FR4A 1JV4A 2RCQA 3FW4A 2W2AA 1KZWA 1A18A 3FLLA 3HWEA 2CM9A 1HBQA 1XCAA 5H9AA 4MVIA 3JSQA 4WFUA 3NX2A 1FTPA 4N7CA 3BX8A 1KGLA 1BSYA 1CJ5A 2BLGA 3P6CA 3CWKA 5BVQA 4GETA 3AKMA 4I3DA 1LFOA 2NNEA 3BSZE 4IB6A 4NNTA 1NGLA 1LNMA 4YFQA 1HQPA 4ALOA 4TKBA 1N0SA 3NQ3A 1FEMA 1U17A 2FWVA 5HZQA 4WBKA 2NP1A 1DZMA 4NYQA 1ACDA 2WQ9A 3WJDA 1TXLA 1SY3A 4YDBA 1EPAA 1KQWA 1KXOA 4I3CA 1E02A 1BM5A 1JBHA 3STKA 3B2KA 4ARHA 3BDRA 3C78X 1NP4A 3L4RA 1EIOA 4AZRA 2NNDA 1CRBA 1EQDA 1EXSA 1GX9A 1ZRYA 1SA8A 5LJBA 3BY0A 1KT7A 1ZNDA 4XMGA 1AQBA 3KFIA 1LF7A 2FTBA 1SXXA 3WVMA 1ADLA 3EBKA 1G7NA 4ZH6A 1ZNEA 5HZ8A 5LKFA 2NNQA 2RA6A 1MDCA 1PMPA 1SY2A 4OMXA 5LJDA 3MBTA 2XSTA 3HWFA 1ZNKA 1X8NA 1U18A 2CBRA 2WEWA 1DC9A 1LIBA 3G7XA 1PEEA 1HMTA 1A2DA 1OPAA 1DZPA 3BX7A 1B0OA 3EM0A 5D47A 5BVTA 1IW2A 1ICNA 1LKEA 3VG6A 1UREA 1QY0A 3UEWA 4OS3A 1IKJA 3CMPA 4GNWA 4EXZA 2LKKA 2W2BA 2A2GA 5H8TA 2PY1A 1YP6A 3CBCA 3RZYA 4NP1A 1B56A 1EPBA 1YWCA 2JU8A 4RUUA 5EEEA 3ZQ3A 1JJXA 4Y0QA 4YCEA 4ZHCA 1B8EA 2ACOA 5IO5A 1U0XA 4IB9A 4UU3A 2QM9A 3FEPA 3U03A 4ZHFA 2FR3A 1MX7A 3T1DA 1P6PA 3K3LA 1UZ2X 3B2LA 5HCEC 1KZXA 3B2IA 2FS7A 3S26A 2RQ0A 4IMNA 3I0AA 1SXYA 3FEKA 2HZRA 4YGZA 2L67A 4OMWA 4LZUA 3F9DA 3MVFA 2HNXA 4LKPA 3APVA 3FW5A 1ALBA 2ASNX 3P6HA 4YGHA 2WEXA 1SXUA 2G7BA 3TF6A 1X89A 2LFOA 2QO6A 3VG3A 1AELA 4NLIA 1I05A 1E5PA 1YWBA 1Z24A 3KFGA 1IKEA 4A60A 3KQ0A 4NLJA 5F6BA 4YCHA 1FDQA 4LZVA 4AW8A 2FT9A 3FIQA 4IAXA 2JOZA 1DF3A 1BSQA 5HWZA 2OFMX 3STNA 2A13A 1QWDA 1GT1A 1JYJA 2LB6A 3UEUA 1LIEA 1XKIA 3EBWA 3JS1A 2CM4A 4A1YA 2Q39A 3TGCA 1EIIA 4ZHDA 4YH0A 1S44A 3WBGA 4AZOA 3FA6A 1ERBA 4BVMA 4QYNA 5HZ9A 5LKEA 4A8ZA 4TJZA 4I3BA 2AT8X 1QQSA 3PH5A 1GKAA 2DM5A 1GGLA 2WUTA 1DV9A 1YUPA 2QO4A 5KICA 2R56A 3FENA 1DZJA 4ZHHA 1BWYA 1I4UA 4ORSA 4YKMA 1CBSA 3NX1A 2O62A 1ICMA 4TKHA 3RSWA 1A3YA 2OFRX 4XMFA 5HA1A 1OBPA 2AT3X 1PBOA 1RBPA 2ALLX 2HLVA 2X45A 4D6BA 3TGAA 5CE4A 3I17A 5F58A 1LIDA 2G78A 4HPDA 4YBPA 3CR6A 1SY0A 4XMCA 1QABE 2MJIA 4WFVA 1GKAB 1D3SA 1QY1A 3ELXA 5IO6A 5K06A 3OJYC 3ZUIA 3ELZA 2FR2A 4R0BA 1OBUA 4QGVA 1H91A 1O1VA 4ORRA 3P6GA 4QAEA 5BVSA 2YG2A 1S2PA 3PEDA 5LJEA 1OEJA 3BRNA 3GAQA 4YFRA 3PP6A 4RUNA 4D6AA 5LJHA 3P6FA 4GE1A 3SAOA 5H9LA 1HN2A 2AT0X 2RCTA 3CBSA 1KT5A 1QG5A 1KT3A 1O1UA 4TNNA 1JJJA 1GT4A 1X8QA 2KT4B 3PECA 4AYHA 5AQ6A 4DQ4A 1LPJA 5FAZA 1X8PA 5LJCA 5B29A 4XMHA 1ZNGA 5LJKA 5DG4A 3ZUOA 4MVKA 5FFHA 1BRPA 5EEDA 4ZCBA 2K62A 1B4MA 5KHPA 4EEJA 1O8VA 1EUOA 4YGGA 4ES7A 1FELA 5F7GA 1AVGI 1CBIA 2JU7A 2WQAE 5HBSA 3IA8A 3KFFA 2CBSA 2P8GA 4ZR2A 5B27A 1OPBA 1VPRA 1MUPA 5C0NA 2HZQA 3DSZA 1D2UA 1ZNHA 2HMBA 3WJFA 5L8IA 2OVEA 2RD7C 1GXAA 4I9SA 4DQ3A 2R73A 3HK1A 5EDCA 2WR6A 3NP1A 1KT6A 4QGWA 1FE3A 4NNSA 2W2FA 3KZAA 1BSOA 1G85A 1PM1X 4IB7A 3WXQA 2OZQA 4CK4A 4Y0SA 3FR2A 1X71A 3WJGA 1GM6A 3C77X 1HBPA 1QFVA 3P6EA 5KIDA 3NQ9A 1L6MA 1SXWA 2QOSC 1I04A 2Q2PA 2A3FX 1MX8A 3D96A 1TOWA 1QFTA 3FELA 5D4AA 2EU7X 1AB0A 4N7DA 3WJEA 1X8OA 1NP1A 4ALBA 4TQ2A 2X46A 1LIFA 4IAWA 4ORUA 2L68A 1FENA 1TOUA 3IFBA 1GT5A 4ORWA 3APWA 3VG2A 1KOIA 1SY1A 2HYSA 4YBUA 5EDBA 1KT4A 4ZH9A 3VG7A 3EYCA 2LBAA 1HMRA 1OBQA 5L8NA 5HTDA 2N93A 3O22A 5D45A 1YIVA 4AZMA 1BLRA 1JYDA 4QZUA 4XMEA 3UEXA 1X8UA 4Y0PA 2AH7X 2L5PA 3D95A 5IO7A 4QYPA 4YFPA 2IFBA 4PSQA 2R74A 4ODDA 1S7DA 2GC9A 3PH6A 4QGXA 5EZ2A 2JN3A 4EFGA 2Q2MA 5HA0A 2LBVA 4IBAA 1CBRA 3WJBA 4EDEA 1IFCA 5HZ6A 2FLJA 2OVAA 3BLGA 1YWDA 4OS0A 3Q6LA 1IIUA 2CZTA 3TZSA 2L9CA 3CQRA 1GX8A 4HPCA 1OEKA 5HCDC 1G5WA 2JU3A 1TVQA 1CBQA 4BOEA 3FA9A 1IFBA 4BQUA 2E4JA 3NR3A 4YMYA 1BJ7A 4GKCA 4ZFXA 4AZQA 2F73A 1BEBA 3O19A 2AMMX 2K23A 4HFOA 4O9SA 4IMOA 1T0VA 3KFHA 4YKOA 2Q9SA 3U9PC 3HWDA 1T8VA 4NYRA 4MVLA 5LJGA 5HTEA 2WWPA 5H9KA 2WSJA 4ZHGA 1DFVA 3FR5A 2FRSA 4LKTA 4HPAA 3APUA 3O2YA 1VYGA 2MM3A 5HAEA 1R0UA 3U0DA 2GJ5A 3DTQA 4UU2A 3TGBA 4Y0RA 2A0AA 2AL0X 3BU9A 3NPOA 3QKGA 1JZUA 1OEEA 4A1HA 3AKNA 3BS2A 3F8AA 2OVDA 1A57A 5HCCC 2POAA 4OS8A 1RLBE 1LICA 3VG4A 3C76X 5JR8A 1VYFA 1TW4A 5HZ5A 2A2UA 4KIIA 3P6DA 5F1EA 3VG5A 3B2HA 3CQNA 4YDAA 1GT3A 1I06A 3APXA 2CZUA 4IB8A 2ANSA 5F6ZA 1HMSA 1T68X 2FS6A 3FA7A 3STMX 3UEVA 1ZNLA 2AT6X 3WJCA 2Q4NA 1EALA 1G74A 2QO5A 4AZPA 4M6SA 4AZNA 5L8OA 5H9NA 3FA8A 4ORXA 3PPTA 4XMDA 4M7MA 5D8JA 4ZJ0A 2ACPX 1YWAA 5FENA 1KQXA 4GNYA 2GTFX 2XKLA 4GRJA 1ML7A 3FMZA 2G79A 1YP7A 5DPQA 5D48A 1BRQA 1E00A 2KTDA 3D97A 1E06A 1MVGA 4I9RA 4HPBA 2MO5A 4K19A 4ZGUA 1EW3A
chains in the Genus database with same CATH superfamily
1SWTA 2IZHB 3EC5A 4U3QA 4CDFA 2AKQA 4TKJA 4TLJA 3RDXA 3HWGA 5B3MO 1Y53X 3EMMA 2AT5X 5EPQA 4ORYA 1DZKA 3B2JA 3LV4A 1QY2A 1AVEA 4ML7B 3RE5A 3NADA 4GH7A 4O4SA 1ERXA 1STSB 5F2BA 3MX7A 1BBPA 3BU1A 4QZTA 3FR4A 1JV4A 2RCQA 1SWJA 3FW4A 4GGZA 2OF9A 2W2AA 1KZWA 5BYPA 2GTLO 1A18A 3FLLA 3HWEA 4QRLA 2CM9A 1HBQA 1XCAA 4MIRA 5H9AA 4MVIA 3JSQA 2RN4A 4WFUA 2RTAA 4CV7A 4I60A 3NX2A 1FTPA 2PI3O 3BX8A 2IZIA 2RTIB 3NBXX 1BSYA 4N7CA 3VHMA 4Z6JA 4O4OA 1CJ5A 1KGLA 2BLGA 3HPEA 3X00A 4HWMA 3P6CA 3CWKA 2FHNX 2RTBB 1LDQA 2RTEB 1W5RA 5BVQA 2IZDB 4JHQA 4GETA 2RTPB 3AKMA 1LFOA 2MWHA 3HOEA 2NNEA 4I3DA 3BSZE 4IB6A 2IZLB 3D9WA 3HOLA 4NNTA 1I9HA 4ON1A 1NGLA 2RTKA 1LNMA 4YFQA 2FGSA 1HQPA 3WZNA 4ALOA 3T2WA 4TKBA 1N0SA 3NQ3A 1FEMA 4BGFA 4BX6A 2OY7A 1U17A 2FWVA 5B10O 1RXKA 5HZQA 3JQOA 4WBKA 4O4XA 4L3RA 2NP1A 1DZMA 1JQPA 1PTSA 4NYQA 1ACDA 2WQ9A 3WJDA 1TXLA 1SY3A 3V8UA 4YDBA 3SOTA 1EPAA 1KQWA 1KXOA 4I3CA 1E02A 1UYOX 1BM5A 1JBHA 3STKA 3B2KA 1NC9A 4JO6A 4ARHA 3BDRA 3C78X 1NP4A 2BC3A 5HA1A 3L4RA 1EIOA 4AZRA 1RSUB 5CHKA 3OD9A 2NNDA 2RTHB 1CRBA 4CDEA 1EQDA 1EXSA 1GX9A 3T6FA 1W6FA 1LCZA 1SA8A 1ZRYA 2OL8O 3BY0A 5IRAA 1KT7A 1ZNDA 4XMGA 1AQBA 3S5VA 3KFIA 1LF7A 2FTBA 1N9MA 1SXXA 3WVMA 5KIDA 2GH7A 1ADLA 3EBKA 1G7NA 1Y55X 3EW1A 4WHIA 1ZNEA 4ZH6A 5HZ8A 5LKFA 2NNQA 1JMZA 2RA6A 1MDCA 4YVBA 4BX7A 1PMPA 2RTLA 3EW2A 1SY2A 4OMXA 5LJDA 3MBTA 2KD2A 2XSTA 3HWFA 1ZNKA 1X8NA 1U18A 2CBRA 2WEWA 1DC9A 1LIBA 2OY8A 3G7XA 4NW4A 4MVEA 4OKAA 4Y5DA 1PEEA 3VGWA 1HMTA 1VWMB 4DCBA 1A2DA 1OPAA 1DZPA 2Y3EA 3BX7A 5F1EA 1B0OA 3EM0A 5D47A 5BVTA 1IW2A 1MK5A 2LA7A 1NQNA 1VWEB 1ICNA 1JJUA 1LKEA 3VG6A 1UREA 1QY0A 3WYQA 3UEWA 4OS3A 1WUBA 1IKJA 1KL4A 1GX3A 3CMPA 4GJVA 2RTMA 4GNWA 4EXZA 2LKKA 1VWPB 2W2BA 1VWFB 2A2GA 5H8TA 4BX7B 1YP6A 2PY1A 3CBCA 2JGSA 1SRGA 1B56A 4NP1A 4U8UM 3RZYA 1EPBA 1YWCA 2JU8A 4RUUA 5EEEA 3ZQ3A 1WBIA 2IZEB 4O3WA 4Y0QA 1JJXA 3MG5A 4YCEA 2HKDA 2X8SA 4ZHCA 3HTYA 1B8EA 3PDFA 2IZCB 3VHIA 2ACOA 5IO5A 1HXLA 2OFBA 1SLFB 1U0XA 3PQSA 4IB9A 2QM9A 3FEPA 2VFCA 1NDJA 3CKFA 4UU3A 4COTA 4ZHFA 2FKJA 2FR3A 3ZW0A 3OBLA 1MX7A 3WZQA 3T1DA 1P6PA 3K3LA 1UZ2X 3B2LA 5HCEC 1KZXA 2BS6A 3B2IA 2FS7A 2I5VO 5B11O 3S26A 2RQ0A 2VFBA 3I0AA 1SXYA 1VWDB 2RTJA 3FEKA 2X56A 4IMNA 3RE6A 3SLTA 2HZRA 2WPUA 4YGZA 1E2TA 2L67A 2FHLA 4OMWA 4FGIB 4LZUA 3F9DA 2ZAGA 3MVFA 1SWUA 2HNXA 4LKPA 3APVA 3T2XA 3FW5A 1ALBA 2ZSCA 3PK2A 2ASNX 3P6HA 4YGHA 2WEXA 1SXUA 5B5FA 2G7BA 3TF6A 1KL5A 1X89A 4Z2OA 2LFOA 2QO6A 3VG3A 4Z2VA 1SWCA 1I05A 4GJSA 4NLIA 3WZPA 2F09A 1AELA 1JMXA 3Q34A 1E5PA 1YWBA 1Z24A 3KFGA 4FQBB 1IKEA 4A60A 1N9YA 3KQ0A 4NLJA 5F6BA 1RSTB 4YCHA 3E3CA 1FDQA 2RTNB 4U8UN 4LZVA 3T6LA 4AW8A 1VWRB 1VWCB 2FT9A 3FIQA 4IAXA 2JOZA 4MISA 1DF3A 1BSQA 3GE2A 1SWEA 2OFMX 3STNA 2A13A 5HWZA 4B55A 1QWDA 3SLOA 1GT1A 1SWRA 4CDDA 1JYJA 2C4IA 2LB6A 3UEUA 1LIEA 1XKIA 1UYNX 2YMSA 2CM4A 3EBWA 3JS1A 3ZW2A 4A1YA 2Q39A 3TGCA 4C5PA 1EW3A 1EIIA 1SWNA 4ZHDA 4CPHA 4GUZA 4YH0A 1W4TA 1Y52X 4I6SA 3RWXA 4GK9A 1S44A 3WBGA 2OFAA 4Y59A 4AZOA 3FA6A 3OE3A 2JW1A 3LTWA 1NQMA 2JMBA 3NQKA 4OEMA 1AVDA 1ERBA 3VHHA 1VWJB 4BVMA 1SREA 4QYNA 3WOVA 4CPEA 5HZ9A 5LKEA 4A8ZA 5LJBA 4TJZA 1N4JA 2C1QA 4I3BA 2AT8X 1QQSA 3PH5A 3RDOA 1GKAA 2DM5A 1GGLA 1VWLB 2WUTA 1DV9A 3N91A 1YUPA 2QO4A 5KICA 1VWOB 2R56A 3FENA 1DZJA 4BCSA 4ZHHA 1BWYA 1I4UA 5CYBA 4ORSA 4CPHB 4YKMA 1CBSA 2X55A 3NX1A 2O62A 1ICMA 2RTQB 4GGRA 4GU8A 4TKHA 3RSWA 3S5XA 1A3YA 4LQZA 4KC8A 5CSEA 2OFRX 4I95A 1K3BA 2GTLN 1PBYA 1RXHA 1OBPA 2AT3X 1PBOA 1RBPA 2ALLX 2HLVA 2X45A 4XMFA 3TGAA 4D6BA 3I17A 5F58A 1LIDA 2G78A 4HPDA 4YBPA 5CE4A 3CR6A 1SY0A 4XMCA 5IXGA 1QABE 2IZFB 2MJIA 4WFVA 1GKAB 1D3SA 1QY1A 2M4LA 4NV8A 3ELXA 3SZJA 2ZAIA 5IO6A 5K06A 3ZW1A 3CKGA 3OJYC 3VPJE 2MF6A 2RTOB 4NV7A 1HXZA 3ZUIA 3ELZA 4CPFA 2FR2A 1EI5A 4R0BA 4QNIA 1OBUA 3RY1A 3H3IA 1Y0GA 2IZBA 1H91A 1O1VA 4IABA 3P6GA 1Y9TA 4ORRA 4QAEA 5BVSA 4CDCA 4ZGFA 2YG2A 1S2PA 2BS5A 4U46A 4BX5A 3MM0A 2RTGB 1SWHA 3PEDA 5LJEA 1OEJA 3ZWEA 3BRNA 2F01A 1N7YA 3VE2A 3GAQA 4YFRA 3PP6A 4RUNA 2IZAA 4KC7A 1RXJA 2QOMA 2OY1O 4D6AA 5LJHA 3P6FA 3KVNA 2KW1A 4GE1A 1SRJA 3SAOA 5H9LA 3AUMO 4FBOA 5JR8A 1HN2A 2AT0X 1VWAB 2RCTA 2RTCB 1VWIB 2IZJA 1OSPO 3CBSA 1KT5A 1QG5A 1KT3A 2A5CA 1VWKB 1O1UA 4TNNA 3AEHA 4BX5B 1JJJA 1GT4A 4ID2A 1X8QA 2X8TA 4CPIA 2OF8A 1VWGB 1N43A 2I5ZO 2KT4B 3PECA 4AYHA 5AQ6A 4DQ4A 1LPJA 5FAZA 1X8PA 2C1SA 5B29A 5LJCA 4XMHA 2G5LA 1ZNGA 5LJKA 5DG4A 3ZUOA 4MVKA 5FFHA 3U03A 1BRPA 5EEDA 4ZCBA 2K62A 1B4MA 5KHPA 4EEJA 4KT5A 1O8VA 1EUOA 2CAMA 4YGGA 2OL7A 1FELA 2G8CO 2IZGB 5B2AO 5F7GA 2OY5O 3SZIA 4ES7A 4GZVA 1VWHB 4BX6B 1LUQA 1STPA 1AVGI 1CBIA 2JU7A 1LELA 2WQAE 3ZI8A 5HBSA 3IA8A 3KFFA 2CBSA 1SWPA 2P8GA 4ZR2A 1SRHA 5B27A 4QQ1A 1OPBA 1VPRA 3ZW0B 1MUPA 5C0NA 2HZQA 3DSZA 1D2UA 1ZNHA 2HMBA 2QCBA 3QQ2A 5L8IA 3WJFA 2OVEA 3LHNA 2RD7C 1GXAA 4I9SA 2DJFA 4KH8A 2GTLM 2R73A 3WYPA 4DQ3A 2A5BA 3HK1A 4Z28A 5EDCA 3P24A 2WR6A 3NP1A 1KT6A 1VWBB 1DF8A 1SRFA 4QGWA 5FQ6E 1FE3A 2IZKA 1SWQA 1I78A 4NNSA 1SWLA 2W2FA 3KZAA 4GGTA 1BSOA 1G85A 1PM1X 4IB7A 3WXQA 4DNEA 2OZQA 4CK4A 5HZ5A 4Y0SA 1JIWI 3FR2A 1X71A 3WJGA 1GM6A 1LDOA 1HBPA 1QFVA 2OL6O 3C77X 3P6EA 3NQ9A 1L6MA 1SXWA 3RY2A 2QOSC 1I04A 3RDUA 3FYFA 2Q2PA 2A3FX 1MX8A 3D96A 1TOWA 1QFTA 2Z4IA 3FELA 5D4AA 2EU7X 1AB0A 4N7DA 3WJEA 5JD2A 1X8OA 4O4UA 1NP1A 1SMPI 2RTRB 2Z4HA 4ALBA 4TQ2A 2X46A 1LIFA 4IAWA 1SWDA 4ORUA 2L68A 1FENA 1TOUA 3IFBA 1GT5A 2UYWA 3APWA 4ORWA 3VG2A 4GDZA 1KOIA 1SY1A 2HYSA 1MEPA 4YBUA 5EDBA 2RTDB 1KT4A 4KCAA 4ZH9A 3VG7A 4FBVA 1Y9LA 3EYCA 1SWGA 2LBAA 1HMRA 4EQAC 1OBQA 5L8NA 5HTDA 2N93A 3O22A 5D45A 1YIVA 4OELA 2KTSA 4L1NA 1VYOA 4AZMA 4CSBA 5K67A 1BLRA 1JYDA 4QZUA 4XMEA 3UEXA 3VG5A 1X8UA 3PQUA 4Y0PA 2L5PA 3D95A 2AH7X 5IO7A 4QYPA 4YFPA 2IFBA 4PSQA 2OVSA 2R74A 5AJBA 3RBYA 4ODDA 1S7DA 2X32A 4O49A 2GC9A 3PH6A 4QGXA 5EZ2A 2JN3A 4EFGA 2A8GA 2Q2MA 5HA0A 2LBVA 1HY2A 1CBRA 4IBAA 4JGLA 4PJ2A 3WJBA 4EDEA 1IFCA 5HZ6A 1SWKA 1K24A 2FLJA 2OVAA 3BLGA 4MEEA 1YWDA 4OS0A 4U9CA 4QGVA 3Q6LA 1SWAA 1IIUA 2X8FA 2CZTA 3D4RA 3TZSA 2L9CA 3CQRA 4INNA 1GX8A 5IRUA 3RDQA 4HPCA 4GD9A 1OEKA 5HCDC 1MOYA 1G5WA 5IRWA 4O3YA 4BBOA 2JU3A 1SLEB 1TVQA 1CBQA 5FQ7E 3WZOA 4BOEA 3FA9A 1IFBA 1HQQA 2E4JA 4BQUA 4Z2PA 5FQ8E 3NR3A 3FIDA 4YMYA 1BJ7A 4GKCA 3RKGA 4ZFXA 2BT9A 2F73A 1BEBA 3O19A 1NBXA 1RAVA 4JNJA 5B5GA 4AZQA 4IRWA 2AMMX 2K23A 4HFOA 4O9SA 1FJ1E 4IMOA 1T0VA 3KFHA 4YKOA 1VWNB 2Q9SA 3U9PC 3HWDA 1T8VA 4NYRA 2AVIA 1MM9A 3S60A 4MVLA 5LJGA 5HTEA 2WWPA 5H9KA 2MHDA 4FBRA 2WSJA 4ZHGA 1DFVA 3FR5A 2FRSA 4LKTA 3ZW1B 4HPAA 3APUA 3O2YA 1VYGA 2MM3A 2RTFB 3FDCA 5HAEA 1R0UA 4O3XB 3U0DA 2GJ5A 3DTQA 4O3ZA 4UU2A 4Z27A 4Y0RA 1SLGB 2A0AA 2AL0X 3TGBA 1LCVA 3BU9A 3NPOA 3QKGA 1JZUA 1OEEA 2UZ2A 3VU1A 4A1HA 3AKNA 1SLDB 3BS2A 3F8AA 2OVDA 1SWBA 3ZZVA 1IJ8A 3SZHA 1A57A 1SWOA 5HCCC 2POAA 4OS8A 1RLBE 1LICA 3VG4A 3C76X 1STRB 1VYFA 1TW4A 5K68A 3SLJA 2A2UA 2QMIA 3P6DA 2X34A 4KIIA 2X4MA 3B2HA 3CQNA 2AF5A 4YDAA 1GT3A 2DJGA 1I06A 3APXA 2OYBO 2CZUA 4IB8A 2ANSA 3UAQA 2BSZA 5F6ZA 1HMSA 1T68X 2FS6A 3FA7A 4U8UO 3STMX 5L3YA 3UEVA 1ZNLA 2AT6X 5AJCA 2Q4NA 3WJCA 1G74A 2QO5A 4AZPA 4M6SA 4BJ8A 1EALA 1VWQB 5AEOA 2Y3FA 4AZNA 5L8OA 3F6ZB 5H9NA 3RDSA 2FKGA 2VDFA 2Y32A 3FA8A 3VE1A 4ORXA 3PPTA 4XMDA 4M7MA 5D8JA 4ZJ0A 2ACPX 1YWAA 5FENA 1KQXA 4GNYA 1KL3A 1SRIA 2GTFX 2XKLA 2BHVA 4GRJA 1ML7A 3FMZA 2G79A 1YP7A 5DPQA 5D48A 1KFFA 1BRQA 1E00A 2KTDA 3D97A 4EKVA 1E06A 4GDAA 1MVGA 1SWFA 4I9RA 4HPBA 2MO5A 3RDMA 3P02A 4K19A 1LCWA 4ZGUA 1SWSA
chains in the Genus database with same CATH topology
4U3QA 2AKQA 4TKJA 4TLJA 3HWGA 3EMMA 5EPQA 2AT5X 4ORYA 1DZKA 3B2JA 3LV4A 1QY2A 4ML7B 3NADA 4GH7A 4O4SA 1ERXA 3MX7A 1BBPA 3BU1A 4QZTA 3FR4A 1JV4A 2RCQA 3FW4A 2W2AA 1KZWA 5BYPA 2GTLO 1A18A 3FLLA 3HWEA 4QRLA 2CM9A 1HBQA 1XCAA 4MIRA 5H9AA 4MVIA 3JSQA 2RN4A 4WFUA 4CV7A 3NX2A 1FTPA 4N7CA 3BX8A 1KGLA 3NBXX 1BSYA 1CJ5A 4O4OA 2BLGA 4HWMA 3P6CA 3CWKA 5BVQA 4GETA 3AKMA 3HOEA 1LFOA 2MWHA 4I3DA 2NNEA 3RBYA 3BSZE 4IB6A 4NNTA 3HOLA 4ON1A 1NGLA 1LNMA 4YFQA 1HQPA 4ALOA 4TKBA 1N0SA 3NQ3A 1FEMA 1U17A 2FWVA 5HZQA 3JQOA 4WBKA 4O4XA 4L3RA 2NP1A 1DZMA 4NYQA 1ACDA 2WQ9A 3WJDA 1TXLA 1SY3A 3V8UA 4YDBA 3SOTA 1EPAA 1KQWA 1KXOA 4I3CA 1E02A 1BM5A 1JBHA 3STKA 3B2KA 4ARHA 3BDRA 3C78X 1NP4A 3L4RA 1EIOA 4AZRA 3OD9A 2NNDA 1CRBA 1EQDA 1EXSA 1GX9A 1ZRYA 1SA8A 5LJBA 3BY0A 1KT7A 1ZNDA 4XMGA 1AQBA 3S5VA 3KFIA 1LF7A 2FTBA 1SXXA 3WVMA 1ADLA 3EBKA 1G7NA 4WHIA 4ZH6A 1ZNEA 5HZ8A 5LKFA 2NNQA 2RA6A 1MDCA 1PMPA 1SY2A 4OMXA 5LJDA 3MBTA 2KD2A 2XSTA 3HWFA 1ZNKA 1X8NA 1U18A 2CBRA 2WEWA 1DC9A 1LIBA 3G7XA 4NW4A 4MVEA 1PEEA 1HMTA 1A2DA 1OPAA 1DZPA 3BX7A 1B0OA 3EM0A 5D47A 5BVTA 1IW2A 2LA7A 1ICNA 1LKEA 3VG6A 1UREA 1QY0A 3UEWA 4OS3A 1IKJA 3CMPA 4GNWA 4EXZA 2LKKA 2W2BA 2A2GA 5H8TA 2PY1A 1YP6A 3CBCA 3RZYA 4NP1A 1B56A 4U8UM 1EPBA 1YWCA 2JU8A 4RUUA 5EEEA 3ZQ3A 4O3WA 1JJXA 4Y0QA 4YCEA 2X8SA 4ZHCA 3HTYA 1B8EA 2ACOA 5IO5A 1U0XA 3PQSA 4IB9A 2QM9A 3FEPA 4UU3A 4COTA 3U03A 4ZHFA 2FR3A 3ZW0A 3OBLA 1MX7A 3T1DA 1P6PA 3K3LA 1UZ2X 3B2LA 5HCEC 1KZXA 2BS6A 3B2IA 2FS7A 3S26A 2RQ0A 4IMNA 3I0AA 1SXYA 3FEKA 2HZRA 4YGZA 2L67A 4OMWA 4FGIB 4LZUA 3F9DA 2ZAGA 3MVFA 2HNXA 4LKPA 3APVA 3FW5A 1ALBA 2ASNX 3P6HA 4YGHA 2WEXA 1SXUA 2G7BA 3TF6A 1X89A 2LFOA 2QO6A 3VG3A 1AELA 4NLIA 1I05A 2F09A 1E5PA 1YWBA 1Z24A 3KFGA 4FQBB 1IKEA 4A60A 3KQ0A 4NLJA 5F6BA 4YCHA 3E3CA 1FDQA 4U8UN 4LZVA 4AW8A 4MISA 2FT9A 3FIQA 4IAXA 2JOZA 1DF3A 1BSQA 3GE2A 5HWZA 2OFMX 3STNA 2A13A 1QWDA 1GT1A 1JYJA 2LB6A 3UEUA 1LIEA 1XKIA 2YMSA 3EBWA 2CM4A 3JS1A 3ZW2A 4A1YA 2Q39A 3TGCA 1EIIA 4ZHDA 4YH0A 4I6SA 3RWXA 4GK9A 1S44A 3WBGA 4AZOA 3FA6A 3OE3A 2JW1A 2JMBA 3NQKA 1ERBA 4BVMA 3WOVA 4QYNA 5HZ9A 5LKEA 4A8ZA 4TJZA 4I3BA 2AT8X 1QQSA 3PH5A 1GKAA 2DM5A 1GGLA 2WUTA 1DV9A 3N91A 1YUPA 2QO4A 5KICA 2R56A 3FENA 1DZJA 4ZHHA 1BWYA 1I4UA 5CYBA 4ORSA 4YKMA 1CBSA 3NX1A 2O62A 1ICMA 4GU8A 4TKHA 3RSWA 3S5XA 1A3YA 4LQZA 4KC8A 2OFRX 4I95A 2GTLN 4XMFA 5HA1A 1OBPA 2AT3X 1PBOA 1RBPA 2ALLX 2HLVA 2X45A 4D6BA 3TGAA 5CE4A 3I17A 5F58A 1LIDA 2G78A 4HPDA 4YBPA 3CR6A 1SY0A 4XMCA 1QABE 2MJIA 4WFVA 1GKAB 1D3SA 1QY1A 2M4LA 3ELXA 2ZAIA 5IO6A 5K06A 3ZW1A 3OJYC 3VPJE 3ZUIA 3ELZA 2FR2A 1EI5A 4R0BA 4QNIA 1OBUA 3H3IA 4QGVA 4IABA 1H91A 1O1VA 4ORRA 3P6GA 1Y9TA 4QAEA 5BVSA 4ZGFA 2YG2A 1S2PA 2BS5A 3PEDA 5LJEA 1OEJA 3ZWEA 3BRNA 3VE2A 3GAQA 4YFRA 3PP6A 4RUNA 4KC7A 4D6AA 5LJHA 3P6FA 2KW1A 4GE1A 3SAOA 5H9LA 4FBOA 1HN2A 2AT0X 2RCTA 3CBSA 1KT5A 1QG5A 1KT3A 1O1UA 4TNNA 1JJJA 1GT4A 4ID2A 1X8QA 2X8TA 2KT4B 3PECA 4AYHA 5AQ6A 4DQ4A 1LPJA 5FAZA 1X8PA 5LJCA 5B29A 4XMHA 1ZNGA 5LJKA 5DG4A 3ZUOA 4MVKA 5FFHA 1BRPA 5EEDA 4ZCBA 2K62A 1B4MA 5KHPA 4EEJA 4KT5A 1O8VA 1EUOA 4YGGA 4ES7A 1FELA 5F7GA 4GZVA 1AVGI 1CBIA 2JU7A 3ZI8A 2WQAE 5HBSA 3IA8A 3KFFA 2CBSA 2P8GA 4ZR2A 5B27A 4QQ1A 1OPBA 1VPRA 3ZW0B 1MUPA 5C0NA 2HZQA 3DSZA 1D2UA 1ZNHA 2HMBA 3WJFA 5L8IA 2OVEA 3LHNA 2RD7C 1GXAA 4I9SA 4KH8A 2GTLM 2R73A 4DQ3A 3HK1A 5EDCA 3P24A 2WR6A 3NP1A 1KT6A 5FQ6E 4QGWA 1FE3A 4NNSA 2W2FA 3KZAA 1BSOA 1G85A 1PM1X 4IB7A 3WXQA 2OZQA 4CK4A 4Y0SA 1JIWI 3FR2A 1X71A 3WJGA 1GM6A 3C77X 1HBPA 1QFVA 3P6EA 3VU1A 5KIDA 3NQ9A 1L6MA 1SXWA 2QOSC 1I04A 3FYFA 2Q2PA 2A3FX 1MX8A 3D96A 1TOWA 1QFTA 2Z4IA 3FELA 5D4AA 2EU7X 1AB0A 4N7DA 3WJEA 1X8OA 4O4UA 1NP1A 1SMPI 2Z4HA 4ALBA 4TQ2A 2X46A 1LIFA 4IAWA 4ORUA 2L68A 1FENA 1TOUA 3IFBA 1GT5A 4ORWA 3APWA 3VG2A 4GDZA 1KOIA 1SY1A 2HYSA 4YBUA 5EDBA 1KT4A 4KCAA 4ZH9A 3VG7A 4FBVA 1Y9LA 3EYCA 2LBAA 1HMRA 4EQAC 1OBQA 5L8NA 5HTDA 2N93A 3O22A 5D45A 1YIVA 4AZMA 2KTSA 4L1NA 4CSBA 1BLRA 1JYDA 4QZUA 4XMEA 3UEXA 1X8UA 3PQUA 4Y0PA 2L5PA 3D95A 2AH7X 5IO7A 4QYPA 4YFPA 2IFBA 4PSQA 2OVSA 2R74A 5AJBA 4ODDA 1S7DA 4O49A 2GC9A 3PH6A 4QGXA 5EZ2A 2JN3A 4EFGA 2Q2MA 5HA0A 2LBVA 4IBAA 1CBRA 4PJ2A 4JGLA 3WJBA 4EDEA 1IFCA 5HZ6A 4U9CA 2FLJA 2OVAA 3BLGA 1YWDA 4OS0A 3Q6LA 1IIUA 2X8FA 2CZTA 3D4RA 3TZSA 2L9CA 3CQRA 4INNA 1GX8A 4HPCA 1OEKA 5HCDC 1G5WA 4O3YA 2JU3A 5FQ7E 1TVQA 1CBQA 4BOEA 3FA9A 1IFBA 4BQUA 2E4JA 5FQ8E 3NR3A 4YMYA 1BJ7A 4GKCA 3RKGA 4ZFXA 2BT9A 2F73A 1BEBA 3O19A 4AZQA 2AMMX 2K23A 4HFOA 4O9SA 4IMOA 1T0VA 3KFHA 4YKOA 2Q9SA 3U9PC 3HWDA 1T8VA 4NYRA 3S60A 4MVLA 5LJGA 5HTEA 2WWPA 5H9KA 2MHDA 4FBRA 2WSJA 4ZHGA 1DFVA 3FR5A 2FRSA 4LKTA 3ZW1B 4HPAA 3APUA 3O2YA 1VYGA 2MM3A 5HAEA 1R0UA 4O3XB 3U0DA 2GJ5A 3DTQA 4O3ZA 4UU2A 3TGBA 4Y0RA 2A0AA 2AL0X 3BU9A 3NPOA 3QKGA 1JZUA 1OEEA 4A1HA 3AKNA 3BS2A 3F8AA 2OVDA 3ZZVA 1A57A 5HCCC 2POAA 4OS8A 1RLBE 1LICA 3VG4A 3C76X 5JR8A 1VYFA 1TW4A 5HZ5A 2A2UA 2QMIA 3P6DA 4KIIA 5F1EA 3VG5A 3B2HA 3CQNA 4YDAA 1GT3A 1I06A 3APXA 2CZUA 4IB8A 2ANSA 3UAQA 5F6ZA 1HMSA 1T68X 2FS6A 3FA7A 4U8UO 3STMX 3UEVA 1ZNLA 2AT6X 5AJCA 2Q4NA 3WJCA 1G74A 2QO5A 4AZPA 4M6SA 1EALA 5AEOA 4AZNA 5L8OA 3F6ZB 5H9NA 3VE1A 3FA8A 4ORXA 3PPTA 4XMDA 4M7MA 5D8JA 4ZJ0A 2ACPX 1YWAA 5FENA 1KQXA 4GNYA 2GTFX 2XKLA 4GRJA 2BHVA 1ML7A 3FMZA 2G79A 1YP7A 5DPQA 5D48A 1BRQA 1E00A 2KTDA 3D97A 1E06A 1MVGA 4I9RA 4HPBA 2MO5A 3P02A 4K19A 4ZGUA 1EW3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AKQ A;  4TKJ A;  4TLJ A;  3HWG A;  3EMM A;  5EPQ A;  2AT5 X;  4ORY A;  1DZK A;  3B2J A;  1QY2 A;  3NAD A;  4GH7 A;  1ERX A;  1BBP A;  3BU1 A;  4QZT A;  3FR4 A;  1JV4 A;  2RCQ A;  3FW4 A;  2W2A A;  1KZW A;  1A18 A;  3FLL A;  3HWE A;  2CM9 A;  1HBQ A;  1XCA A;  5H9A A;  4MVI A;  3JSQ A;  4WFU A;  3NX2 A;  1FTP A;  4N7C A;  3BX8 A;  1KGL A;  1BSY A;  1CJ5 A;  2BLG A;  3P6C A;  3CWK A;  5BVQ A;  4GET A;  3AKM A;  4I3D A;  1LFO A;  2NNE A;  3BSZ E;  4IB6 A;  4NNT A;  1NGL A;  1LNM A;  4YFQ A;  1HQP A;  4ALO A;  4TKB A;  1N0S A;  3NQ3 A;  1FEM A;  1U17 A;  2FWV A;  5HZQ A;  4WBK A;  2NP1 A;  1DZM A;  4NYQ A;  1ACD A;  2WQ9 A;  3WJD A;  1TXL A;  1SY3 A;  4YDB A;  1EPA A;  1KQW A;  1KXO A;  4I3C A;  1E02 A;  1BM5 A;  1JBH A;  3STK A;  3B2K A;  4ARH A;  3BDR A;  3C78 X;  1NP4 A;  3L4R A;  1EIO A;  4AZR A;  2NND A;  1CRB A;  1EQD A;  1EXS A;  1GX9 A;  1ZRY A;  1SA8 A;  5LJB A;  3BY0 A;  1KT7 A;  1ZND A;  4XMG A;  1AQB A;  3KFI A;  1LF7 A;  2FTB A;  1SXX A;  3WVM A;  1ADL A;  3EBK A;  1G7N A;  4ZH6 A;  1ZNE A;  5HZ8 A;  5LKF A;  2NNQ A;  2RA6 A;  1MDC A;  1PMP A;  1SY2 A;  4OMX A;  5LJD A;  3MBT A;  2XST A;  3HWF A;  1ZNK A;  1X8N A;  1U18 A;  2CBR A;  2WEW A;  1DC9 A;  1LIB A;  3G7X A;  1PEE A;  1HMT A;  1A2D A;  1OPA A;  1DZP A;  3BX7 A;  1B0O A;  3EM0 A;  5D47 A;  5BVT A;  1IW2 A;  1ICN A;  1LKE A;  3VG6 A;  1URE A;  1QY0 A;  3UEW A;  4OS3 A;  1IKJ A;  3CMP A;  4GNW A;  4EXZ A;  2LKK A;  2W2B A;  2A2G A;  5H8T A;  2PY1 A;  1YP6 A;  3CBC A;  3RZY A;  4NP1 A;  1B56 A;  1EPB A;  1YWC A;  2JU8 A;  4RUU A;  5EEE A;  3ZQ3 A;  1JJX A;  4Y0Q A;  4YCE A;  4ZHC A;  1B8E A;  2ACO A;  5IO5 A;  1U0X A;  4IB9 A;  4UU3 A;  2QM9 A;  3FEP A;  3U03 A;  4ZHF A;  2FR3 A;  1MX7 A;  3T1D A;  1P6P A;  3K3L A;  1UZ2 X;  3B2L A;  5HCE C;  1KZX A;  3B2I A;  2FS7 A;  3S26 A;  2RQ0 A;  4IMN A;  3I0A A;  1SXY A;  3FEK A;  2HZR A;  4YGZ A;  2L67 A;  4OMW A;  4LZU A;  3F9D A;  3MVF A;  2HNX A;  4LKP A;  3APV A;  3FW5 A;  1ALB A;  2ASN X;  3P6H A;  4YGH A;  2WEX A;  1SXU A;  2G7B A;  3TF6 A;  1X89 A;  2LFO A;  2QO6 A;  3VG3 A;  1AEL A;  4NLI A;  1I05 A;  1E5P A;  1YWB A;  1Z24 A;  3KFG A;  1IKE A;  4A60 A;  3KQ0 A;  4NLJ A;  5F6B A;  4YCH A;  1FDQ A;  4LZV A;  4AW8 A;  2FT9 A;  3FIQ A;  4IAX A;  2JOZ A;  1DF3 A;  1BSQ A;  5HWZ A;  2OFM X;  3STN A;  2A13 A;  1QWD A;  1GT1 A;  1JYJ A;  2LB6 A;  3UEU A;  1LIE A;  1XKI A;  3EBW A;  3JS1 A;  2CM4 A;  4A1Y A;  2Q39 A;  3TGC A;  1EII A;  4ZHD A;  4YH0 A;  1S44 A;  3WBG A;  4AZO A;  3FA6 A;  1ERB A;  4BVM A;  4QYN A;  5HZ9 A;  5LKE A;  4A8Z A;  4TJZ A;  4I3B A;  2AT8 X;  1QQS A;  3PH5 A;  1GKA A;  2DM5 A;  1GGL A;  2WUT A;  1DV9 A;  1YUP A;  2QO4 A;  5KIC A;  2R56 A;  3FEN A;  1DZJ A;  4ZHH A;  1BWY A;  1I4U A;  4ORS A;  4YKM A;  1CBS A;  3NX1 A;  2O62 A;  1ICM A;  4TKH A;  3RSW A;  1A3Y A;  2OFR X;  4XMF A;  5HA1 A;  1OBP A;  2AT3 X;  1PBO A;  1RBP A;  2ALL X;  2HLV A;  2X45 A;  4D6B A;  3TGA A;  5CE4 A;  3I17 A;  5F58 A;  1LID A;  2G78 A;  4HPD A;  4YBP A;  3CR6 A;  1SY0 A;  4XMC A;  1QAB E;  2MJI A;  4WFV A;  1GKA B;  1D3S A;  1QY1 A;  3ELX A;  5IO6 A;  5K06 A;  3OJY C;  3ZUI A;  3ELZ A;  2FR2 A;  4R0B A;  1OBU A;  4QGV A;  1H91 A;  1O1V A;  4ORR A;  3P6G A;  4QAE A;  5BVS A;  2YG2 A;  1S2P A;  3PED A;  5LJE A;  1OEJ A;  3BRN A;  3GAQ A;  4YFR A;  3PP6 A;  4RUN A;  4D6A A;  5LJH A;  3P6F A;  4GE1 A;  3SAO A;  5H9L A;  1HN2 A;  2AT0 X;  2RCT A;  3CBS A;  1KT5 A;  1QG5 A;  1KT3 A;  1O1U A;  4TNN A;  1JJJ A;  1GT4 A;  1X8Q A;  2KT4 B;  3PEC A;  4AYH A;  5AQ6 A;  4DQ4 A;  1LPJ A;  5FAZ A;  1X8P A;  5LJC A;  5B29 A;  4XMH A;  1ZNG A;  5LJK A;  5DG4 A;  3ZUO A;  4MVK A;  5FFH A;  1BRP A;  5EED A;  4ZCB A;  2K62 A;  1B4M A;  5KHP A;  4EEJ A;  1O8V A;  1EUO A;  4YGG A;  4ES7 A;  1FEL A;  5F7G A;  1AVG I;  1CBI A;  2JU7 A;  2WQA E;  5HBS A;  3IA8 A;  3KFF A;  2CBS A;  2P8G A;  4ZR2 A;  5B27 A;  1OPB A;  1VPR A;  1MUP A;  5C0N A;  2HZQ A;  3DSZ A;  1D2U A;  1ZNH A;  2HMB A;  3WJF A;  5L8I A;  2OVE A;  2RD7 C;  1GXA A;  4I9S A;  4DQ3 A;  2R73 A;  3HK1 A;  5EDC A;  2WR6 A;  3NP1 A;  1KT6 A;  4QGW A;  1FE3 A;  4NNS A;  2W2F A;  3KZA A;  1BSO A;  1G85 A;  1PM1 X;  4IB7 A;  3WXQ A;  2OZQ A;  4CK4 A;  4Y0S A;  3FR2 A;  1X71 A;  3WJG A;  1GM6 A;  3C77 X;  1HBP A;  1QFV A;  3P6E A;  5KID A;  3NQ9 A;  1L6M A;  1SXW A;  2QOS C;  1I04 A;  2Q2P A;  2A3F X;  1MX8 A;  3D96 A;  1TOW A;  1QFT A;  3FEL A;  5D4A A;  2EU7 X;  1AB0 A;  4N7D A;  3WJE A;  1X8O A;  1NP1 A;  4ALB A;  4TQ2 A;  2X46 A;  1LIF A;  4IAW A;  4ORU A;  2L68 A;  1FEN A;  1TOU A;  3IFB A;  1GT5 A;  4ORW A;  3APW A;  3VG2 A;  1KOI A;  1SY1 A;  2HYS A;  4YBU A;  5EDB A;  1KT4 A;  4ZH9 A;  3VG7 A;  3EYC A;  2LBA A;  1HMR A;  1OBQ A;  5L8N A;  5HTD A;  2N93 A;  3O22 A;  5D45 A;  1YIV A;  4AZM A;  1BLR A;  1JYD A;  4QZU A;  4XME A;  3UEX A;  1X8U A;  4Y0P A;  2AH7 X;  2L5P A;  3D95 A;  5IO7 A;  4QYP A;  4YFP A;  2IFB A;  4PSQ A;  2R74 A;  4ODD A;  1S7D A;  2GC9 A;  3PH6 A;  4QGX A;  5EZ2 A;  2JN3 A;  4EFG A;  2Q2M A;  5HA0 A;  2LBV A;  4IBA A;  1CBR A;  3WJB A;  4EDE A;  1IFC A;  5HZ6 A;  2FLJ A;  2OVA A;  3BLG A;  1YWD A;  4OS0 A;  3Q6L A;  1IIU A;  2CZT A;  3TZS A;  2L9C A;  3CQR A;  1GX8 A;  4HPC A;  1OEK A;  5HCD C;  1G5W A;  2JU3 A;  1TVQ A;  1CBQ A;  4BOE A;  3FA9 A;  1IFB A;  4BQU A;  2E4J A;  3NR3 A;  4YMY A;  1BJ7 A;  4GKC A;  4ZFX A;  4AZQ A;  2F73 A;  1BEB A;  3O19 A;  2AMM X;  2K23 A;  4HFO A;  4O9S A;  4IMO A;  1T0V A;  3KFH A;  4YKO A;  2Q9S A;  3U9P C;  3HWD A;  1T8V A;  4NYR A;  4MVL A;  5LJG A;  5HTE A;  2WWP A;  5H9K A;  2WSJ A;  4ZHG A;  1DFV A;  3FR5 A;  2FRS A;  4LKT A;  4HPA A;  3APU A;  3O2Y A;  1VYG A;  2MM3 A;  5HAE A;  1R0U A;  3U0D A;  2GJ5 A;  3DTQ A;  4UU2 A;  3TGB A;  4Y0R A;  2A0A A;  2AL0 X;  3BU9 A;  3NPO A;  3QKG A;  1JZU A;  1OEE A;  4A1H A;  3AKN A;  3BS2 A;  3F8A A;  2OVD A;  1A57 A;  5HCC C;  2POA A;  4OS8 A;  1RLB E;  1LIC A;  3VG4 A;  3C76 X;  5JR8 A;  1VYF A;  1TW4 A;  5HZ5 A;  2A2U A;  4KII A;  3P6D A;  5F1E A;  3VG5 A;  3B2H A;  3CQN A;  4YDA A;  1GT3 A;  1I06 A;  3APX A;  2CZU A;  4IB8 A;  2ANS A;  5F6Z A;  1HMS A;  1T68 X;  2FS6 A;  3FA7 A;  3STM X;  3UEV A;  1ZNL A;  2AT6 X;  3WJC A;  2Q4N A;  1EAL A;  1G74 A;  2QO5 A;  4AZP A;  4M6S A;  4AZN A;  5L8O A;  5H9N A;  3FA8 A;  4ORX A;  3PPT A;  4XMD A;  4M7M A;  5D8J A;  4ZJ0 A;  2ACP X;  1YWA A;  5FEN A;  1KQX A;  4GNY A;  2GTF X;  2XKL A;  4GRJ A;  1ML7 A;  3FMZ A;  2G79 A;  1YP7 A;  5DPQ A;  5D48 A;  1BRQ A;  1E00 A;  2KTD A;  3D97 A;  1E06 A;  1MVG A;  4I9R A;  4HPB A;  2MO5 A;  4K19 A;  4ZGU A;  1EW3 A; 
#chains in the Genus database with same CATH topology
 1SWT A;  2IZH B;  3EC5 A;  4U3Q A;  4CDF A;  2AKQ A;  4TKJ A;  4TLJ A;  3RDX A;  3HWG A;  5B3M O;  1Y53 X;  3EMM A;  2AT5 X;  5EPQ A;  4ORY A;  1DZK A;  3B2J A;  3LV4 A;  1QY2 A;  1AVE A;  4ML7 B;  3RE5 A;  3NAD A;  4GH7 A;  4O4S A;  1ERX A;  1STS B;  5F2B A;  3MX7 A;  1BBP A;  3BU1 A;  4QZT A;  3FR4 A;  1JV4 A;  2RCQ A;  1SWJ A;  3FW4 A;  4GGZ A;  2OF9 A;  2W2A A;  1KZW A;  5BYP A;  2GTL O;  1A18 A;  3FLL A;  3HWE A;  4QRL A;  2CM9 A;  1HBQ A;  1XCA A;  4MIR A;  5H9A A;  4MVI A;  3JSQ A;  2RN4 A;  4WFU A;  2RTA A;  4CV7 A;  4I60 A;  3NX2 A;  1FTP A;  2PI3 O;  3BX8 A;  2IZI A;  2RTI B;  3NBX X;  1BSY A;  4N7C A;  3VHM A;  4Z6J A;  4O4O A;  1CJ5 A;  1KGL A;  2BLG A;  3HPE A;  3X00 A;  4HWM A;  3P6C A;  3CWK A;  2FHN X;  2RTB B;  1LDQ A;  2RTE B;  1W5R A;  5BVQ A;  2IZD B;  4JHQ A;  4GET A;  2RTP B;  3AKM A;  1LFO A;  2MWH A;  3HOE A;  2NNE A;  4I3D A;  3BSZ E;  4IB6 A;  2IZL B;  3D9W A;  3HOL A;  4NNT A;  1I9H A;  4ON1 A;  1NGL A;  2RTK A;  1LNM A;  4YFQ A;  2FGS A;  1HQP A;  3WZN A;  4ALO A;  3T2W A;  4TKB A;  1N0S A;  3NQ3 A;  1FEM A;  4BGF A;  4BX6 A;  2OY7 A;  1U17 A;  2FWV A;  5B10 O;  1RXK A;  5HZQ A;  3JQO A;  4WBK A;  4O4X A;  4L3R A;  2NP1 A;  1DZM A;  1JQP A;  1PTS A;  4NYQ A;  1ACD A;  2WQ9 A;  3WJD A;  1TXL A;  1SY3 A;  3V8U A;  4YDB A;  3SOT A;  1EPA A;  1KQW A;  1KXO A;  4I3C A;  1E02 A;  1UYO X;  1BM5 A;  1JBH A;  3STK A;  3B2K A;  1NC9 A;  4JO6 A;  4ARH A;  3BDR A;  3C78 X;  1NP4 A;  2BC3 A;  5HA1 A;  3L4R A;  1EIO A;  4AZR A;  1RSU B;  5CHK A;  3OD9 A;  2NND A;  2RTH B;  1CRB A;  4CDE A;  1EQD A;  1EXS A;  1GX9 A;  3T6F A;  1W6F A;  1LCZ A;  1SA8 A;  1ZRY A;  2OL8 O;  3BY0 A;  5IRA A;  1KT7 A;  1ZND A;  4XMG A;  1AQB A;  3S5V A;  3KFI A;  1LF7 A;  2FTB A;  1N9M A;  1SXX A;  3WVM A;  5KID A;  2GH7 A;  1ADL A;  3EBK A;  1G7N A;  1Y55 X;  3EW1 A;  4WHI A;  1ZNE A;  4ZH6 A;  5HZ8 A;  5LKF A;  2NNQ A;  1JMZ A;  2RA6 A;  1MDC A;  4YVB A;  4BX7 A;  1PMP A;  2RTL A;  3EW2 A;  1SY2 A;  4OMX A;  5LJD A;  3MBT A;  2KD2 A;  2XST A;  3HWF A;  1ZNK A;  1X8N A;  1U18 A;  2CBR A;  2WEW A;  1DC9 A;  1LIB A;  2OY8 A;  3G7X A;  4NW4 A;  4MVE A;  4OKA A;  4Y5D A;  1PEE A;  3VGW A;  1HMT A;  1VWM B;  4DCB A;  1A2D A;  1OPA A;  1DZP A;  2Y3E A;  3BX7 A;  5F1E A;  1B0O A;  3EM0 A;  5D47 A;  5BVT A;  1IW2 A;  1MK5 A;  2LA7 A;  1NQN A;  1VWE B;  1ICN A;  1JJU A;  1LKE A;  3VG6 A;  1URE A;  1QY0 A;  3WYQ A;  3UEW A;  4OS3 A;  1WUB A;  1IKJ A;  1KL4 A;  1GX3 A;  3CMP A;  4GJV A;  2RTM A;  4GNW A;  4EXZ A;  2LKK A;  1VWP B;  2W2B A;  1VWF B;  2A2G A;  5H8T A;  4BX7 B;  1YP6 A;  2PY1 A;  3CBC A;  2JGS A;  1SRG A;  1B56 A;  4NP1 A;  4U8U M;  3RZY A;  1EPB A;  1YWC A;  2JU8 A;  4RUU A;  5EEE A;  3ZQ3 A;  1WBI A;  2IZE B;  4O3W A;  4Y0Q A;  1JJX A;  3MG5 A;  4YCE A;  2HKD A;  2X8S A;  4ZHC A;  3HTY A;  1B8E A;  3PDF A;  2IZC B;  3VHI A;  2ACO A;  5IO5 A;  1HXL A;  2OFB A;  1SLF B;  1U0X A;  3PQS A;  4IB9 A;  2QM9 A;  3FEP A;  2VFC A;  1NDJ A;  3CKF A;  4UU3 A;  4COT A;  4ZHF A;  2FKJ A;  2FR3 A;  3ZW0 A;  3OBL A;  1MX7 A;  3WZQ A;  3T1D A;  1P6P A;  3K3L A;  1UZ2 X;  3B2L A;  5HCE C;  1KZX A;  2BS6 A;  3B2I A;  2FS7 A;  2I5V O;  5B11 O;  3S26 A;  2RQ0 A;  2VFB A;  3I0A A;  1SXY A;  1VWD B;  2RTJ A;  3FEK A;  2X56 A;  4IMN A;  3RE6 A;  3SLT A;  2HZR A;  2WPU A;  4YGZ A;  1E2T A;  2L67 A;  2FHL A;  4OMW A;  4FGI B;  4LZU A;  3F9D A;  2ZAG A;  3MVF A;  1SWU A;  2HNX A;  4LKP A;  3APV A;  3T2X A;  3FW5 A;  1ALB A;  2ZSC A;  3PK2 A;  2ASN X;  3P6H A;  4YGH A;  2WEX A;  1SXU A;  5B5F A;  2G7B A;  3TF6 A;  1KL5 A;  1X89 A;  4Z2O A;  2LFO A;  2QO6 A;  3VG3 A;  4Z2V A;  1SWC A;  1I05 A;  4GJS A;  4NLI A;  3WZP A;  2F09 A;  1AEL A;  1JMX A;  3Q34 A;  1E5P A;  1YWB A;  1Z24 A;  3KFG A;  4FQB B;  1IKE A;  4A60 A;  1N9Y A;  3KQ0 A;  4NLJ A;  5F6B A;  1RST B;  4YCH A;  3E3C A;  1FDQ A;  2RTN B;  4U8U N;  4LZV A;  3T6L A;  4AW8 A;  1VWR B;  1VWC B;  2FT9 A;  3FIQ A;  4IAX A;  2JOZ A;  4MIS A;  1DF3 A;  1BSQ A;  3GE2 A;  1SWE A;  2OFM X;  3STN A;  2A13 A;  5HWZ A;  4B55 A;  1QWD A;  3SLO A;  1GT1 A;  1SWR A;  4CDD A;  1JYJ A;  2C4I A;  2LB6 A;  3UEU A;  1LIE A;  1XKI A;  1UYN X;  2YMS A;  2CM4 A;  3EBW A;  3JS1 A;  3ZW2 A;  4A1Y A;  2Q39 A;  3TGC A;  4C5P A;  1EW3 A;  1EII A;  1SWN A;  4ZHD A;  4CPH A;  4GUZ A;  4YH0 A;  1W4T A;  1Y52 X;  4I6S A;  3RWX A;  4GK9 A;  1S44 A;  3WBG A;  2OFA A;  4Y59 A;  4AZO A;  3FA6 A;  3OE3 A;  2JW1 A;  3LTW A;  1NQM A;  2JMB A;  3NQK A;  4OEM A;  1AVD A;  1ERB A;  3VHH A;  1VWJ B;  4BVM A;  1SRE A;  4QYN A;  3WOV A;  4CPE A;  5HZ9 A;  5LKE A;  4A8Z A;  5LJB A;  4TJZ A;  1N4J A;  2C1Q A;  4I3B A;  2AT8 X;  1QQS A;  3PH5 A;  3RDO A;  1GKA A;  2DM5 A;  1GGL A;  1VWL B;  2WUT A;  1DV9 A;  3N91 A;  1YUP A;  2QO4 A;  5KIC A;  1VWO B;  2R56 A;  3FEN A;  1DZJ A;  4BCS A;  4ZHH A;  1BWY A;  1I4U A;  5CYB A;  4ORS A;  4CPH B;  4YKM A;  1CBS A;  2X55 A;  3NX1 A;  2O62 A;  1ICM A;  2RTQ B;  4GGR A;  4GU8 A;  4TKH A;  3RSW A;  3S5X A;  1A3Y A;  4LQZ A;  4KC8 A;  5CSE A;  2OFR X;  4I95 A;  1K3B A;  2GTL N;  1PBY A;  1RXH A;  1OBP A;  2AT3 X;  1PBO A;  1RBP A;  2ALL X;  2HLV A;  2X45 A;  4XMF A;  3TGA A;  4D6B A;  3I17 A;  5F58 A;  1LID A;  2G78 A;  4HPD A;  4YBP A;  5CE4 A;  3CR6 A;  1SY0 A;  4XMC A;  5IXG A;  1QAB E;  2IZF B;  2MJI A;  4WFV A;  1GKA B;  1D3S A;  1QY1 A;  2M4L A;  4NV8 A;  3ELX A;  3SZJ A;  2ZAI A;  5IO6 A;  5K06 A;  3ZW1 A;  3CKG A;  3OJY C;  3VPJ E;  2MF6 A;  2RTO B;  4NV7 A;  1HXZ A;  3ZUI A;  3ELZ A;  4CPF A;  2FR2 A;  1EI5 A;  4R0B A;  4QNI A;  1OBU A;  3RY1 A;  3H3I A;  1Y0G A;  2IZB A;  1H91 A;  1O1V A;  4IAB A;  3P6G A;  1Y9T A;  4ORR A;  4QAE A;  5BVS A;  4CDC A;  4ZGF A;  2YG2 A;  1S2P A;  2BS5 A;  4U46 A;  4BX5 A;  3MM0 A;  2RTG B;  1SWH A;  3PED A;  5LJE A;  1OEJ A;  3ZWE A;  3BRN A;  2F01 A;  1N7Y A;  3VE2 A;  3GAQ A;  4YFR A;  3PP6 A;  4RUN A;  2IZA A;  4KC7 A;  1RXJ A;  2QOM A;  2OY1 O;  4D6A A;  5LJH A;  3P6F A;  3KVN A;  2KW1 A;  4GE1 A;  1SRJ A;  3SAO A;  5H9L A;  3AUM O;  4FBO A;  5JR8 A;  1HN2 A;  2AT0 X;  1VWA B;  2RCT A;  2RTC B;  1VWI B;  2IZJ A;  1OSP O;  3CBS A;  1KT5 A;  1QG5 A;  1KT3 A;  2A5C A;  1VWK B;  1O1U A;  4TNN A;  3AEH A;  4BX5 B;  1JJJ A;  1GT4 A;  4ID2 A;  1X8Q A;  2X8T A;  4CPI A;  2OF8 A;  1VWG B;  1N43 A;  2I5Z O;  2KT4 B;  3PEC A;  4AYH A;  5AQ6 A;  4DQ4 A;  1LPJ A;  5FAZ A;  1X8P A;  2C1S A;  5B29 A;  5LJC A;  4XMH A;  2G5L A;  1ZNG A;  5LJK A;  5DG4 A;  3ZUO A;  4MVK A;  5FFH A;  3U03 A;  1BRP A;  5EED A;  4ZCB A;  2K62 A;  1B4M A;  5KHP A;  4EEJ A;  4KT5 A;  1O8V A;  1EUO A;  2CAM A;  4YGG A;  2OL7 A;  1FEL A;  2G8C O;  2IZG B;  5B2A O;  5F7G A;  2OY5 O;  3SZI A;  4ES7 A;  4GZV A;  1VWH B;  4BX6 B;  1LUQ A;  1STP A;  1AVG I;  1CBI A;  2JU7 A;  1LEL A;  2WQA E;  3ZI8 A;  5HBS A;  3IA8 A;  3KFF A;  2CBS A;  1SWP A;  2P8G A;  4ZR2 A;  1SRH A;  5B27 A;  4QQ1 A;  1OPB A;  1VPR A;  3ZW0 B;  1MUP A;  5C0N A;  2HZQ A;  3DSZ A;  1D2U A;  1ZNH A;  2HMB A;  2QCB A;  3QQ2 A;  5L8I A;  3WJF A;  2OVE A;  3LHN A;  2RD7 C;  1GXA A;  4I9S A;  2DJF A;  4KH8 A;  2GTL M;  2R73 A;  3WYP A;  4DQ3 A;  2A5B A;  3HK1 A;  4Z28 A;  5EDC A;  3P24 A;  2WR6 A;  3NP1 A;  1KT6 A;  1VWB B;  1DF8 A;  1SRF A;  4QGW A;  5FQ6 E;  1FE3 A;  2IZK A;  1SWQ A;  1I78 A;  4NNS A;  1SWL A;  2W2F A;  3KZA A;  4GGT A;  1BSO A;  1G85 A;  1PM1 X;  4IB7 A;  3WXQ A;  4DNE A;  2OZQ A;  4CK4 A;  5HZ5 A;  4Y0S A;  1JIW I;  3FR2 A;  1X71 A;  3WJG A;  1GM6 A;  1LDO A;  1HBP A;  1QFV A;  2OL6 O;  3C77 X;  3P6E A;  3NQ9 A;  1L6M A;  1SXW A;  3RY2 A;  2QOS C;  1I04 A;  3RDU A;  3FYF A;  2Q2P A;  2A3F X;  1MX8 A;  3D96 A;  1TOW A;  1QFT A;  2Z4I A;  3FEL A;  5D4A A;  2EU7 X;  1AB0 A;  4N7D A;  3WJE A;  5JD2 A;  1X8O A;  4O4U A;  1NP1 A;  1SMP I;  2RTR B;  2Z4H A;  4ALB A;  4TQ2 A;  2X46 A;  1LIF A;  4IAW A;  1SWD A;  4ORU A;  2L68 A;  1FEN A;  1TOU A;  3IFB A;  1GT5 A;  2UYW A;  3APW A;  4ORW A;  3VG2 A;  4GDZ A;  1KOI A;  1SY1 A;  2HYS A;  1MEP A;  4YBU A;  5EDB A;  2RTD B;  1KT4 A;  4KCA A;  4ZH9 A;  3VG7 A;  4FBV A;  1Y9L A;  3EYC A;  1SWG A;  2LBA A;  1HMR A;  4EQA C;  1OBQ A;  5L8N A;  5HTD A;  2N93 A;  3O22 A;  5D45 A;  1YIV A;  4OEL A;  2KTS A;  4L1N A;  1VYO A;  4AZM A;  4CSB A;  5K67 A;  1BLR A;  1JYD A;  4QZU A;  4XME A;  3UEX A;  3VG5 A;  1X8U A;  3PQU A;  4Y0P A;  2L5P A;  3D95 A;  2AH7 X;  5IO7 A;  4QYP A;  4YFP A;  2IFB A;  4PSQ A;  2OVS A;  2R74 A;  5AJB A;  3RBY A;  4ODD A;  1S7D A;  2X32 A;  4O49 A;  2GC9 A;  3PH6 A;  4QGX A;  5EZ2 A;  2JN3 A;  4EFG A;  2A8G A;  2Q2M A;  5HA0 A;  2LBV A;  1HY2 A;  1CBR A;  4IBA A;  4JGL A;  4PJ2 A;  3WJB A;  4EDE A;  1IFC A;  5HZ6 A;  1SWK A;  1K24 A;  2FLJ A;  2OVA A;  3BLG A;  4MEE A;  1YWD A;  4OS0 A;  4U9C A;  4QGV A;  3Q6L A;  1SWA A;  1IIU A;  2X8F A;  2CZT A;  3D4R A;  3TZS A;  2L9C A;  3CQR A;  4INN A;  1GX8 A;  5IRU A;  3RDQ A;  4HPC A;  4GD9 A;  1OEK A;  5HCD C;  1MOY A;  1G5W A;  5IRW A;  4O3Y A;  4BBO A;  2JU3 A;  1SLE B;  1TVQ A;  1CBQ A;  5FQ7 E;  3WZO A;  4BOE A;  3FA9 A;  1IFB A;  1HQQ A;  2E4J A;  4BQU A;  4Z2P A;  5FQ8 E;  3NR3 A;  3FID A;  4YMY A;  1BJ7 A;  4GKC A;  3RKG A;  4ZFX A;  2BT9 A;  2F73 A;  1BEB A;  3O19 A;  1NBX A;  1RAV A;  4JNJ A;  5B5G A;  4AZQ A;  4IRW A;  2AMM X;  2K23 A;  4HFO A;  4O9S A;  1FJ1 E;  4IMO A;  1T0V A;  3KFH A;  4YKO A;  1VWN B;  2Q9S A;  3U9P C;  3HWD A;  1T8V A;  4NYR A;  2AVI A;  1MM9 A;  3S60 A;  4MVL A;  5LJG A;  5HTE A;  2WWP A;  5H9K A;  2MHD A;  4FBR A;  2WSJ A;  4ZHG A;  1DFV A;  3FR5 A;  2FRS A;  4LKT A;  3ZW1 B;  4HPA A;  3APU A;  3O2Y A;  1VYG A;  2MM3 A;  2RTF B;  3FDC A;  5HAE A;  1R0U A;  4O3X B;  3U0D A;  2GJ5 A;  3DTQ A;  4O3Z A;  4UU2 A;  4Z27 A;  4Y0R A;  1SLG B;  2A0A A;  2AL0 X;  3TGB A;  1LCV A;  3BU9 A;  3NPO A;  3QKG A;  1JZU A;  1OEE A;  2UZ2 A;  3VU1 A;  4A1H A;  3AKN A;  1SLD B;  3BS2 A;  3F8A A;  2OVD A;  1SWB A;  3ZZV A;  1IJ8 A;  3SZH A;  1A57 A;  1SWO A;  5HCC C;  2POA A;  4OS8 A;  1RLB E;  1LIC A;  3VG4 A;  3C76 X;  1STR B;  1VYF A;  1TW4 A;  5K68 A;  3SLJ A;  2A2U A;  2QMI A;  3P6D A;  2X34 A;  4KII A;  2X4M A;  3B2H A;  3CQN A;  2AF5 A;  4YDA A;  1GT3 A;  2DJG A;  1I06 A;  3APX A;  2OYB O;  2CZU A;  4IB8 A;  2ANS A;  3UAQ A;  2BSZ A;  5F6Z A;  1HMS A;  1T68 X;  2FS6 A;  3FA7 A;  4U8U O;  3STM X;  5L3Y A;  3UEV A;  1ZNL A;  2AT6 X;  5AJC A;  2Q4N A;  3WJC A;  1G74 A;  2QO5 A;  4AZP A;  4M6S A;  4BJ8 A;  1EAL A;  1VWQ B;  5AEO A;  2Y3F A;  4AZN A;  5L8O A;  3F6Z B;  5H9N A;  3RDS A;  2FKG A;  2VDF A;  2Y32 A;  3FA8 A;  3VE1 A;  4ORX A;  3PPT A;  4XMD A;  4M7M A;  5D8J A;  4ZJ0 A;  2ACP X;  1YWA A;  5FEN A;  1KQX A;  4GNY A;  1KL3 A;  1SRI A;  2GTF X;  2XKL A;  2BHV A;  4GRJ A;  1ML7 A;  3FMZ A;  2G79 A;  1YP7 A;  5DPQ A;  5D48 A;  1KFF A;  1BRQ A;  1E00 A;  2KTD A;  3D97 A;  4EKV A;  1E06 A;  4GDA A;  1MVG A;  1SWF A;  4I9R A;  4HPB A;  2MO5 A;  3RDM A;  3P02 A;  4K19 A;  1LCW A;  4ZGU A;  1SWS A; 
#chains in the Genus database with same CATH homology
 4U3Q A;  2AKQ A;  4TKJ A;  4TLJ A;  3HWG A;  3EMM A;  5EPQ A;  2AT5 X;  4ORY A;  1DZK A;  3B2J A;  3LV4 A;  1QY2 A;  4ML7 B;  3NAD A;  4GH7 A;  4O4S A;  1ERX A;  3MX7 A;  1BBP A;  3BU1 A;  4QZT A;  3FR4 A;  1JV4 A;  2RCQ A;  3FW4 A;  2W2A A;  1KZW A;  5BYP A;  2GTL O;  1A18 A;  3FLL A;  3HWE A;  4QRL A;  2CM9 A;  1HBQ A;  1XCA A;  4MIR A;  5H9A A;  4MVI A;  3JSQ A;  2RN4 A;  4WFU A;  4CV7 A;  3NX2 A;  1FTP A;  4N7C A;  3BX8 A;  1KGL A;  3NBX X;  1BSY A;  1CJ5 A;  4O4O A;  2BLG A;  4HWM A;  3P6C A;  3CWK A;  5BVQ A;  4GET A;  3AKM A;  3HOE A;  1LFO A;  2MWH A;  4I3D A;  2NNE A;  3RBY A;  3BSZ E;  4IB6 A;  4NNT A;  3HOL A;  4ON1 A;  1NGL A;  1LNM A;  4YFQ A;  1HQP A;  4ALO A;  4TKB A;  1N0S A;  3NQ3 A;  1FEM A;  1U17 A;  2FWV A;  5HZQ A;  3JQO A;  4WBK A;  4O4X A;  4L3R A;  2NP1 A;  1DZM A;  4NYQ A;  1ACD A;  2WQ9 A;  3WJD A;  1TXL A;  1SY3 A;  3V8U A;  4YDB A;  3SOT A;  1EPA A;  1KQW A;  1KXO A;  4I3C A;  1E02 A;  1BM5 A;  1JBH A;  3STK A;  3B2K A;  4ARH A;  3BDR A;  3C78 X;  1NP4 A;  3L4R A;  1EIO A;  4AZR A;  3OD9 A;  2NND A;  1CRB A;  1EQD A;  1EXS A;  1GX9 A;  1ZRY A;  1SA8 A;  5LJB A;  3BY0 A;  1KT7 A;  1ZND A;  4XMG A;  1AQB A;  3S5V A;  3KFI A;  1LF7 A;  2FTB A;  1SXX A;  3WVM A;  1ADL A;  3EBK A;  1G7N A;  4WHI A;  4ZH6 A;  1ZNE A;  5HZ8 A;  5LKF A;  2NNQ A;  2RA6 A;  1MDC A;  1PMP A;  1SY2 A;  4OMX A;  5LJD A;  3MBT A;  2KD2 A;  2XST A;  3HWF A;  1ZNK A;  1X8N A;  1U18 A;  2CBR A;  2WEW A;  1DC9 A;  1LIB A;  3G7X A;  4NW4 A;  4MVE A;  1PEE A;  1HMT A;  1A2D A;  1OPA A;  1DZP A;  3BX7 A;  1B0O A;  3EM0 A;  5D47 A;  5BVT A;  1IW2 A;  2LA7 A;  1ICN A;  1LKE A;  3VG6 A;  1URE A;  1QY0 A;  3UEW A;  4OS3 A;  1IKJ A;  3CMP A;  4GNW A;  4EXZ A;  2LKK A;  2W2B A;  2A2G A;  5H8T A;  2PY1 A;  1YP6 A;  3CBC A;  3RZY A;  4NP1 A;  1B56 A;  4U8U M;  1EPB A;  1YWC A;  2JU8 A;  4RUU A;  5EEE A;  3ZQ3 A;  4O3W A;  1JJX A;  4Y0Q A;  4YCE A;  2X8S A;  4ZHC A;  3HTY A;  1B8E A;  2ACO A;  5IO5 A;  1U0X A;  3PQS A;  4IB9 A;  2QM9 A;  3FEP A;  4UU3 A;  4COT A;  3U03 A;  4ZHF A;  2FR3 A;  3ZW0 A;  3OBL A;  1MX7 A;  3T1D A;  1P6P A;  3K3L A;  1UZ2 X;  3B2L A;  5HCE C;  1KZX A;  2BS6 A;  3B2I A;  2FS7 A;  3S26 A;  2RQ0 A;  4IMN A;  3I0A A;  1SXY A;  3FEK A;  2HZR A;  4YGZ A;  2L67 A;  4OMW A;  4FGI B;  4LZU A;  3F9D A;  2ZAG A;  3MVF A;  2HNX A;  4LKP A;  3APV A;  3FW5 A;  1ALB A;  2ASN X;  3P6H A;  4YGH A;  2WEX A;  1SXU A;  2G7B A;  3TF6 A;  1X89 A;  2LFO A;  2QO6 A;  3VG3 A;  1AEL A;  4NLI A;  1I05 A;  2F09 A;  1E5P A;  1YWB A;  1Z24 A;  3KFG A;  4FQB B;  1IKE A;  4A60 A;  3KQ0 A;  4NLJ A;  5F6B A;  4YCH A;  3E3C A;  1FDQ A;  4U8U N;  4LZV A;  4AW8 A;  4MIS A;  2FT9 A;  3FIQ A;  4IAX A;  2JOZ A;  1DF3 A;  1BSQ A;  3GE2 A;  5HWZ A;  2OFM X;  3STN A;  2A13 A;  1QWD A;  1GT1 A;  1JYJ A;  2LB6 A;  3UEU A;  1LIE A;  1XKI A;  2YMS A;  3EBW A;  2CM4 A;  3JS1 A;  3ZW2 A;  4A1Y A;  2Q39 A;  3TGC A;  1EII A;  4ZHD A;  4YH0 A;  4I6S A;  3RWX A;  4GK9 A;  1S44 A;  3WBG A;  4AZO A;  3FA6 A;  3OE3 A;  2JW1 A;  2JMB A;  3NQK A;  1ERB A;  4BVM A;  3WOV A;  4QYN A;  5HZ9 A;  5LKE A;  4A8Z A;  4TJZ A;  4I3B A;  2AT8 X;  1QQS A;  3PH5 A;  1GKA A;  2DM5 A;  1GGL A;  2WUT A;  1DV9 A;  3N91 A;  1YUP A;  2QO4 A;  5KIC A;  2R56 A;  3FEN A;  1DZJ A;  4ZHH A;  1BWY A;  1I4U A;  5CYB A;  4ORS A;  4YKM A;  1CBS A;  3NX1 A;  2O62 A;  1ICM A;  4GU8 A;  4TKH A;  3RSW A;  3S5X A;  1A3Y A;  4LQZ A;  4KC8 A;  2OFR X;  4I95 A;  2GTL N;  4XMF A;  5HA1 A;  1OBP A;  2AT3 X;  1PBO A;  1RBP A;  2ALL X;  2HLV A;  2X45 A;  4D6B A;  3TGA A;  5CE4 A;  3I17 A;  5F58 A;  1LID A;  2G78 A;  4HPD A;  4YBP A;  3CR6 A;  1SY0 A;  4XMC A;  1QAB E;  2MJI A;  4WFV A;  1GKA B;  1D3S A;  1QY1 A;  2M4L A;  3ELX A;  2ZAI A;  5IO6 A;  5K06 A;  3ZW1 A;  3OJY C;  3VPJ E;  3ZUI A;  3ELZ A;  2FR2 A;  1EI5 A;  4R0B A;  4QNI A;  1OBU A;  3H3I A;  4QGV A;  4IAB A;  1H91 A;  1O1V A;  4ORR A;  3P6G A;  1Y9T A;  4QAE A;  5BVS A;  4ZGF A;  2YG2 A;  1S2P A;  2BS5 A;  3PED A;  5LJE A;  1OEJ A;  3ZWE A;  3BRN A;  3VE2 A;  3GAQ A;  4YFR A;  3PP6 A;  4RUN A;  4KC7 A;  4D6A A;  5LJH A;  3P6F A;  2KW1 A;  4GE1 A;  3SAO A;  5H9L A;  4FBO A;  1HN2 A;  2AT0 X;  2RCT A;  3CBS A;  1KT5 A;  1QG5 A;  1KT3 A;  1O1U A;  4TNN A;  1JJJ A;  1GT4 A;  4ID2 A;  1X8Q A;  2X8T A;  2KT4 B;  3PEC A;  4AYH A;  5AQ6 A;  4DQ4 A;  1LPJ A;  5FAZ A;  1X8P A;  5LJC A;  5B29 A;  4XMH A;  1ZNG A;  5LJK A;  5DG4 A;  3ZUO A;  4MVK A;  5FFH A;  1BRP A;  5EED A;  4ZCB A;  2K62 A;  1B4M A;  5KHP A;  4EEJ A;  4KT5 A;  1O8V A;  1EUO A;  4YGG A;  4ES7 A;  1FEL A;  5F7G A;  4GZV A;  1AVG I;  1CBI A;  2JU7 A;  3ZI8 A;  2WQA E;  5HBS A;  3IA8 A;  3KFF A;  2CBS A;  2P8G A;  4ZR2 A;  5B27 A;  4QQ1 A;  1OPB A;  1VPR A;  3ZW0 B;  1MUP A;  5C0N A;  2HZQ A;  3DSZ A;  1D2U A;  1ZNH A;  2HMB A;  3WJF A;  5L8I A;  2OVE A;  3LHN A;  2RD7 C;  1GXA A;  4I9S A;  4KH8 A;  2GTL M;  2R73 A;  4DQ3 A;  3HK1 A;  5EDC A;  3P24 A;  2WR6 A;  3NP1 A;  1KT6 A;  5FQ6 E;  4QGW A;  1FE3 A;  4NNS A;  2W2F A;  3KZA A;  1BSO A;  1G85 A;  1PM1 X;  4IB7 A;  3WXQ A;  2OZQ A;  4CK4 A;  4Y0S A;  1JIW I;  3FR2 A;  1X71 A;  3WJG A;  1GM6 A;  3C77 X;  1HBP A;  1QFV A;  3P6E A;  3VU1 A;  5KID A;  3NQ9 A;  1L6M A;  1SXW A;  2QOS C;  1I04 A;  3FYF A;  2Q2P A;  2A3F X;  1MX8 A;  3D96 A;  1TOW A;  1QFT A;  2Z4I A;  3FEL A;  5D4A A;  2EU7 X;  1AB0 A;  4N7D A;  3WJE A;  1X8O A;  4O4U A;  1NP1 A;  1SMP I;  2Z4H A;  4ALB A;  4TQ2 A;  2X46 A;  1LIF A;  4IAW A;  4ORU A;  2L68 A;  1FEN A;  1TOU A;  3IFB A;  1GT5 A;  4ORW A;  3APW A;  3VG2 A;  4GDZ A;  1KOI A;  1SY1 A;  2HYS A;  4YBU A;  5EDB A;  1KT4 A;  4KCA A;  4ZH9 A;  3VG7 A;  4FBV A;  1Y9L A;  3EYC A;  2LBA A;  1HMR A;  4EQA C;  1OBQ A;  5L8N A;  5HTD A;  2N93 A;  3O22 A;  5D45 A;  1YIV A;  4AZM A;  2KTS A;  4L1N A;  4CSB A;  1BLR A;  1JYD A;  4QZU A;  4XME A;  3UEX A;  1X8U A;  3PQU A;  4Y0P A;  2L5P A;  3D95 A;  2AH7 X;  5IO7 A;  4QYP A;  4YFP A;  2IFB A;  4PSQ A;  2OVS A;  2R74 A;  5AJB A;  4ODD A;  1S7D A;  4O49 A;  2GC9 A;  3PH6 A;  4QGX A;  5EZ2 A;  2JN3 A;  4EFG A;  2Q2M A;  5HA0 A;  2LBV A;  4IBA A;  1CBR A;  4PJ2 A;  4JGL A;  3WJB A;  4EDE A;  1IFC A;  5HZ6 A;  4U9C A;  2FLJ A;  2OVA A;  3BLG A;  1YWD A;  4OS0 A;  3Q6L A;  1IIU A;  2X8F A;  2CZT A;  3D4R A;  3TZS A;  2L9C A;  3CQR A;  4INN A;  1GX8 A;  4HPC A;  1OEK A;  5HCD C;  1G5W A;  4O3Y A;  2JU3 A;  5FQ7 E;  1TVQ A;  1CBQ A;  4BOE A;  3FA9 A;  1IFB A;  4BQU A;  2E4J A;  5FQ8 E;  3NR3 A;  4YMY A;  1BJ7 A;  4GKC A;  3RKG A;  4ZFX A;  2BT9 A;  2F73 A;  1BEB A;  3O19 A;  4AZQ A;  2AMM X;  2K23 A;  4HFO A;  4O9S A;  4IMO A;  1T0V A;  3KFH A;  4YKO A;  2Q9S A;  3U9P C;  3HWD A;  1T8V A;  4NYR A;  3S60 A;  4MVL A;  5LJG A;  5HTE A;  2WWP A;  5H9K A;  2MHD A;  4FBR A;  2WSJ A;  4ZHG A;  1DFV A;  3FR5 A;  2FRS A;  4LKT A;  3ZW1 B;  4HPA A;  3APU A;  3O2Y A;  1VYG A;  2MM3 A;  5HAE A;  1R0U A;  4O3X B;  3U0D A;  2GJ5 A;  3DTQ A;  4O3Z A;  4UU2 A;  3TGB A;  4Y0R A;  2A0A A;  2AL0 X;  3BU9 A;  3NPO A;  3QKG A;  1JZU A;  1OEE A;  4A1H A;  3AKN A;  3BS2 A;  3F8A A;  2OVD A;  3ZZV A;  1A57 A;  5HCC C;  2POA A;  4OS8 A;  1RLB E;  1LIC A;  3VG4 A;  3C76 X;  5JR8 A;  1VYF A;  1TW4 A;  5HZ5 A;  2A2U A;  2QMI A;  3P6D A;  4KII A;  5F1E A;  3VG5 A;  3B2H A;  3CQN A;  4YDA A;  1GT3 A;  1I06 A;  3APX A;  2CZU A;  4IB8 A;  2ANS A;  3UAQ A;  5F6Z A;  1HMS A;  1T68 X;  2FS6 A;  3FA7 A;  4U8U O;  3STM X;  3UEV A;  1ZNL A;  2AT6 X;  5AJC A;  2Q4N A;  3WJC A;  1G74 A;  2QO5 A;  4AZP A;  4M6S A;  1EAL A;  5AEO A;  4AZN A;  5L8O A;  3F6Z B;  5H9N A;  3VE1 A;  3FA8 A;  4ORX A;  3PPT A;  4XMD A;  4M7M A;  5D8J A;  4ZJ0 A;  2ACP X;  1YWA A;  5FEN A;  1KQX A;  4GNY A;  2GTF X;  2XKL A;  4GRJ A;  2BHV A;  1ML7 A;  3FMZ A;  2G79 A;  1YP7 A;  5DPQ A;  5D48 A;  1BRQ A;  1E00 A;  2KTD A;  3D97 A;  1E06 A;  1MVG A;  4I9R A;  4HPB A;  2MO5 A;  3P02 A;  4K19 A;  4ZGU A;  1EW3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...