2AT5X

1.22 a crystal structure of nitrophorin 4 from rhodnius prolixus containing fe(iii) deuteroporphyrin ix complexed with nitric oxide at ph 5.6
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
184
structure length
184
Chain Sequence
b'ACTKNAIAQTGFNKDKYFNGDVWYVTDYLDLEPDDVPKRYCAALAAGTASGKLKEALYHYDPKTQDTFYDVSELQVESLGKYTANFKKVDKNGNVKVAVTAGNYYTFTVMYADDSSALIHTCLHKGNKDLGDLYAVLNRNKDAAAGDKVKSAVSAATLEFSKFISTKENNCAYDNDSLKSLLTK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrophorin 4
publication title Heme distortion in nitrophorin 4: high resolution structures of mutated positions L123V and L133V and heme altered proteins
rcsb
source organism Rhodnius prolixus
molecule tags Transport protein
total genus 52
structure length 184
sequence length 184
ec nomenclature ec 1.7.6.1: Nitrite dismutase.
pdb deposition date 2005-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF02087 Nitrophorin Nitrophorin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 2at5X00
2POAA 3WBGA 2P8GA 3FR5A 4AZOA 1KGLA 1GT1A 1BM5A 2X46A 2MJIA 1VYFA 1GT3A 2GTFX 3WJGA 1BRPA 5HZ8A 2FS7A 4NP1A 1LIFA 1ZNLA 4A60A 1PMPA 2OVDA 1HQPA 3FA6A 4YBPA 4EEJA 2WUTA 4IBAA 3C78X 4YFQA 2Q4NA 5EEDA 1GX9A 4ARHA 2OZQA 5HZ9A 2OVAA 3P6CA 3WJCA 3PH5A 4GNYA 1EQDA 5F1EA 1B4MA 1JZUA 2G78A 5L8IA 4GETA 5EDBA 3PECA 4TLJA 5BVSA 3NQ3A 2FT9A 4D6AA 2OFRX 4IB8A 4YBUA 2HMBA 5HZ5A 2WR6A 1GXAA 3VG2A 1H91A 3O22A 1X8OA 1TXLA 4ORYA 1B0OA 4TKBA 4ZH9A 2W2BA 1E5PA 1OEKA 4YKMA 3ZUIA 4A8ZA 1ERXA 1YWDA 3B2HA 5FENA 4ZH6A 1KT7A 3CR6A 3WJBA 3D96A 2Q2MA 1R0UA 3U9PC 3B2LA 3WVMA 3BDRA 3FW4A 1QY0A 4GRJA 5KHPA 1QY1A 1S44A 1JYDA 3JSQA 1JV4A 5D48A 3FA9A 1YWAA 2A3FX 1DZMA 4XMDA 3NX2A 1QQSA 3FEPA 3P6DA 5BVQA 1XCAA 4ODDA 2AKQA 4BQUA 1LKEA 2HYSA 3NP1A 3APUA 3C76X 3BS2A 3CMPA 1AB0A 2K62A 3P6FA 5LJDA 1IFCA 4EFGA 3UEUA 1MX8A 1KT5A 2CM4A 5D47A 1VPRA 2AT6X 3IFBA 4AZMA 1QG5A 5D45A 5HCDC 3Q6LA 1QY2A 1A18A 3FIQA 5LJEA 3FR2A 1DV9A 2ANSA 1T68X 4ORWA 5H9LA 2G79A 4IMNA 5K06A 3O19A 3BX8A 1TW4A 2A2GA 3FW5A 5HCCC 4A1HA 4R0BA 1DZJA 1OBPA 4HFOA 3CBCA 5LJBA 4QGXA 2XKLA 2CM9A 1GM6A 1B8EA 3D97A 3FENA 1S2PA 1A2DA 4XMEA 5EEEA 1JYJA 2RCQA 4AZRA 2Q9SA 1KT3A 2JU3A 2NNEA 3STMX 3B2JA 1KOIA 1GGLA 3HWFA 3PP6A 1QWDA 3WJFA 4CK4A 1X89A 1CBSA 1KT4A 4QYPA 5EPQA 3WXQA 5HWZA 5FAZA 2ACOA 3F9DA 5H9NA 2WSJA 2AT3X 1D3SA 3HK1A 3EMMA 3VG7A 5HAEA 1YP6A 1YP7A 2FRSA 2QO4A 3FA8A 1G74A 3KFGA 1X8NA 1UZ2X 1O1UA 3APVA 2PY1A 4A1YA 4PSQA 4GKCA 4YFRA 1KXOA 3BX7A 2A2UA 5HA1A 1SY3A 1ICNA 1BSOA 5H8TA 1DZKA 3WJEA 5IO7A 3ZUOA 2JU8A 1IIUA 3FELA 4MVLA 2R56A 4UU2A 3TGAA 1IW2A 3WJDA 4QZTA 1O8VA 1YWCA 2FLJA 3RSWA 2X45A 1OEEA 1E06A 3ELZA 1P6PA 4AZQA 2QM9A 5HZ6A 1SY2A 3P6GA 4YMYA 5LJHA 3APXA 1GT4A 1KT6A 2RD7C 5HA0A 5B29A 1VYGA 2ASNX 4Y0RA 1MVGA 3TF6A 4WFUA 3U03A 4IAXA 4GH7A 5L8NA 3I0AA 2WQAE 1RLBE 3F8AA 5CE4A 1AQBA 1NP1A 2MO5A 4NNTA 4M7MA 1I05A 4QAEA 4TKJA 5BVTA 1HBPA 5B27A 4IAWA 1CBQA 3STKA 3I17A 1LFOA 4ZJ0A 1NGLA 3CWKA 5AQ6A 1EALA 1AELA 2NNQA 3EYCA 3CQRA 2CZUA 3U0DA 4IMOA 4YFPA 1GT5A 5EZ2A 1X71A 1ADLA 1EW3A 1ZNGA 2Q39A 3D95A 4ZHDA 4RUNA 5D4AA 1ZNEA 5HZQA 4OS8A 1AVGI 4I9SA 1MUPA 5F6ZA 2L9CA 2RA6A 4I3DA 3ELXA 1XKIA 5DG4A 3BY0A 4OMXA 1BEBA 4AYHA 1ACDA 3OJYC 1G85A 4XMHA 5IO6A 4YDAA 5KICA 3DSZA 5D8JA 1CRBA 4AZNA 3PH6A 1LIBA 4UU3A 4NLIA 3T1DA 1LIDA 4LKPA 1MDCA 2JOZA 5DPQA 1QABE 4ZCBA 4ORSA 4ZHHA 1CBRA 1I06A 3CQNA 4ORXA 5C0NA 2LKKA 2W2AA 3NX1A 1KZWA 5HCEC 4YCEA 3L4RA 4WFVA 1SXYA 2FR3A 1HMSA 4LKTA 4YGHA 3B2IA 4ORRA 1U18A 4OS0A 2K23A 4I9RA 3IA8A 1DFVA 2KTDA 3BU1A 1O1VA 5LKEA 1FENA 1X8QA 1E02A 3BSZE 2BLGA 2A0AA 1YUPA 4ALOA 1LIEA 4LZUA 5L8OA 2GC9A 2A13A 3KFIA 4HPAA 1PBOA 3RZYA 2WEXA 1T8VA 1ML7A 3VG5A 1KQWA 4NYRA 3NQ9A 1A3YA 2GJ5A 2LBAA 4YDBA 2AT8X 5EDCA 2MM3A 1NP4A 3VG4A 3EBKA 2Q2PA 2QO6A 5IO5A 1CBIA 5JR8A 2N93A 2L67A 1E00A 3TGBA 4ZFXA 3STNA 3KQ0A 4GE1A 1HMTA 2HNXA 3GAQA 1SA8A 3K3LA 4YH0A 1ERBA 1X8PA 4TQ2A 1BRQA 1A57A 1X8UA 1ZNHA 3HWGA 1OPBA 3UEVA 1RBPA 3BLGA 4I3CA 2AL0X 1GKAA 5H9KA 1QFTA 3DTQA 2FR2A 2HZRA 1S7DA 2OFMX 1YIVA 4O9SA 1DZPA 2CBSA 5LJGA 1MX7A 3VG6A 2KT4B 4ZR2A 4EXZA 4YKOA 3TGCA 1G7NA 1PM1X 2R73A 3PPTA 4YGGA 4QGVA 1D2UA 2XSTA 3UEXA 2IFBA 4YCHA 3FA7A 2HZQA 2LFOA 1TOWA 3P6HA 2QO5A 4EDEA 1PEEA 1HN2A 4ALBA 1OEJA 4DQ4A 1B56A 4I3BA 1FELA 2L68A 3EBWA 4YGZA 3HWDA 2HLVA 4LZVA 1DF3A 1OBQA 4XMFA 3AKMA 2JN3A 1LF7A 4HPDA 3FLLA 1KZXA 3KFFA 3EM0A 1GX8A 1EIIA 2G7BA 3C77X 3NPOA 3NR3A 4N7DA 2AMMX 4ZHGA 1LNMA 1GKAB 5KIDA 3FR4A 3O2YA 1Z24A 4ES7A 3FEKA 1SXUA 3APWA 1ZNDA 3G7XA 1N0SA 1TVQA 2EU7X 3FMZA 2W2FA 1EPBA 2R74A 1YWBA 5F6BA 3S26A 1BWYA 1LICA 5F58A 1G5WA 1BBPA 1EXSA 2FTBA 4IB9A 1ZRYA 4OMWA 1EIOA 1IFBA 1L6MA 5F7GA 1OPAA 2O62A 4AZPA 4ZHFA 5HTDA 1BLRA 1FDQA 3QKGA 1U17A 4ZGUA 2DM5A 4MVKA 1LPJA 3PEDA 2OVEA 4QGWA 1ZNKA 2YG2A 3CBSA 4DQ3A 5LJCA 1KQXA 1JJXA 3MVFA 1ICMA 1SY0A 4QYNA 3KZAA 1FTPA 4BOEA 4MVIA 1OBUA 1BSQA 3P6EA 4TNNA 4NYQA 2F73A 3BU9A 4QZUA 1DC9A 2RQ0A 5LJKA 3KFHA 4TJZA 4HPCA 3B2KA 4IB6A 1JBHA 1IKJA 5H9AA 4N7CA 1TOUA 2QOSC 1EUOA 4KIIA 3TZSA 2NP1A 4Y0PA 2AT0X 1JJJA 5FFHA 3NADA 4IB7A 4Y0QA 2NNDA 1HBQA 2WWPA 4NNSA 2ACPX 2E4JA 3AKNA 4M6SA 2JU7A 4HPBA 4Y0SA 2FS6A 5HBSA 1I4UA 3BRNA 4TKHA 4ORUA 1EPAA 1IKEA 3ZQ3A 4XMGA 4NLJA 2AH7X 2CZTA 4OS3A 1ALBA 3JS1A 1BSYA 2LBVA 2WEWA 4XMCA 4BVMA 5LKFA 4ZHCA 1CJ5A 3MBTA 3HWEA 1FE3A 2AT5X 2L5PA 2WQ9A 4WBKA 4RUUA 3UEWA 5HTEA 1T0VA 1BJ7A 4AW8A 1I04A 1QFVA 1FEMA 2CBRA 4D6BA 1SXXA 4K19A 1UREA 3VG3A 1SY1A 4GNWA 2RCTA 1SXWA 2LB6A 2FWVA 1U0XA 2ALLX 3SAOA 1HMRA
chains in the Genus database with same CATH superfamily
2LA7A 2POAA 3WBGA 2P8GA 2GTLO 3FR5A 4AZOA 1KGLA 1GT1A 1BM5A 2X46A 2MJIA 1VYFA 1GT3A 2GTFX 4O4XA 3WJGA 1BRPA 2OL7A 2FS7A 4Z2PA 5HZ8A 3D9WA 4NP1A 1LIFA 2RTFB 1ZNLA 4A60A 1PMPA 2OVDA 2RTKA 1HQPA 4I60A 5BYPA 3FA6A 4GUZA 3RDSA 3AUMO 4YBPA 4EEJA 2WUTA 2OF8A 3C78X 3HOLA 4IBAA 4YFQA 3RBYA 2Q4NA 5EEDA 1LCWA 1GX9A 4ARHA 2OZQA 5HZ9A 2OVAA 2BSZA 3P6CA 3WJCA 1SWKA 3PH5A 4GNYA 1EQDA 5F1EA 1B4MA 1JZUA 2G78A 5L8IA 4GETA 1SLEB 5EDBA 3PECA 4TLJA 5BVSA 3RDQA 4BX7B 3V8UA 1SWNA 4I95A 3NQ3A 2FT9A 4D6AA 2OFRX 4IB8A 1UYNX 4YBUA 5K67A 1VWOB 2HMBA 2OVSA 5HZ5A 2WR6A 1GXAA 4JHQA 4BX6A 2QOMA 3VG2A 4U9CA 1H91A 1RSTB 2RTHB 1SWLA 1X8OA 3O22A 3VHMA 4CPFA 2OFAA 4Z2OA 1TXLA 4ORYA 3VGWA 1B0OA 4BGFA 3PQSA 4TKBA 4ZH9A 2W2BA 1E5PA 1OEKA 4YKMA 3ZUIA 4A8ZA 1ERXA 1VWEB 1YWDA 3B2HA 4WHIA 5FENA 4ZH6A 2BS5A 1KT7A 2AF5A 1VWDB 2QCBA 3CR6A 3WJBA 3D96A 2Q2MA 1R0UA 4BX5A 3U9PC 3B2LA 3WVMA 3BDRA 1SWQA 3FW4A 1QY0A 4GRJA 5KHPA 1QY1A 1S44A 1JYDA 3JSQA 1JV4A 5D48A 3FA9A 2RTOB 4O4UA 1YWAA 2A3FX 3ZW0A 1DZMA 4XMDA 5F2BA 3NX2A 1QQSA 1W5RA 4NV7A 3S60A 3FEPA 2IZHB 3NQKA 1XCAA 1SWBA 2FHLA 3P6DA 4MISA 4ODDA 5BVQA 2AKQA 4PJ2A 4BQUA 1LKEA 3RWXA 3T2XA 1JMZA 2HYSA 2BS6A 3NP1A 3APUA 4MVEA 1SWFA 2RTLA 1VWMB 2X56A 3C76X 3BS2A 3X00A 4O49A 3CMPA 1W6FA 1GX3A 4BX6B 1AB0A 2K62A 1SWOA 1MOYA 3P6FA 1IFCA 5FQ6E 5LJDA 1RXHA 5B11O 4EFGA 2RTCB 3UEUA 4FBVA 1MX8A 1KT5A 2CM4A 1VYOA 5D47A 1VPRA 2RTJA 2AT6X 2QMIA 3IFBA 4NW4A 5B2AO 4AZMA 2OY8A 1QG5A 5D45A 5HCDC 3Q6LA 4OEMA 1QY2A 1A18A 3FIQA 5LJEA 3FR2A 1DV9A 2ANSA 1T68X 4ORWA 5H9LA 2G79A 4IMNA 5K06A 3O19A 2GTLN 3BX8A 4GZVA 1TW4A 1RSUB 1Y55X 1SWHA 2A2GA 3FW5A 4INNA 1STPA 4A1HA 4GK9A 1DZJA 4GD9A 4R0BA 4BX5B 5HCCC 1OBPA 3T6FA 4O4SA 4HFOA 3CBCA 5LJBA 4QGXA 2CAMA 2XKLA 2X8SA 2CM9A 2PI3O 1GM6A 1B8EA 1VWCB 2RN4A 4ZGFA 5L3YA 2RTPB 3D97A 3FDCA 1S2PA 1A2DA 3FENA 1K3BA 2MWHA 4XMEA 5EEEA 1JYJA 1STSB 2RCQA 3RY1A 4AZRA 2Q9SA 1KT3A 2RTNB 2JU3A 1SMPI 2NNEA 1Y52X 2RTGB 2KTSA 3STMX 1JMXA 1SWEA 3B2JA 1VWHB 1KOIA 2IZDB 1GGLA 3HWFA 3PP6A 3WZQA 1QWDA 3WJFA 1SWUA 1X89A 4CK4A 1CBSA 1HQQA 1MM9A 4ML7B 1KT4A 4QYPA 4Y59A 5EPQA 2ZSCA 2AVIA 3WXQA 5HWZA 3PQUA 3RDOA 3SLTA 5IRUA 5FAZA 2ACOA 3F9DA 1SRGA 2WSJA 1HY2A 1D3SA 2AT3X 2KD2A 3HK1A 3EMMA 4CV7A 1JJUA 2RTMA 3VG7A 5HAEA 1YP6A 1VWLB 1YP7A 3SZJA 3WYQA 2FRSA 2QO4A 3OD9A 3FA8A 1G74A 3KFGA 3PDFA 1X8NA 1NQMA 1UZ2X 2I5VO 2IZCB 1NC9A 1O1UA 3APVA 2PY1A 1Y53X 4GJSA 4A1YA 4PSQA 3OBLA 4GKCA 4YFRA 1KXOA 4O4OA 4QRLA 3BX7A 2A2UA 5HA1A 2X32A 2RTRB 1SY3A 1ICNA 1SWPA 1BSOA 5H8TA 1DZKA 3WJEA 5AEOA 5B5FA 5IO7A 3ZUOA 1UYOX 1IIUA 2JU8A 1Y9TA 2FHNX 3FELA 4MVLA 2R56A 1SWGA 4UU2A 1IW2A 4JNJA 3TGAA 3WJDA 4QZTA 1O8VA 1YWCA 2FLJA 3RSWA 2X45A 1OEEA 4OELA 1E06A 2Y3EA 3ELZA 1IJ8A 1P6PA 1SRIA 2VFCA 2QM9A 4AZQA 2X4MA 3P24A 5HZ6A 1SY2A 3P6GA 4YMYA 5LJHA 3ZWEA 5KICA 4O3XB 2Y32A 5FQ8E 3RDXA 3APXA 1GT4A 1KT6A 2RD7C 5HA0A 5B29A 4Z6JA 3ZW2A 4CPEA 1VYGA 2ASNX 3OE3A 4Y0RA 1MVGA 1SWDA 3P02A 4GDZA 3TF6A 4KCAA 1LDOA 4WFUA 3U03A 2X55A 4GH7A 4IAXA 3RKGA 5L8NA 3I0AA 2WQAE 3RE6A 1RLBE 1SREA 3F8AA 5CE4A 5K68A 3HOEA 1AQBA 3VE2A 4KT5A 1NP1A 2MO5A 4Z2VA 4NNTA 2ALLX 1I05A 4M7MA 4QAEA 4TKJA 1SWAA 5CYBA 1HBPA 4DCBA 5B27A 5BVTA 4IAWA 1CBQA 3Q34A 1SLFB 3STKA 3I17A 2IZLB 4IABA 1LFOA 4ZJ0A 1NGLA 3CWKA 5AQ6A 2FGSA 1EALA 1RAVA 2ZAGA 2BC3A 2NNQA 2RTQB 1AELA 3EYCA 3CQRA 2CZUA 1PTSA 2G8CO 3U0DA 4IMOA 4YFPA 4BJ8A 4QQ1A 1GT5A 5EZ2A 1X71A 1ADLA 3HTYA 1DF8A 1EW3A 1ZNGA 2Q39A 3D95A 3EW2A 4RUNA 5D4AA 1ZNEA 4ZHDA 5HZQA 4OS8A 3NBXX 1AVGI 4I9SA 2YMSA 3EC5A 1MUPA 5F6ZA 2L9CA 2RA6A 4U3QA 4I3DA 1I9HA 1XKIA 3ELXA 4MIRA 5DG4A 4FBRA 3BY0A 1VWQB 3SZHA 4OMXA 3WOVA 2IZAA 1BEBA 2Y3FA 1ACDA 1VWKB 1G85A 3KVNA 3MX7A 3OJYC 2WPUA 4XMHA 2Z4IA 4YDAA 5IO6A 3DSZA 5D8JA 4NV8A 1CRBA 4AZNA 1N4JA 3PH6A 1LIBA 1AVDA 1SRFA 4UU3A 4NLIA 3T1DA 1LIDA 4LKPA 1MDCA 2JOZA 3S5VA 3VHHA 5DPQA 1LUQA 1QABE 4C5PA 4ZCBA 4ORSA 4ZHHA 2VFBA 1SLGB 1CBRA 2C1QA 1I06A 1JQPA 1KL4A 3CQNA 4ORXA 3UAQA 5C0NA 4ID2A 1SWSA 3AEHA 2LKKA 2W2AA 3NX1A 1KZWA 5HCEC 4YCEA 3L4RA 4WFVA 1SXYA 1VWPB 1HXZA 1HMSA 2FR3A 4LKTA 4YGHA 3B2IA 2Z4HA 3ZI8A 4ORRA 1U18A 4OS0A 2K23A 3CKFA 3IA8A 1DFVA 2KTDA 3BU1A 1O1VA 4I9RA 1FENA 1X8QA 1E02A 3BSZE 3JQOA 2BLGA 2A0AA 5LKEA 1YUPA 3ZW0B 1AVEA 4O3WA 4ALOA 2OY7A 1LIEA 4LZUA 5L8OA 2GC9A 2A13A 2F09A 3KFIA 4HPAA 1PBOA 3RZYA 1KL3A 2WEXA 1T8VA 2X34A 1ML7A 3VG5A 1KQWA 4NYRA 3NQ9A 1A3YA 1SWJA 4CPHA 2GJ5A 2LBAA 4YDBA 2AT8X 5EDCA 2MM3A 1VWJB 4Z28A 1OSPO 5JD2A 1NP4A 3VG4A 3EBKA 4ON1A 2Q2PA 3T6LA 3S5XA 2QO6A 5IO5A 1CBIA 5JR8A 2A8GA 2IZJA 2N93A 2L67A 4CDDA 1E00A 2C1SA 3TGBA 4FQBB 2ZAIA 4ZFXA 4KC7A 4CPIA 2OFBA 1VWIB 3VHIA 3STNA 3KQ0A 1NQNA 3ZZVA 4GE1A 1HMTA 2HNXA 5H9NA 3GAQA 2IZIA 1LELA 1SA8A 3K3LA 4YH0A 1ERBA 1X8PA 1WUBA 2UZ2A 4TQ2A 1BRQA 4KH8A 1A57A 1WBIA 1SRJA 4KC8A 1X8UA 1ZNHA 3HWGA 1OPBA 2IZBA 1MK5A 1RBPA 2JMBA 3N91A 3BLGA 4I3CA 3UEVA 1K24A 3FIDA 2AL0X 1GKAA 3PK2A 5H9KA 1QFTA 2IZEB 3DTQA 2FR2A 1STRB 2RTDB 2HZRA 3RY2A 4YVBA 1VWAB 4QNIA 4O3ZA 1S7DA 2OFMX 2IZFB 4BBOA 1YIVA 4O9SA 1LCZA 4GU8A 1DZPA 2CBSA 5LJGA 1MX7A 4OKAA 3SOTA 2KT4B 4GDAA 4Y5DA 3VG6A 4ZR2A 4EXZA 4YKOA 3TGCA 1G7NA 1PM1X 2R73A 1MEPA 3PPTA 3FYFA 1D2UA 4YGGA 2XSTA 3UEXA 2G5LA 4CPHB 4QGVA 1EI5A 2IFBA 2RTEB 4YCHA 4GJVA 5IXGA 3FA7A 4HWMA 2HZQA 2LFOA 1TOWA 3P6HA 2QO5A 3RDUA 4EDEA 1PEEA 3WZOA 1RXJA 1HN2A 4GGTA 4ALBA 2FKJA 1OEJA 4COTA 2JGSA 4U8UM 3GE2A 4DQ4A 1B56A 4I3BA 1FELA 2L68A 3EBWA 4YGZA 1SWRA 3HWDA 5IRWA 4GGRA 1VWGB 2HLVA 4LZVA 3H3IA 1DF3A 1OBQA 4XMFA 4EQAC 3AKMA 2JN3A 1LF7A 4HPDA 3FLLA 1KZXA 4I6SA 3KFFA 3D4RA 3EM0A 1JIWI 1Y9LA 3E3CA 1N43A 1GX8A 1EIIA 2DJGA 2G7BA 3C77X 3NPOA 4MEEA 3NR3A 5FQ7E 3MG5A 4N7DA 2AMMX 2RTBB 4ZHGA 1N9MA 4CDFA 1LNMA 1GKAB 5KIDA 3FR4A 3O2YA 2BHVA 5CSEA 1Z24A 2X8FA 3SZIA 3WZPA 2MF6A 4ES7A 3FEKA 1SXUA 3APWA 2GTLM 2X8TA 4O3YA 1ZNDA 3G7XA 2HKDA 4CDEA 1N0SA 1TVQA 3WYPA 2EU7X 3FMZA 2W2FA 5IRAA 2KW1A 1EPBA 2R74A 1YWBA 4FGIB 5F6BA 5B10O 3S26A 3VPJE 4Z27A 1BWYA 1LICA 5F58A 1G5WA 1FJ1E 2M4LA 1BBPA 1EXSA 2FTBA 4IB9A 1ZRYA 4GGZA 4OMWA 1EIOA 2RTAA 1IFBA 4BCSA 1L6MA 2RTIB 5F7GA 1OPAA 2O62A 4JGLA 4AZPA 4ZHFA 5HTDA 1BLRA 1RXKA 1FDQA 3QKGA 4EKVA 1U17A 4ZGUA 2DM5A 4MVKA 1LPJA 3T2WA 3PEDA 2OVEA 2A5BA 4QGWA 1ZNKA 2YG2A 3CBSA 5B5GA 3VE1A 4DQ3A 5LJCA 1KQXA 1JJXA 1LDQA 3MVFA 1NDJA 1ICMA 2MHDA 1SY0A 4QYNA 3CKGA 4CDCA 5AJCA 2A5CA 2IZKA 1FTPA 3KZAA 4U8UN 5B3MO 3EW1A 4MVIA 4BOEA 1OBUA 2UYWA 1BSQA 3P6EA 3ZW1A 2VDFA 4TNNA 4L3RA 4NYQA 2F73A 1W4TA 1Y0GA 3BU9A 1DC9A 4QZUA 1I78A 4B55A 2RQ0A 4CSBA 3KFHA 3VU1A 4TJZA 5LJKA 1SWCA 4HPCA 3B2KA 4IB6A 4U46A 2OL6O 2DJFA 1JBHA 2OF9A 4DNEA 1IKJA 5H9AA 4AYHA 4N7CA 1NBXA 3WZNA 3LHNA 3RE5A 1SRHA 1TOUA 3LTWA 2QOSC 1EUOA 4KIIA 2OYBO 1VWFB 2NP1A 4Y0PA 3TZSA 4FBOA 2AT0X 1JJJA 5FFHA 3NADA 4IB7A 4Y0QA 1E2TA 2NNDA 3F6ZB 2FKGA 2WWPA 3LV4A 1VWBB 2ACPX 2E4JA 4NNSA 4L1NA 3AKNA 4M6SA 2JU7A 4HPBA 4Y0SA 2FS6A 1VWNB 5HBSA 1I4UA 3BRNA 4IRWA 4TKHA 4ORUA 3RDMA 2C4IA 1EPAA 3SLJA 1IKEA 3ZQ3A 2F01A 2OL8O 4XMGA 2IZGB 2OY1O 4NLJA 2AH7X 2CZTA 4OS3A 1KFFA 1ALBA 3JS1A 4U8UO 3HPEA 1BSYA 2LBVA 4LQZA 5CHKA 2GH7A 1N7YA 2WEWA 1N9YA 4XMCA 5LKFA 4BVMA 4ZHCA 1CJ5A 3MBTA 3HWEA 1FE3A 3MM0A 1SWTA 2AT5X 5AJBA 2L5PA 2WQ9A 4WBKA 4RUUA 3UEWA 5HTEA 3ZW1B 4JO6A 3QQ2A 1T0VA 1BJ7A 4AW8A 1I04A 1QFVA 1FEMA 2CBRA 4BX7A 1VWRB 1SXXA 2JW1A 3SLOA 4D6BA 1HXLA 1KL5A 2BT9A 1UREA 4K19A 3VG3A 1SY1A 1LCVA 2I5ZO 4GNWA 2OY5O 1SLDB 2RCTA 1PBYA 1SXWA 2LB6A 2FWVA 1U0XA 1HBQA 3SAOA 1HMRA
chains in the Genus database with same CATH topology
2LA7A 2POAA 3WBGA 2P8GA 2GTLO 3FR5A 4AZOA 1KGLA 1GT1A 1BM5A 2X46A 2MJIA 1VYFA 1GT3A 2GTFX 4O4XA 3WJGA 1BRPA 5HZ8A 2FS7A 4NP1A 1LIFA 1ZNLA 4A60A 1PMPA 2OVDA 1HQPA 5BYPA 3FA6A 4YBPA 4EEJA 2WUTA 3HOLA 3C78X 4IBAA 3RBYA 4YFQA 2Q4NA 5EEDA 1GX9A 4ARHA 2OZQA 5HZ9A 2OVAA 3P6CA 3WJCA 3PH5A 4GNYA 1EQDA 5F1EA 1B4MA 1JZUA 2G78A 5L8IA 4GETA 5EDBA 3PECA 4TLJA 5BVSA 3V8UA 4I95A 3NQ3A 2FT9A 4D6AA 2OFRX 4IB8A 4YBUA 2HMBA 2OVSA 5HZ5A 2WR6A 1GXAA 3VG2A 4U9CA 1H91A 3O22A 1X8OA 1TXLA 4ORYA 1B0OA 3PQSA 4TKBA 4ZH9A 2W2BA 1E5PA 1OEKA 4YKMA 3ZUIA 4A8ZA 1ERXA 1YWDA 3B2HA 4WHIA 5FENA 4ZH6A 2BS5A 1KT7A 3CR6A 3WJBA 3D96A 2Q2MA 1R0UA 3U9PC 3B2LA 3WVMA 3BDRA 3FW4A 1QY0A 4GRJA 5KHPA 1QY1A 1S44A 1JYDA 3JSQA 1JV4A 5D48A 3FA9A 4O4UA 1YWAA 2A3FX 3ZW0A 1DZMA 4XMDA 3NX2A 1QQSA 3S60A 3FEPA 3NQKA 3P6DA 1XCAA 5BVQA 4MISA 4ODDA 2AKQA 4PJ2A 4BQUA 1LKEA 3RWXA 2HYSA 2BS6A 3NP1A 3APUA 4MVEA 3C76X 3BS2A 4O49A 3CMPA 1AB0A 2K62A 3P6FA 5FQ6E 1IFCA 5LJDA 4EFGA 3UEUA 4FBVA 1MX8A 1KT5A 2CM4A 5D47A 1VPRA 2AT6X 2QMIA 3IFBA 4NW4A 4AZMA 1QG5A 5D45A 5HCDC 3Q6LA 1QY2A 1A18A 3FIQA 5LJEA 3FR2A 1DV9A 2ANSA 1T68X 4ORWA 5H9LA 2G79A 4IMNA 5K06A 3O19A 2GTLN 3BX8A 4GZVA 1TW4A 2A2GA 3FW5A 4INNA 5HCCC 4A1HA 4GK9A 1DZJA 4R0BA 1OBPA 4O4SA 4HFOA 3CBCA 5LJBA 4QGXA 2XKLA 2X8SA 2CM9A 1GM6A 1B8EA 2RN4A 4ZGFA 3D97A 3FENA 1S2PA 1A2DA 4XMEA 2MWHA 5EEEA 1JYJA 2RCQA 4AZRA 2Q9SA 1KT3A 2JU3A 1SMPI 2NNEA 2KTSA 3STMX 3B2JA 1KOIA 1GGLA 3HWFA 3PP6A 1QWDA 3WJFA 4CK4A 1X89A 1CBSA 4ML7B 1KT4A 4QYPA 5EPQA 3WXQA 5HWZA 3PQUA 5FAZA 2ACOA 3F9DA 5H9NA 2WSJA 2AT3X 1D3SA 2KD2A 3HK1A 3EMMA 4CV7A 3VG7A 5HAEA 1YP6A 1YP7A 2FRSA 2QO4A 3OD9A 3FA8A 1G74A 3KFGA 1X8NA 1UZ2X 1O1UA 3APVA 2PY1A 4A1YA 4PSQA 3OBLA 4GKCA 4YFRA 1KXOA 4O4OA 4QRLA 3BX7A 2A2UA 5HA1A 1SY3A 1ICNA 1BSOA 5H8TA 1DZKA 3WJEA 5AEOA 5IO7A 3ZUOA 2JU8A 1IIUA 1Y9TA 3FELA 4MVLA 2R56A 4UU2A 3TGAA 1IW2A 3WJDA 4QZTA 1O8VA 1YWCA 2FLJA 3RSWA 2X45A 1OEEA 1E06A 3ELZA 1P6PA 4AZQA 2QM9A 3P24A 5HZ6A 1SY2A 3P6GA 4YMYA 5LJHA 3ZWEA 4O3XB 5FQ8E 3APXA 1GT4A 1KT6A 2RD7C 5HA0A 5B29A 3ZW2A 1VYGA 2ASNX 3OE3A 4Y0RA 1MVGA 3P02A 4GDZA 3TF6A 4KCAA 4WFUA 3U03A 4IAXA 4GH7A 3RKGA 5L8NA 3I0AA 2WQAE 1RLBE 3F8AA 5CE4A 3VE2A 3HOEA 1AQBA 4KT5A 1NP1A 2MO5A 4NNTA 4M7MA 1I05A 4QAEA 4TKJA 5CYBA 5BVTA 1HBPA 5B27A 4IAWA 1CBQA 3STKA 3I17A 4IABA 1LFOA 4ZJ0A 1NGLA 3CWKA 5AQ6A 1EALA 1AELA 2ZAGA 2NNQA 3EYCA 3CQRA 2CZUA 3U0DA 4IMOA 4YFPA 4QQ1A 1GT5A 5EZ2A 1X71A 1ADLA 3HTYA 1EW3A 1ZNGA 2Q39A 3D95A 4ZHDA 4RUNA 5D4AA 1ZNEA 5HZQA 4OS8A 3NBXX 1AVGI 4I9SA 2YMSA 1MUPA 5F6ZA 2L9CA 2RA6A 4U3QA 4I3DA 3ELXA 1XKIA 4MIRA 5DG4A 4FBRA 3BY0A 4OMXA 3WOVA 1BEBA 4AYHA 1ACDA 3OJYC 1G85A 4XMHA 3MX7A 4YDAA 5IO6A 5KICA 2Z4IA 3DSZA 5D8JA 1CRBA 4AZNA 3PH6A 1LIBA 4UU3A 4NLIA 3T1DA 1LIDA 4LKPA 1MDCA 2JOZA 3S5VA 5DPQA 1QABE 4ZCBA 4ORSA 4ZHHA 1CBRA 1I06A 3CQNA 4ORXA 3UAQA 5C0NA 4ID2A 2LKKA 2W2AA 3NX1A 1KZWA 5HCEC 4YCEA 3L4RA 4WFVA 1SXYA 2FR3A 1HMSA 4LKTA 4YGHA 3B2IA 2Z4HA 3ZI8A 4ORRA 1U18A 4OS0A 2K23A 4I9RA 3IA8A 1DFVA 2KTDA 3BU1A 1O1VA 5LKEA 1FENA 1X8QA 1E02A 3BSZE 3JQOA 2BLGA 2A0AA 1YUPA 3ZW0B 4O3WA 4ALOA 1LIEA 4LZUA 5L8OA 2GC9A 2A13A 2F09A 3KFIA 4HPAA 1PBOA 3RZYA 2WEXA 1T8VA 1ML7A 3VG5A 1KQWA 4NYRA 3NQ9A 1A3YA 2GJ5A 2LBAA 4YDBA 2AT8X 5EDCA 2MM3A 1NP4A 3VG4A 3EBKA 4ON1A 2Q2PA 3S5XA 2QO6A 5IO5A 1CBIA 5JR8A 2N93A 2L67A 1E00A 3TGBA 4FQBB 2ZAIA 4ZFXA 4KC7A 3STNA 3KQ0A 3ZZVA 4GE1A 1HMTA 2HNXA 3GAQA 1SA8A 3K3LA 4YH0A 1ERBA 1X8PA 4TQ2A 1BRQA 4KH8A 1A57A 4KC8A 1X8UA 1ZNHA 3HWGA 1OPBA 3UEVA 1RBPA 2JMBA 3N91A 3BLGA 4I3CA 2AL0X 1GKAA 5H9KA 1QFTA 3DTQA 2FR2A 2HZRA 4QNIA 4O3ZA 1S7DA 2OFMX 1YIVA 4O9SA 4GU8A 1DZPA 2CBSA 5LJGA 1MX7A 3VG6A 3SOTA 2KT4B 4ZR2A 4EXZA 4YKOA 3TGCA 1G7NA 1PM1X 2R73A 3PPTA 4YGGA 3FYFA 1D2UA 4QGVA 2XSTA 3UEXA 1EI5A 2IFBA 4YCHA 3FA7A 4HWMA 2HZQA 2LFOA 1TOWA 3P6HA 2QO5A 4EDEA 1PEEA 1HN2A 4ALBA 1OEJA 4COTA 4U8UM 3GE2A 4DQ4A 1B56A 4I3BA 1FELA 2L68A 3EBWA 4YGZA 3HWDA 2HLVA 4LZVA 3H3IA 1DF3A 1OBQA 4XMFA 4EQAC 3AKMA 2JN3A 1LF7A 4HPDA 3FLLA 1KZXA 4I6SA 3KFFA 3D4RA 3EM0A 1JIWI 1Y9LA 3E3CA 1GX8A 1EIIA 2G7BA 3C77X 3NPOA 3NR3A 5FQ7E 4N7DA 2AMMX 4ZHGA 1LNMA 1GKAB 5KIDA 3FR4A 3O2YA 2BHVA 1Z24A 2X8FA 4ES7A 3FEKA 1SXUA 3APWA 2GTLM 2X8TA 4O3YA 1ZNDA 3G7XA 1N0SA 1TVQA 2EU7X 3FMZA 2W2FA 2KW1A 1EPBA 2R74A 1YWBA 4FGIB 5F6BA 3S26A 3VPJE 1BWYA 1LICA 5F58A 1G5WA 2M4LA 1BBPA 1EXSA 2FTBA 4IB9A 1ZRYA 4OMWA 1EIOA 1IFBA 1L6MA 5F7GA 1OPAA 2O62A 4JGLA 4AZPA 4ZHFA 5HTDA 1BLRA 1FDQA 3QKGA 1U17A 4ZGUA 2DM5A 4MVKA 1LPJA 3PEDA 2OVEA 4QGWA 1ZNKA 2YG2A 3CBSA 3VE1A 4DQ3A 5LJCA 1KQXA 1JJXA 3MVFA 1ICMA 2MHDA 1SY0A 4QYNA 5AJCA 3KZAA 1FTPA 4U8UN 4BOEA 4MVIA 1OBUA 1BSQA 3P6EA 3ZW1A 4TNNA 4L3RA 4NYQA 2F73A 3BU9A 4QZUA 1DC9A 4CSBA 2RQ0A 5LJKA 3KFHA 3VU1A 4TJZA 4HPCA 3B2KA 4IB6A 1JBHA 1IKJA 5H9AA 4N7CA 3LHNA 1TOUA 2QOSC 1EUOA 4KIIA 3TZSA 2NP1A 4Y0PA 4FBOA 2AT0X 1JJJA 5FFHA 3NADA 4IB7A 4Y0QA 2NNDA 3F6ZB 1HBQA 2WWPA 3LV4A 4NNSA 2ACPX 2E4JA 4L1NA 3AKNA 4M6SA 2JU7A 4HPBA 4Y0SA 2FS6A 5HBSA 1I4UA 3BRNA 4TKHA 4ORUA 1EPAA 1IKEA 3ZQ3A 4XMGA 4NLJA 2AH7X 2CZTA 4OS3A 1ALBA 3JS1A 4U8UO 1BSYA 2LBVA 4LQZA 2WEWA 4XMCA 4BVMA 5LKFA 4ZHCA 1CJ5A 3MBTA 3HWEA 1FE3A 5AJBA 2AT5X 2L5PA 2WQ9A 4WBKA 4RUUA 3UEWA 5HTEA 3ZW1B 1T0VA 1BJ7A 4AW8A 1I04A 1QFVA 1FEMA 2CBRA 4D6BA 2JW1A 1SXXA 2BT9A 4K19A 1UREA 3VG3A 1SY1A 4GNWA 2RCTA 1SXWA 2LB6A 2FWVA 1U0XA 2ALLX 3SAOA 1HMRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2POA A;  3WBG A;  2P8G A;  3FR5 A;  4AZO A;  1KGL A;  1GT1 A;  1BM5 A;  2X46 A;  2MJI A;  1VYF A;  1GT3 A;  2GTF X;  3WJG A;  1BRP A;  5HZ8 A;  2FS7 A;  4NP1 A;  1LIF A;  1ZNL A;  4A60 A;  1PMP A;  2OVD A;  1HQP A;  3FA6 A;  4YBP A;  4EEJ A;  2WUT A;  4IBA A;  3C78 X;  4YFQ A;  2Q4N A;  5EED A;  1GX9 A;  4ARH A;  2OZQ A;  5HZ9 A;  2OVA A;  3P6C A;  3WJC A;  3PH5 A;  4GNY A;  1EQD A;  5F1E A;  1B4M A;  1JZU A;  2G78 A;  5L8I A;  4GET A;  5EDB A;  3PEC A;  4TLJ A;  5BVS A;  3NQ3 A;  2FT9 A;  4D6A A;  2OFR X;  4IB8 A;  4YBU A;  2HMB A;  5HZ5 A;  2WR6 A;  1GXA A;  3VG2 A;  1H91 A;  3O22 A;  1X8O A;  1TXL A;  4ORY A;  1B0O A;  4TKB A;  4ZH9 A;  2W2B A;  1E5P A;  1OEK A;  4YKM A;  3ZUI A;  4A8Z A;  1ERX A;  1YWD A;  3B2H A;  5FEN A;  4ZH6 A;  1KT7 A;  3CR6 A;  3WJB A;  3D96 A;  2Q2M A;  1R0U A;  3U9P C;  3B2L A;  3WVM A;  3BDR A;  3FW4 A;  1QY0 A;  4GRJ A;  5KHP A;  1QY1 A;  1S44 A;  1JYD A;  3JSQ A;  1JV4 A;  5D48 A;  3FA9 A;  1YWA A;  2A3F X;  1DZM A;  4XMD A;  3NX2 A;  1QQS A;  3FEP A;  3P6D A;  5BVQ A;  1XCA A;  4ODD A;  2AKQ A;  4BQU A;  1LKE A;  2HYS A;  3NP1 A;  3APU A;  3C76 X;  3BS2 A;  3CMP A;  1AB0 A;  2K62 A;  3P6F A;  5LJD A;  1IFC A;  4EFG A;  3UEU A;  1MX8 A;  1KT5 A;  2CM4 A;  5D47 A;  1VPR A;  2AT6 X;  3IFB A;  4AZM A;  1QG5 A;  5D45 A;  5HCD C;  3Q6L A;  1QY2 A;  1A18 A;  3FIQ A;  5LJE A;  3FR2 A;  1DV9 A;  2ANS A;  1T68 X;  4ORW A;  5H9L A;  2G79 A;  4IMN A;  5K06 A;  3O19 A;  3BX8 A;  1TW4 A;  2A2G A;  3FW5 A;  5HCC C;  4A1H A;  4R0B A;  1DZJ A;  1OBP A;  4HFO A;  3CBC A;  5LJB A;  4QGX A;  2XKL A;  2CM9 A;  1GM6 A;  1B8E A;  3D97 A;  3FEN A;  1S2P A;  1A2D A;  4XME A;  5EEE A;  1JYJ A;  2RCQ A;  4AZR A;  2Q9S A;  1KT3 A;  2JU3 A;  2NNE A;  3STM X;  3B2J A;  1KOI A;  1GGL A;  3HWF A;  3PP6 A;  1QWD A;  3WJF A;  4CK4 A;  1X89 A;  1CBS A;  1KT4 A;  4QYP A;  5EPQ A;  3WXQ A;  5HWZ A;  5FAZ A;  2ACO A;  3F9D A;  5H9N A;  2WSJ A;  2AT3 X;  1D3S A;  3HK1 A;  3EMM A;  3VG7 A;  5HAE A;  1YP6 A;  1YP7 A;  2FRS A;  2QO4 A;  3FA8 A;  1G74 A;  3KFG A;  1X8N A;  1UZ2 X;  1O1U A;  3APV A;  2PY1 A;  4A1Y A;  4PSQ A;  4GKC A;  4YFR A;  1KXO A;  3BX7 A;  2A2U A;  5HA1 A;  1SY3 A;  1ICN A;  1BSO A;  5H8T A;  1DZK A;  3WJE A;  5IO7 A;  3ZUO A;  2JU8 A;  1IIU A;  3FEL A;  4MVL A;  2R56 A;  4UU2 A;  3TGA A;  1IW2 A;  3WJD A;  4QZT A;  1O8V A;  1YWC A;  2FLJ A;  3RSW A;  2X45 A;  1OEE A;  1E06 A;  3ELZ A;  1P6P A;  4AZQ A;  2QM9 A;  5HZ6 A;  1SY2 A;  3P6G A;  4YMY A;  5LJH A;  3APX A;  1GT4 A;  1KT6 A;  2RD7 C;  5HA0 A;  5B29 A;  1VYG A;  2ASN X;  4Y0R A;  1MVG A;  3TF6 A;  4WFU A;  3U03 A;  4IAX A;  4GH7 A;  5L8N A;  3I0A A;  2WQA E;  1RLB E;  3F8A A;  5CE4 A;  1AQB A;  1NP1 A;  2MO5 A;  4NNT A;  4M7M A;  1I05 A;  4QAE A;  4TKJ A;  5BVT A;  1HBP A;  5B27 A;  4IAW A;  1CBQ A;  3STK A;  3I17 A;  1LFO A;  4ZJ0 A;  1NGL A;  3CWK A;  5AQ6 A;  1EAL A;  1AEL A;  2NNQ A;  3EYC A;  3CQR A;  2CZU A;  3U0D A;  4IMO A;  4YFP A;  1GT5 A;  5EZ2 A;  1X71 A;  1ADL A;  1EW3 A;  1ZNG A;  2Q39 A;  3D95 A;  4ZHD A;  4RUN A;  5D4A A;  1ZNE A;  5HZQ A;  4OS8 A;  1AVG I;  4I9S A;  1MUP A;  5F6Z A;  2L9C A;  2RA6 A;  4I3D A;  3ELX A;  1XKI A;  5DG4 A;  3BY0 A;  4OMX A;  1BEB A;  4AYH A;  1ACD A;  3OJY C;  1G85 A;  4XMH A;  5IO6 A;  4YDA A;  5KIC A;  3DSZ A;  5D8J A;  1CRB A;  4AZN A;  3PH6 A;  1LIB A;  4UU3 A;  4NLI A;  3T1D A;  1LID A;  4LKP A;  1MDC A;  2JOZ A;  5DPQ A;  1QAB E;  4ZCB A;  4ORS A;  4ZHH A;  1CBR A;  1I06 A;  3CQN A;  4ORX A;  5C0N A;  2LKK A;  2W2A A;  3NX1 A;  1KZW A;  5HCE C;  4YCE A;  3L4R A;  4WFV A;  1SXY A;  2FR3 A;  1HMS A;  4LKT A;  4YGH A;  3B2I A;  4ORR A;  1U18 A;  4OS0 A;  2K23 A;  4I9R A;  3IA8 A;  1DFV A;  2KTD A;  3BU1 A;  1O1V A;  5LKE A;  1FEN A;  1X8Q A;  1E02 A;  3BSZ E;  2BLG A;  2A0A A;  1YUP A;  4ALO A;  1LIE A;  4LZU A;  5L8O A;  2GC9 A;  2A13 A;  3KFI A;  4HPA A;  1PBO A;  3RZY A;  2WEX A;  1T8V A;  1ML7 A;  3VG5 A;  1KQW A;  4NYR A;  3NQ9 A;  1A3Y A;  2GJ5 A;  2LBA A;  4YDB A;  2AT8 X;  5EDC A;  2MM3 A;  1NP4 A;  3VG4 A;  3EBK A;  2Q2P A;  2QO6 A;  5IO5 A;  1CBI A;  5JR8 A;  2N93 A;  2L67 A;  1E00 A;  3TGB A;  4ZFX A;  3STN A;  3KQ0 A;  4GE1 A;  1HMT A;  2HNX A;  3GAQ A;  1SA8 A;  3K3L A;  4YH0 A;  1ERB A;  1X8P A;  4TQ2 A;  1BRQ A;  1A57 A;  1X8U A;  1ZNH A;  3HWG A;  1OPB A;  3UEV A;  1RBP A;  3BLG A;  4I3C A;  2AL0 X;  1GKA A;  5H9K A;  1QFT A;  3DTQ A;  2FR2 A;  2HZR A;  1S7D A;  2OFM X;  1YIV A;  4O9S A;  1DZP A;  2CBS A;  5LJG A;  1MX7 A;  3VG6 A;  2KT4 B;  4ZR2 A;  4EXZ A;  4YKO A;  3TGC A;  1G7N A;  1PM1 X;  2R73 A;  3PPT A;  4YGG A;  4QGV A;  1D2U A;  2XST A;  3UEX A;  2IFB A;  4YCH A;  3FA7 A;  2HZQ A;  2LFO A;  1TOW A;  3P6H A;  2QO5 A;  4EDE A;  1PEE A;  1HN2 A;  4ALB A;  1OEJ A;  4DQ4 A;  1B56 A;  4I3B A;  1FEL A;  2L68 A;  3EBW A;  4YGZ A;  3HWD A;  2HLV A;  4LZV A;  1DF3 A;  1OBQ A;  4XMF A;  3AKM A;  2JN3 A;  1LF7 A;  4HPD A;  3FLL A;  1KZX A;  3KFF A;  3EM0 A;  1GX8 A;  1EII A;  2G7B A;  3C77 X;  3NPO A;  3NR3 A;  4N7D A;  2AMM X;  4ZHG A;  1LNM A;  1GKA B;  5KID A;  3FR4 A;  3O2Y A;  1Z24 A;  4ES7 A;  3FEK A;  1SXU A;  3APW A;  1ZND A;  3G7X A;  1N0S A;  1TVQ A;  2EU7 X;  3FMZ A;  2W2F A;  1EPB A;  2R74 A;  1YWB A;  5F6B A;  3S26 A;  1BWY A;  1LIC A;  5F58 A;  1G5W A;  1BBP A;  1EXS A;  2FTB A;  4IB9 A;  1ZRY A;  4OMW A;  1EIO A;  1IFB A;  1L6M A;  5F7G A;  1OPA A;  2O62 A;  4AZP A;  4ZHF A;  5HTD A;  1BLR A;  1FDQ A;  3QKG A;  1U17 A;  4ZGU A;  2DM5 A;  4MVK A;  1LPJ A;  3PED A;  2OVE A;  4QGW A;  1ZNK A;  2YG2 A;  3CBS A;  4DQ3 A;  5LJC A;  1KQX A;  1JJX A;  3MVF A;  1ICM A;  1SY0 A;  4QYN A;  3KZA A;  1FTP A;  4BOE A;  4MVI A;  1OBU A;  1BSQ A;  3P6E A;  4TNN A;  4NYQ A;  2F73 A;  3BU9 A;  4QZU A;  1DC9 A;  2RQ0 A;  5LJK A;  3KFH A;  4TJZ A;  4HPC A;  3B2K A;  4IB6 A;  1JBH A;  1IKJ A;  5H9A A;  4N7C A;  1TOU A;  2QOS C;  1EUO A;  4KII A;  3TZS A;  2NP1 A;  4Y0P A;  2AT0 X;  1JJJ A;  5FFH A;  3NAD A;  4IB7 A;  4Y0Q A;  2NND A;  1HBQ A;  2WWP A;  4NNS A;  2ACP X;  2E4J A;  3AKN A;  4M6S A;  2JU7 A;  4HPB A;  4Y0S A;  2FS6 A;  5HBS A;  1I4U A;  3BRN A;  4TKH A;  4ORU A;  1EPA A;  1IKE A;  3ZQ3 A;  4XMG A;  4NLJ A;  2AH7 X;  2CZT A;  4OS3 A;  1ALB A;  3JS1 A;  1BSY A;  2LBV A;  2WEW A;  4XMC A;  4BVM A;  5LKF A;  4ZHC A;  1CJ5 A;  3MBT A;  3HWE A;  1FE3 A;  2AT5 X;  2L5P A;  2WQ9 A;  4WBK A;  4RUU A;  3UEW A;  5HTE A;  1T0V A;  1BJ7 A;  4AW8 A;  1I04 A;  1QFV A;  1FEM A;  2CBR A;  4D6B A;  1SXX A;  4K19 A;  1URE A;  3VG3 A;  1SY1 A;  4GNW A;  2RCT A;  1SXW A;  2LB6 A;  2FWV A;  1U0X A;  2ALL X;  3SAO A;  1HMR A; 
#chains in the Genus database with same CATH topology
 2LA7 A;  2POA A;  3WBG A;  2P8G A;  2GTL O;  3FR5 A;  4AZO A;  1KGL A;  1GT1 A;  1BM5 A;  2X46 A;  2MJI A;  1VYF A;  1GT3 A;  2GTF X;  4O4X A;  3WJG A;  1BRP A;  2OL7 A;  2FS7 A;  4Z2P A;  5HZ8 A;  3D9W A;  4NP1 A;  1LIF A;  2RTF B;  1ZNL A;  4A60 A;  1PMP A;  2OVD A;  2RTK A;  1HQP A;  4I60 A;  5BYP A;  3FA6 A;  4GUZ A;  3RDS A;  3AUM O;  4YBP A;  4EEJ A;  2WUT A;  2OF8 A;  3C78 X;  3HOL A;  4IBA A;  4YFQ A;  3RBY A;  2Q4N A;  5EED A;  1LCW A;  1GX9 A;  4ARH A;  2OZQ A;  5HZ9 A;  2OVA A;  2BSZ A;  3P6C A;  3WJC A;  1SWK A;  3PH5 A;  4GNY A;  1EQD A;  5F1E A;  1B4M A;  1JZU A;  2G78 A;  5L8I A;  4GET A;  1SLE B;  5EDB A;  3PEC A;  4TLJ A;  5BVS A;  3RDQ A;  4BX7 B;  3V8U A;  1SWN A;  4I95 A;  3NQ3 A;  2FT9 A;  4D6A A;  2OFR X;  4IB8 A;  1UYN X;  4YBU A;  5K67 A;  1VWO B;  2HMB A;  2OVS A;  5HZ5 A;  2WR6 A;  1GXA A;  4JHQ A;  4BX6 A;  2QOM A;  3VG2 A;  4U9C A;  1H91 A;  1RST B;  2RTH B;  1SWL A;  1X8O A;  3O22 A;  3VHM A;  4CPF A;  2OFA A;  4Z2O A;  1TXL A;  4ORY A;  3VGW A;  1B0O A;  4BGF A;  3PQS A;  4TKB A;  4ZH9 A;  2W2B A;  1E5P A;  1OEK A;  4YKM A;  3ZUI A;  4A8Z A;  1ERX A;  1VWE B;  1YWD A;  3B2H A;  4WHI A;  5FEN A;  4ZH6 A;  2BS5 A;  1KT7 A;  2AF5 A;  1VWD B;  2QCB A;  3CR6 A;  3WJB A;  3D96 A;  2Q2M A;  1R0U A;  4BX5 A;  3U9P C;  3B2L A;  3WVM A;  3BDR A;  1SWQ A;  3FW4 A;  1QY0 A;  4GRJ A;  5KHP A;  1QY1 A;  1S44 A;  1JYD A;  3JSQ A;  1JV4 A;  5D48 A;  3FA9 A;  2RTO B;  4O4U A;  1YWA A;  2A3F X;  3ZW0 A;  1DZM A;  4XMD A;  5F2B A;  3NX2 A;  1QQS A;  1W5R A;  4NV7 A;  3S60 A;  3FEP A;  2IZH B;  3NQK A;  1XCA A;  1SWB A;  2FHL A;  3P6D A;  4MIS A;  4ODD A;  5BVQ A;  2AKQ A;  4PJ2 A;  4BQU A;  1LKE A;  3RWX A;  3T2X A;  1JMZ A;  2HYS A;  2BS6 A;  3NP1 A;  3APU A;  4MVE A;  1SWF A;  2RTL A;  1VWM B;  2X56 A;  3C76 X;  3BS2 A;  3X00 A;  4O49 A;  3CMP A;  1W6F A;  1GX3 A;  4BX6 B;  1AB0 A;  2K62 A;  1SWO A;  1MOY A;  3P6F A;  1IFC A;  5FQ6 E;  5LJD A;  1RXH A;  5B11 O;  4EFG A;  2RTC B;  3UEU A;  4FBV A;  1MX8 A;  1KT5 A;  2CM4 A;  1VYO A;  5D47 A;  1VPR A;  2RTJ A;  2AT6 X;  2QMI A;  3IFB A;  4NW4 A;  5B2A O;  4AZM A;  2OY8 A;  1QG5 A;  5D45 A;  5HCD C;  3Q6L A;  4OEM A;  1QY2 A;  1A18 A;  3FIQ A;  5LJE A;  3FR2 A;  1DV9 A;  2ANS A;  1T68 X;  4ORW A;  5H9L A;  2G79 A;  4IMN A;  5K06 A;  3O19 A;  2GTL N;  3BX8 A;  4GZV A;  1TW4 A;  1RSU B;  1Y55 X;  1SWH A;  2A2G A;  3FW5 A;  4INN A;  1STP A;  4A1H A;  4GK9 A;  1DZJ A;  4GD9 A;  4R0B A;  4BX5 B;  5HCC C;  1OBP A;  3T6F A;  4O4S A;  4HFO A;  3CBC A;  5LJB A;  4QGX A;  2CAM A;  2XKL A;  2X8S A;  2CM9 A;  2PI3 O;  1GM6 A;  1B8E A;  1VWC B;  2RN4 A;  4ZGF A;  5L3Y A;  2RTP B;  3D97 A;  3FDC A;  1S2P A;  1A2D A;  3FEN A;  1K3B A;  2MWH A;  4XME A;  5EEE A;  1JYJ A;  1STS B;  2RCQ A;  3RY1 A;  4AZR A;  2Q9S A;  1KT3 A;  2RTN B;  2JU3 A;  1SMP I;  2NNE A;  1Y52 X;  2RTG B;  2KTS A;  3STM X;  1JMX A;  1SWE A;  3B2J A;  1VWH B;  1KOI A;  2IZD B;  1GGL A;  3HWF A;  3PP6 A;  3WZQ A;  1QWD A;  3WJF A;  1SWU A;  1X89 A;  4CK4 A;  1CBS A;  1HQQ A;  1MM9 A;  4ML7 B;  1KT4 A;  4QYP A;  4Y59 A;  5EPQ A;  2ZSC A;  2AVI A;  3WXQ A;  5HWZ A;  3PQU A;  3RDO A;  3SLT A;  5IRU A;  5FAZ A;  2ACO A;  3F9D A;  1SRG A;  2WSJ A;  1HY2 A;  1D3S A;  2AT3 X;  2KD2 A;  3HK1 A;  3EMM A;  4CV7 A;  1JJU A;  2RTM A;  3VG7 A;  5HAE A;  1YP6 A;  1VWL B;  1YP7 A;  3SZJ A;  3WYQ A;  2FRS A;  2QO4 A;  3OD9 A;  3FA8 A;  1G74 A;  3KFG A;  3PDF A;  1X8N A;  1NQM A;  1UZ2 X;  2I5V O;  2IZC B;  1NC9 A;  1O1U A;  3APV A;  2PY1 A;  1Y53 X;  4GJS A;  4A1Y A;  4PSQ A;  3OBL A;  4GKC A;  4YFR A;  1KXO A;  4O4O A;  4QRL A;  3BX7 A;  2A2U A;  5HA1 A;  2X32 A;  2RTR B;  1SY3 A;  1ICN A;  1SWP A;  1BSO A;  5H8T A;  1DZK A;  3WJE A;  5AEO A;  5B5F A;  5IO7 A;  3ZUO A;  1UYO X;  1IIU A;  2JU8 A;  1Y9T A;  2FHN X;  3FEL A;  4MVL A;  2R56 A;  1SWG A;  4UU2 A;  1IW2 A;  4JNJ A;  3TGA A;  3WJD A;  4QZT A;  1O8V A;  1YWC A;  2FLJ A;  3RSW A;  2X45 A;  1OEE A;  4OEL A;  1E06 A;  2Y3E A;  3ELZ A;  1IJ8 A;  1P6P A;  1SRI A;  2VFC A;  2QM9 A;  4AZQ A;  2X4M A;  3P24 A;  5HZ6 A;  1SY2 A;  3P6G A;  4YMY A;  5LJH A;  3ZWE A;  5KIC A;  4O3X B;  2Y32 A;  5FQ8 E;  3RDX A;  3APX A;  1GT4 A;  1KT6 A;  2RD7 C;  5HA0 A;  5B29 A;  4Z6J A;  3ZW2 A;  4CPE A;  1VYG A;  2ASN X;  3OE3 A;  4Y0R A;  1MVG A;  1SWD A;  3P02 A;  4GDZ A;  3TF6 A;  4KCA A;  1LDO A;  4WFU A;  3U03 A;  2X55 A;  4GH7 A;  4IAX A;  3RKG A;  5L8N A;  3I0A A;  2WQA E;  3RE6 A;  1RLB E;  1SRE A;  3F8A A;  5CE4 A;  5K68 A;  3HOE A;  1AQB A;  3VE2 A;  4KT5 A;  1NP1 A;  2MO5 A;  4Z2V A;  4NNT A;  2ALL X;  1I05 A;  4M7M A;  4QAE A;  4TKJ A;  1SWA A;  5CYB A;  1HBP A;  4DCB A;  5B27 A;  5BVT A;  4IAW A;  1CBQ A;  3Q34 A;  1SLF B;  3STK A;  3I17 A;  2IZL B;  4IAB A;  1LFO A;  4ZJ0 A;  1NGL A;  3CWK A;  5AQ6 A;  2FGS A;  1EAL A;  1RAV A;  2ZAG A;  2BC3 A;  2NNQ A;  2RTQ B;  1AEL A;  3EYC A;  3CQR A;  2CZU A;  1PTS A;  2G8C O;  3U0D A;  4IMO A;  4YFP A;  4BJ8 A;  4QQ1 A;  1GT5 A;  5EZ2 A;  1X71 A;  1ADL A;  3HTY A;  1DF8 A;  1EW3 A;  1ZNG A;  2Q39 A;  3D95 A;  3EW2 A;  4RUN A;  5D4A A;  1ZNE A;  4ZHD A;  5HZQ A;  4OS8 A;  3NBX X;  1AVG I;  4I9S A;  2YMS A;  3EC5 A;  1MUP A;  5F6Z A;  2L9C A;  2RA6 A;  4U3Q A;  4I3D A;  1I9H A;  1XKI A;  3ELX A;  4MIR A;  5DG4 A;  4FBR A;  3BY0 A;  1VWQ B;  3SZH A;  4OMX A;  3WOV A;  2IZA A;  1BEB A;  2Y3F A;  1ACD A;  1VWK B;  1G85 A;  3KVN A;  3MX7 A;  3OJY C;  2WPU A;  4XMH A;  2Z4I A;  4YDA A;  5IO6 A;  3DSZ A;  5D8J A;  4NV8 A;  1CRB A;  4AZN A;  1N4J A;  3PH6 A;  1LIB A;  1AVD A;  1SRF A;  4UU3 A;  4NLI A;  3T1D A;  1LID A;  4LKP A;  1MDC A;  2JOZ A;  3S5V A;  3VHH A;  5DPQ A;  1LUQ A;  1QAB E;  4C5P A;  4ZCB A;  4ORS A;  4ZHH A;  2VFB A;  1SLG B;  1CBR A;  2C1Q A;  1I06 A;  1JQP A;  1KL4 A;  3CQN A;  4ORX A;  3UAQ A;  5C0N A;  4ID2 A;  1SWS A;  3AEH A;  2LKK A;  2W2A A;  3NX1 A;  1KZW A;  5HCE C;  4YCE A;  3L4R A;  4WFV A;  1SXY A;  1VWP B;  1HXZ A;  1HMS A;  2FR3 A;  4LKT A;  4YGH A;  3B2I A;  2Z4H A;  3ZI8 A;  4ORR A;  1U18 A;  4OS0 A;  2K23 A;  3CKF A;  3IA8 A;  1DFV A;  2KTD A;  3BU1 A;  1O1V A;  4I9R A;  1FEN A;  1X8Q A;  1E02 A;  3BSZ E;  3JQO A;  2BLG A;  2A0A A;  5LKE A;  1YUP A;  3ZW0 B;  1AVE A;  4O3W A;  4ALO A;  2OY7 A;  1LIE A;  4LZU A;  5L8O A;  2GC9 A;  2A13 A;  2F09 A;  3KFI A;  4HPA A;  1PBO A;  3RZY A;  1KL3 A;  2WEX A;  1T8V A;  2X34 A;  1ML7 A;  3VG5 A;  1KQW A;  4NYR A;  3NQ9 A;  1A3Y A;  1SWJ A;  4CPH A;  2GJ5 A;  2LBA A;  4YDB A;  2AT8 X;  5EDC A;  2MM3 A;  1VWJ B;  4Z28 A;  1OSP O;  5JD2 A;  1NP4 A;  3VG4 A;  3EBK A;  4ON1 A;  2Q2P A;  3T6L A;  3S5X A;  2QO6 A;  5IO5 A;  1CBI A;  5JR8 A;  2A8G A;  2IZJ A;  2N93 A;  2L67 A;  4CDD A;  1E00 A;  2C1S A;  3TGB A;  4FQB B;  2ZAI A;  4ZFX A;  4KC7 A;  4CPI A;  2OFB A;  1VWI B;  3VHI A;  3STN A;  3KQ0 A;  1NQN A;  3ZZV A;  4GE1 A;  1HMT A;  2HNX A;  5H9N A;  3GAQ A;  2IZI A;  1LEL A;  1SA8 A;  3K3L A;  4YH0 A;  1ERB A;  1X8P A;  1WUB A;  2UZ2 A;  4TQ2 A;  1BRQ A;  4KH8 A;  1A57 A;  1WBI A;  1SRJ A;  4KC8 A;  1X8U A;  1ZNH A;  3HWG A;  1OPB A;  2IZB A;  1MK5 A;  1RBP A;  2JMB A;  3N91 A;  3BLG A;  4I3C A;  3UEV A;  1K24 A;  3FID A;  2AL0 X;  1GKA A;  3PK2 A;  5H9K A;  1QFT A;  2IZE B;  3DTQ A;  2FR2 A;  1STR B;  2RTD B;  2HZR A;  3RY2 A;  4YVB A;  1VWA B;  4QNI A;  4O3Z A;  1S7D A;  2OFM X;  2IZF B;  4BBO A;  1YIV A;  4O9S A;  1LCZ A;  4GU8 A;  1DZP A;  2CBS A;  5LJG A;  1MX7 A;  4OKA A;  3SOT A;  2KT4 B;  4GDA A;  4Y5D A;  3VG6 A;  4ZR2 A;  4EXZ A;  4YKO A;  3TGC A;  1G7N A;  1PM1 X;  2R73 A;  1MEP A;  3PPT A;  3FYF A;  1D2U A;  4YGG A;  2XST A;  3UEX A;  2G5L A;  4CPH B;  4QGV A;  1EI5 A;  2IFB A;  2RTE B;  4YCH A;  4GJV A;  5IXG A;  3FA7 A;  4HWM A;  2HZQ A;  2LFO A;  1TOW A;  3P6H A;  2QO5 A;  3RDU A;  4EDE A;  1PEE A;  3WZO A;  1RXJ A;  1HN2 A;  4GGT A;  4ALB A;  2FKJ A;  1OEJ A;  4COT A;  2JGS A;  4U8U M;  3GE2 A;  4DQ4 A;  1B56 A;  4I3B A;  1FEL A;  2L68 A;  3EBW A;  4YGZ A;  1SWR A;  3HWD A;  5IRW A;  4GGR A;  1VWG B;  2HLV A;  4LZV A;  3H3I A;  1DF3 A;  1OBQ A;  4XMF A;  4EQA C;  3AKM A;  2JN3 A;  1LF7 A;  4HPD A;  3FLL A;  1KZX A;  4I6S A;  3KFF A;  3D4R A;  3EM0 A;  1JIW I;  1Y9L A;  3E3C A;  1N43 A;  1GX8 A;  1EII A;  2DJG A;  2G7B A;  3C77 X;  3NPO A;  4MEE A;  3NR3 A;  5FQ7 E;  3MG5 A;  4N7D A;  2AMM X;  2RTB B;  4ZHG A;  1N9M A;  4CDF A;  1LNM A;  1GKA B;  5KID A;  3FR4 A;  3O2Y A;  2BHV A;  5CSE A;  1Z24 A;  2X8F A;  3SZI A;  3WZP A;  2MF6 A;  4ES7 A;  3FEK A;  1SXU A;  3APW A;  2GTL M;  2X8T A;  4O3Y A;  1ZND A;  3G7X A;  2HKD A;  4CDE A;  1N0S A;  1TVQ A;  3WYP A;  2EU7 X;  3FMZ A;  2W2F A;  5IRA A;  2KW1 A;  1EPB A;  2R74 A;  1YWB A;  4FGI B;  5F6B A;  5B10 O;  3S26 A;  3VPJ E;  4Z27 A;  1BWY A;  1LIC A;  5F58 A;  1G5W A;  1FJ1 E;  2M4L A;  1BBP A;  1EXS A;  2FTB A;  4IB9 A;  1ZRY A;  4GGZ A;  4OMW A;  1EIO A;  2RTA A;  1IFB A;  4BCS A;  1L6M A;  2RTI B;  5F7G A;  1OPA A;  2O62 A;  4JGL A;  4AZP A;  4ZHF A;  5HTD A;  1BLR A;  1RXK A;  1FDQ A;  3QKG A;  4EKV A;  1U17 A;  4ZGU A;  2DM5 A;  4MVK A;  1LPJ A;  3T2W A;  3PED A;  2OVE A;  2A5B A;  4QGW A;  1ZNK A;  2YG2 A;  3CBS A;  5B5G A;  3VE1 A;  4DQ3 A;  5LJC A;  1KQX A;  1JJX A;  1LDQ A;  3MVF A;  1NDJ A;  1ICM A;  2MHD A;  1SY0 A;  4QYN A;  3CKG A;  4CDC A;  5AJC A;  2A5C A;  2IZK A;  1FTP A;  3KZA A;  4U8U N;  5B3M O;  3EW1 A;  4MVI A;  4BOE A;  1OBU A;  2UYW A;  1BSQ A;  3P6E A;  3ZW1 A;  2VDF A;  4TNN A;  4L3R A;  4NYQ A;  2F73 A;  1W4T A;  1Y0G A;  3BU9 A;  1DC9 A;  4QZU A;  1I78 A;  4B55 A;  2RQ0 A;  4CSB A;  3KFH A;  3VU1 A;  4TJZ A;  5LJK A;  1SWC A;  4HPC A;  3B2K A;  4IB6 A;  4U46 A;  2OL6 O;  2DJF A;  1JBH A;  2OF9 A;  4DNE A;  1IKJ A;  5H9A A;  4AYH A;  4N7C A;  1NBX A;  3WZN A;  3LHN A;  3RE5 A;  1SRH A;  1TOU A;  3LTW A;  2QOS C;  1EUO A;  4KII A;  2OYB O;  1VWF B;  2NP1 A;  4Y0P A;  3TZS A;  4FBO A;  2AT0 X;  1JJJ A;  5FFH A;  3NAD A;  4IB7 A;  4Y0Q A;  1E2T A;  2NND A;  3F6Z B;  2FKG A;  2WWP A;  3LV4 A;  1VWB B;  2ACP X;  2E4J A;  4NNS A;  4L1N A;  3AKN A;  4M6S A;  2JU7 A;  4HPB A;  4Y0S A;  2FS6 A;  1VWN B;  5HBS A;  1I4U A;  3BRN A;  4IRW A;  4TKH A;  4ORU A;  3RDM A;  2C4I A;  1EPA A;  3SLJ A;  1IKE A;  3ZQ3 A;  2F01 A;  2OL8 O;  4XMG A;  2IZG B;  2OY1 O;  4NLJ A;  2AH7 X;  2CZT A;  4OS3 A;  1KFF A;  1ALB A;  3JS1 A;  4U8U O;  3HPE A;  1BSY A;  2LBV A;  4LQZ A;  5CHK A;  2GH7 A;  1N7Y A;  2WEW A;  1N9Y A;  4XMC A;  5LKF A;  4BVM A;  4ZHC A;  1CJ5 A;  3MBT A;  3HWE A;  1FE3 A;  3MM0 A;  1SWT A;  2AT5 X;  5AJB A;  2L5P A;  2WQ9 A;  4WBK A;  4RUU A;  3UEW A;  5HTE A;  3ZW1 B;  4JO6 A;  3QQ2 A;  1T0V A;  1BJ7 A;  4AW8 A;  1I04 A;  1QFV A;  1FEM A;  2CBR A;  4BX7 A;  1VWR B;  1SXX A;  2JW1 A;  3SLO A;  4D6B A;  1HXL A;  1KL5 A;  2BT9 A;  1URE A;  4K19 A;  3VG3 A;  1SY1 A;  1LCV A;  2I5Z O;  4GNW A;  2OY5 O;  1SLD B;  2RCT A;  1PBY A;  1SXW A;  2LB6 A;  2FWV A;  1U0X A;  1HBQ A;  3SAO A;  1HMR A; 
#chains in the Genus database with same CATH homology
 2LA7 A;  2POA A;  3WBG A;  2P8G A;  2GTL O;  3FR5 A;  4AZO A;  1KGL A;  1GT1 A;  1BM5 A;  2X46 A;  2MJI A;  1VYF A;  1GT3 A;  2GTF X;  4O4X A;  3WJG A;  1BRP A;  5HZ8 A;  2FS7 A;  4NP1 A;  1LIF A;  1ZNL A;  4A60 A;  1PMP A;  2OVD A;  1HQP A;  5BYP A;  3FA6 A;  4YBP A;  4EEJ A;  2WUT A;  3HOL A;  3C78 X;  4IBA A;  3RBY A;  4YFQ A;  2Q4N A;  5EED A;  1GX9 A;  4ARH A;  2OZQ A;  5HZ9 A;  2OVA A;  3P6C A;  3WJC A;  3PH5 A;  4GNY A;  1EQD A;  5F1E A;  1B4M A;  1JZU A;  2G78 A;  5L8I A;  4GET A;  5EDB A;  3PEC A;  4TLJ A;  5BVS A;  3V8U A;  4I95 A;  3NQ3 A;  2FT9 A;  4D6A A;  2OFR X;  4IB8 A;  4YBU A;  2HMB A;  2OVS A;  5HZ5 A;  2WR6 A;  1GXA A;  3VG2 A;  4U9C A;  1H91 A;  3O22 A;  1X8O A;  1TXL A;  4ORY A;  1B0O A;  3PQS A;  4TKB A;  4ZH9 A;  2W2B A;  1E5P A;  1OEK A;  4YKM A;  3ZUI A;  4A8Z A;  1ERX A;  1YWD A;  3B2H A;  4WHI A;  5FEN A;  4ZH6 A;  2BS5 A;  1KT7 A;  3CR6 A;  3WJB A;  3D96 A;  2Q2M A;  1R0U A;  3U9P C;  3B2L A;  3WVM A;  3BDR A;  3FW4 A;  1QY0 A;  4GRJ A;  5KHP A;  1QY1 A;  1S44 A;  1JYD A;  3JSQ A;  1JV4 A;  5D48 A;  3FA9 A;  4O4U A;  1YWA A;  2A3F X;  3ZW0 A;  1DZM A;  4XMD A;  3NX2 A;  1QQS A;  3S60 A;  3FEP A;  3NQK A;  3P6D A;  1XCA A;  5BVQ A;  4MIS A;  4ODD A;  2AKQ A;  4PJ2 A;  4BQU A;  1LKE A;  3RWX A;  2HYS A;  2BS6 A;  3NP1 A;  3APU A;  4MVE A;  3C76 X;  3BS2 A;  4O49 A;  3CMP A;  1AB0 A;  2K62 A;  3P6F A;  5FQ6 E;  1IFC A;  5LJD A;  4EFG A;  3UEU A;  4FBV A;  1MX8 A;  1KT5 A;  2CM4 A;  5D47 A;  1VPR A;  2AT6 X;  2QMI A;  3IFB A;  4NW4 A;  4AZM A;  1QG5 A;  5D45 A;  5HCD C;  3Q6L A;  1QY2 A;  1A18 A;  3FIQ A;  5LJE A;  3FR2 A;  1DV9 A;  2ANS A;  1T68 X;  4ORW A;  5H9L A;  2G79 A;  4IMN A;  5K06 A;  3O19 A;  2GTL N;  3BX8 A;  4GZV A;  1TW4 A;  2A2G A;  3FW5 A;  4INN A;  5HCC C;  4A1H A;  4GK9 A;  1DZJ A;  4R0B A;  1OBP A;  4O4S A;  4HFO A;  3CBC A;  5LJB A;  4QGX A;  2XKL A;  2X8S A;  2CM9 A;  1GM6 A;  1B8E A;  2RN4 A;  4ZGF A;  3D97 A;  3FEN A;  1S2P A;  1A2D A;  4XME A;  2MWH A;  5EEE A;  1JYJ A;  2RCQ A;  4AZR A;  2Q9S A;  1KT3 A;  2JU3 A;  1SMP I;  2NNE A;  2KTS A;  3STM X;  3B2J A;  1KOI A;  1GGL A;  3HWF A;  3PP6 A;  1QWD A;  3WJF A;  4CK4 A;  1X89 A;  1CBS A;  4ML7 B;  1KT4 A;  4QYP A;  5EPQ A;  3WXQ A;  5HWZ A;  3PQU A;  5FAZ A;  2ACO A;  3F9D A;  5H9N A;  2WSJ A;  2AT3 X;  1D3S A;  2KD2 A;  3HK1 A;  3EMM A;  4CV7 A;  3VG7 A;  5HAE A;  1YP6 A;  1YP7 A;  2FRS A;  2QO4 A;  3OD9 A;  3FA8 A;  1G74 A;  3KFG A;  1X8N A;  1UZ2 X;  1O1U A;  3APV A;  2PY1 A;  4A1Y A;  4PSQ A;  3OBL A;  4GKC A;  4YFR A;  1KXO A;  4O4O A;  4QRL A;  3BX7 A;  2A2U A;  5HA1 A;  1SY3 A;  1ICN A;  1BSO A;  5H8T A;  1DZK A;  3WJE A;  5AEO A;  5IO7 A;  3ZUO A;  2JU8 A;  1IIU A;  1Y9T A;  3FEL A;  4MVL A;  2R56 A;  4UU2 A;  3TGA A;  1IW2 A;  3WJD A;  4QZT A;  1O8V A;  1YWC A;  2FLJ A;  3RSW A;  2X45 A;  1OEE A;  1E06 A;  3ELZ A;  1P6P A;  4AZQ A;  2QM9 A;  3P24 A;  5HZ6 A;  1SY2 A;  3P6G A;  4YMY A;  5LJH A;  3ZWE A;  4O3X B;  5FQ8 E;  3APX A;  1GT4 A;  1KT6 A;  2RD7 C;  5HA0 A;  5B29 A;  3ZW2 A;  1VYG A;  2ASN X;  3OE3 A;  4Y0R A;  1MVG A;  3P02 A;  4GDZ A;  3TF6 A;  4KCA A;  4WFU A;  3U03 A;  4IAX A;  4GH7 A;  3RKG A;  5L8N A;  3I0A A;  2WQA E;  1RLB E;  3F8A A;  5CE4 A;  3VE2 A;  3HOE A;  1AQB A;  4KT5 A;  1NP1 A;  2MO5 A;  4NNT A;  4M7M A;  1I05 A;  4QAE A;  4TKJ A;  5CYB A;  5BVT A;  1HBP A;  5B27 A;  4IAW A;  1CBQ A;  3STK A;  3I17 A;  4IAB A;  1LFO A;  4ZJ0 A;  1NGL A;  3CWK A;  5AQ6 A;  1EAL A;  1AEL A;  2ZAG A;  2NNQ A;  3EYC A;  3CQR A;  2CZU A;  3U0D A;  4IMO A;  4YFP A;  4QQ1 A;  1GT5 A;  5EZ2 A;  1X71 A;  1ADL A;  3HTY A;  1EW3 A;  1ZNG A;  2Q39 A;  3D95 A;  4ZHD A;  4RUN A;  5D4A A;  1ZNE A;  5HZQ A;  4OS8 A;  3NBX X;  1AVG I;  4I9S A;  2YMS A;  1MUP A;  5F6Z A;  2L9C A;  2RA6 A;  4U3Q A;  4I3D A;  3ELX A;  1XKI A;  4MIR A;  5DG4 A;  4FBR A;  3BY0 A;  4OMX A;  3WOV A;  1BEB A;  4AYH A;  1ACD A;  3OJY C;  1G85 A;  4XMH A;  3MX7 A;  4YDA A;  5IO6 A;  5KIC A;  2Z4I A;  3DSZ A;  5D8J A;  1CRB A;  4AZN A;  3PH6 A;  1LIB A;  4UU3 A;  4NLI A;  3T1D A;  1LID A;  4LKP A;  1MDC A;  2JOZ A;  3S5V A;  5DPQ A;  1QAB E;  4ZCB A;  4ORS A;  4ZHH A;  1CBR A;  1I06 A;  3CQN A;  4ORX A;  3UAQ A;  5C0N A;  4ID2 A;  2LKK A;  2W2A A;  3NX1 A;  1KZW A;  5HCE C;  4YCE A;  3L4R A;  4WFV A;  1SXY A;  2FR3 A;  1HMS A;  4LKT A;  4YGH A;  3B2I A;  2Z4H A;  3ZI8 A;  4ORR A;  1U18 A;  4OS0 A;  2K23 A;  4I9R A;  3IA8 A;  1DFV A;  2KTD A;  3BU1 A;  1O1V A;  5LKE A;  1FEN A;  1X8Q A;  1E02 A;  3BSZ E;  3JQO A;  2BLG A;  2A0A A;  1YUP A;  3ZW0 B;  4O3W A;  4ALO A;  1LIE A;  4LZU A;  5L8O A;  2GC9 A;  2A13 A;  2F09 A;  3KFI A;  4HPA A;  1PBO A;  3RZY A;  2WEX A;  1T8V A;  1ML7 A;  3VG5 A;  1KQW A;  4NYR A;  3NQ9 A;  1A3Y A;  2GJ5 A;  2LBA A;  4YDB A;  2AT8 X;  5EDC A;  2MM3 A;  1NP4 A;  3VG4 A;  3EBK A;  4ON1 A;  2Q2P A;  3S5X A;  2QO6 A;  5IO5 A;  1CBI A;  5JR8 A;  2N93 A;  2L67 A;  1E00 A;  3TGB A;  4FQB B;  2ZAI A;  4ZFX A;  4KC7 A;  3STN A;  3KQ0 A;  3ZZV A;  4GE1 A;  1HMT A;  2HNX A;  3GAQ A;  1SA8 A;  3K3L A;  4YH0 A;  1ERB A;  1X8P A;  4TQ2 A;  1BRQ A;  4KH8 A;  1A57 A;  4KC8 A;  1X8U A;  1ZNH A;  3HWG A;  1OPB A;  3UEV A;  1RBP A;  2JMB A;  3N91 A;  3BLG A;  4I3C A;  2AL0 X;  1GKA A;  5H9K A;  1QFT A;  3DTQ A;  2FR2 A;  2HZR A;  4QNI A;  4O3Z A;  1S7D A;  2OFM X;  1YIV A;  4O9S A;  4GU8 A;  1DZP A;  2CBS A;  5LJG A;  1MX7 A;  3VG6 A;  3SOT A;  2KT4 B;  4ZR2 A;  4EXZ A;  4YKO A;  3TGC A;  1G7N A;  1PM1 X;  2R73 A;  3PPT A;  4YGG A;  3FYF A;  1D2U A;  4QGV A;  2XST A;  3UEX A;  1EI5 A;  2IFB A;  4YCH A;  3FA7 A;  4HWM A;  2HZQ A;  2LFO A;  1TOW A;  3P6H A;  2QO5 A;  4EDE A;  1PEE A;  1HN2 A;  4ALB A;  1OEJ A;  4COT A;  4U8U M;  3GE2 A;  4DQ4 A;  1B56 A;  4I3B A;  1FEL A;  2L68 A;  3EBW A;  4YGZ A;  3HWD A;  2HLV A;  4LZV A;  3H3I A;  1DF3 A;  1OBQ A;  4XMF A;  4EQA C;  3AKM A;  2JN3 A;  1LF7 A;  4HPD A;  3FLL A;  1KZX A;  4I6S A;  3KFF A;  3D4R A;  3EM0 A;  1JIW I;  1Y9L A;  3E3C A;  1GX8 A;  1EII A;  2G7B A;  3C77 X;  3NPO A;  3NR3 A;  5FQ7 E;  4N7D A;  2AMM X;  4ZHG A;  1LNM A;  1GKA B;  5KID A;  3FR4 A;  3O2Y A;  2BHV A;  1Z24 A;  2X8F A;  4ES7 A;  3FEK A;  1SXU A;  3APW A;  2GTL M;  2X8T A;  4O3Y A;  1ZND A;  3G7X A;  1N0S A;  1TVQ A;  2EU7 X;  3FMZ A;  2W2F A;  2KW1 A;  1EPB A;  2R74 A;  1YWB A;  4FGI B;  5F6B A;  3S26 A;  3VPJ E;  1BWY A;  1LIC A;  5F58 A;  1G5W A;  2M4L A;  1BBP A;  1EXS A;  2FTB A;  4IB9 A;  1ZRY A;  4OMW A;  1EIO A;  1IFB A;  1L6M A;  5F7G A;  1OPA A;  2O62 A;  4JGL A;  4AZP A;  4ZHF A;  5HTD A;  1BLR A;  1FDQ A;  3QKG A;  1U17 A;  4ZGU A;  2DM5 A;  4MVK A;  1LPJ A;  3PED A;  2OVE A;  4QGW A;  1ZNK A;  2YG2 A;  3CBS A;  3VE1 A;  4DQ3 A;  5LJC A;  1KQX A;  1JJX A;  3MVF A;  1ICM A;  2MHD A;  1SY0 A;  4QYN A;  5AJC A;  3KZA A;  1FTP A;  4U8U N;  4BOE A;  4MVI A;  1OBU A;  1BSQ A;  3P6E A;  3ZW1 A;  4TNN A;  4L3R A;  4NYQ A;  2F73 A;  3BU9 A;  4QZU A;  1DC9 A;  4CSB A;  2RQ0 A;  5LJK A;  3KFH A;  3VU1 A;  4TJZ A;  4HPC A;  3B2K A;  4IB6 A;  1JBH A;  1IKJ A;  5H9A A;  4N7C A;  3LHN A;  1TOU A;  2QOS C;  1EUO A;  4KII A;  3TZS A;  2NP1 A;  4Y0P A;  4FBO A;  2AT0 X;  1JJJ A;  5FFH A;  3NAD A;  4IB7 A;  4Y0Q A;  2NND A;  3F6Z B;  1HBQ A;  2WWP A;  3LV4 A;  4NNS A;  2ACP X;  2E4J A;  4L1N A;  3AKN A;  4M6S A;  2JU7 A;  4HPB A;  4Y0S A;  2FS6 A;  5HBS A;  1I4U A;  3BRN A;  4TKH A;  4ORU A;  1EPA A;  1IKE A;  3ZQ3 A;  4XMG A;  4NLJ A;  2AH7 X;  2CZT A;  4OS3 A;  1ALB A;  3JS1 A;  4U8U O;  1BSY A;  2LBV A;  4LQZ A;  2WEW A;  4XMC A;  4BVM A;  5LKF A;  4ZHC A;  1CJ5 A;  3MBT A;  3HWE A;  1FE3 A;  5AJB A;  2AT5 X;  2L5P A;  2WQ9 A;  4WBK A;  4RUU A;  3UEW A;  5HTE A;  3ZW1 B;  1T0V A;  1BJ7 A;  4AW8 A;  1I04 A;  1QFV A;  1FEM A;  2CBR A;  4D6B A;  2JW1 A;  1SXX A;  2BT9 A;  4K19 A;  1URE A;  3VG3 A;  1SY1 A;  4GNW A;  2RCT A;  1SXW A;  2LB6 A;  2FWV A;  1U0X A;  2ALL X;  3SAO A;  1HMR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...