2ATCA

Crystal and molecular structures of native and ctp-liganded aspartate carbamoyltransferase from escherichia coli
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
305
structure length
305
Chain Sequence
ANPLYQSHIISINDLSRDDLNLVLATAAKLKANPQPELLKHKVIASCFFEASTRTRLSFQTSMHRLGASVVGFSDSANTSLGKKGQTLANTISVISTYVDAIVMRHPQEGAARLATEFSGNVPVLNAGDGSNQHPTQTLLDLFTIQQTEGRLNNLHVAMVGDLKYGRTVHSLTQALAKFDGNRFYFIAPDALAMPEYILDMLDEKGIAWSLHSSIEEVMTRVQKERLDPSEYAXVKAQFLVRANSLGGLHNAKMNAKVLHPLPRVDEIATDVDKTPHAWYFQQAGNGIFARQALLALVLNRDLVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal and molecular structures of native and CTP-liganded aspartate carbamoyltransferase from Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase (carbamoyl-p,aspartate)
molecule keywords ASPARTATE CARBAMOYLTRANSFERASE, CATALYTIC CHAIN
total genus 51
structure length 305
sequence length 305
ec nomenclature ec 2.1.3.2: Aspartate carbamoyltransferase.
pdb deposition date 1982-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00185 OTCace Aspartate/ornithine carbamoyltransferase, Asp/Orn binding domain
A PF02729 OTCace_N Aspartate/ornithine carbamoyltransferase, carbamoyl-P binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1370 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Aspartate/ornithine carbamoyltransferase 2atcA02
3.40.50.1370 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Aspartate/ornithine carbamoyltransferase 2atcA01
4F04A 1RAEA 1Q95A 2A0FA 1AKMA 1R0CA 2QG9A 1RAAA 8AT1A 4ANFA 3M4JA 3GD5A 3KZCA 7AT1A 4KWTA 1RAGA 1I5OA 5G1OA 1TUGA 4EP1A 4JHXA 3NPMA 2W37A 3KZOA 4FYXA 4FYWA 4KH0A 2H3EA 4E2FA 4FYVA 1F1BA 6AT1A 3L05A 2HSEA 1EZZA 2G7MC 2RGWA 8ATCA 1EKXA 1JS1X 2EF0A 1AT1A 4OH7A 2AIRA 1FVOA 4AM8A 1ORTA 3AT1A 2FZCA 3L02A 2QGFA 4NF2A 1RAHA 3GRFA 1EP9A 1TU0A 2AT1A 3Q98A 4JQOA 2BE9A 1PG5A 4EKNB 3L06A 4A8HA 3M5DA 3R7DA 4KGVA 1PVVA 1ZA2A 2FG7C 3LXMA 1C9YA 4WTOA 4F2GA 4KH1A 1DUVG 3M4NA 3SDSA 4JFRA 2I6UA 4AMUA 2BE7A 2OTCA 1D09A 1TTHA 9ATCA 5AT1A 2P2GA 1RABA 4KGZA 1R0BA 1NBEA 1ACMA 4IV5A 5G1NA 4A8TA 3D6NB 4BJHB 4FYYA 2IPOA 1SKUA 3TXXA 1DXHA 3KZNA 5G1PA 4A8PA 2FZKA 5ILQA 3KZKA 3M5CA 1RADA 2FG6C 3UPDA 4H31A 4AT1A 1ZA1A 2ATCA 1FB5A 1VLVA 3L04A 3D7SA 3E2PA 3CSUA 3KZMA 1OTHA 3R7LA 3MPUA 2FZGA 1RAIA 2YFKA 3TPFA 1RAFA 1XJWA 4KGXA 3R7FA 1ML4A 1A1SA 1RACA
chains in the Genus database with same CATH superfamily
3SSAA 2OBFA 3P9IA 3G0CA 3FM9A 2HU5A 2XDAA 3QYAA 4LY6A 1MOSA 3QX9A 1FXUA 3TE7A 2F62A 1KJZA 5FCDA 1F3OA 1XQWA 3EZ7A 4M38A 5T5QA 1EI9A 3DDCA 4IJKA 1CE8B 4KR9A 3ABQB 1MO3A 1WB4A 4PC6A 2CXRA 1SMKA 1ZMBA 3K8QA 1X87A 1LI7A 4YRRA 3MZ0A 3E48A 1U3WA 4RHYA 2B94A 4UM7A 1N7GA 1NATA 3LGXA 5HKLA 1Y8ZA 4FBMA 1DHTA 4RJLA 3UJDA 3EPJA 4P58A 1NIPA 4BJ5A 3EDMA 3R5JA 5C1OA 1MC5A 5TB5A 4Q05A 3UMSA 3G5LA 2QZ4A 3GFGA 3QVOA 4KPEC 1U3DA 5DK4A 2RGNA 1XT6A 3OESA 4G24A 2KX7A 3I1YA 4Y0VA 3T12A 4B7AA 3LSTA 1JVSA 1XROA 3ZW7A 1Q57A 1R3UA 2YDYA 1EKXA 1O4WA 1WP9A 3A8TA 4U7TB 2NU9B 3KBOA 2JHFA 4CI9A 2AIRA 1FVOA 1O94C 1NF3A 1FY2A 1X1TA 3IT0A 2VHUA 2ONJA 4RKQA 1DBQA 1Y5IA 4KXLA 4QPPA 3H5AA 3VR2A 4Q01A 4KIFA 3IA2A 2NSHA 3C87A 1NV8A 3Q85A 4M9UA 1LSSA 4U0KA 4EUKA 4AY4A 2A9KA 3PFCA 5B7NA 1O5IA 1RLOA 3OHSX 3AUKA 1ZCBA 4FLFA 4DQLA 3KQHA 1CUZA 1K6XA 1QMGA 3LWDA 4H3KB 4XR9A 1PIWA 2IDJA 1WXIA 4KGVA 4QDXA 4IDCA 2EATA 1TIBA 3GVHA 1SEPA 4RK6A 5CT9A 1Y63A 2FHPA 1IHYA 3WO1A 1SUIA 4C1BA 2HDNB 1G8AA 4XVCA 3HP4A 3CB2A 3ZD9A 1O5OA 3NIGB 1KBOA 1ZCAA 2Y1WA 3QYPA 4N7MA 4PRZA 4TL9A 3LPLA 2NTVA 3IAFA 4TWIA 3W04A 1DC6A 4JGBA 1TTHA 5EYPB 2RHCA 4ZOLF 4UMEA 3C5EA 3I01A 5T8KA 4AUMA 4D9IA 4HY3A 2OQ2A 2JIQA 1SKBA 2O3QA 1X7ZA 4I3GA 2WT8A 4KXXA 3OCZA 4L8VA 3B6MA 1IAQA 2QKYA 4EW2A 5CH3A 1Q1QA 3JQAB 4N03A 2ZI6A 4I46A 4NATA 3OCVA 4LNUB 1JR6A 3D9QX 2JNWA 2SKEA 3VHXB 5AKJA 4UOQA 5ALDA 2NMVA 3P2YA 1J1UA 4GPEA 2CUZA 4ZV7A 1Y3BE 4GC9A 5K2OA 4ZV4A 5A4DA 1Z5NA 3P1JA 1B8OA 3E70C 3N2LA 2C4TA 5FRDA 1Z33A 3OWOA 1YL7A 5SY9A 3NUQA 1W19A 3PDHA 1EP1B 3TUZC 2IT1A 4C07A 2IIQA 2ZIWB 1BCSB 1TU4A 1ZONA 4MWSA 3RRZA 1MTOA 3AG5A 3N86A 5CT5A 1L5FA 1ONBA 3SYNA 1RZUA 3WYNA 1Q7CA 2J6HA 3GI1A 4OL0A 1EVJA 5KHLB 4RYDA 5JTUA 1OKKD 1I4WA 3K2QA 3PNYA 4UNQA 3RVBA 4MXDA 5EKUA 3M33A 4ISCA 4XFKA 3Q8KA 3UHAA 1Z16A 2R7MA 1EAMA 1SXGA 3GJ8A 1FU4A 3VH4A 1IY2A 2WTAA 5K2MA 4ZCTA 1NMSA 3QM1A 1A5AB 1RKVA 4K9DA 3CM0A 4OGFA 1BDJA 2W00A 5EZYB 2NT4A 4WLVA 3TOXA 1I8TA 5FA8A 1SVNA 3SKXA 2EP7A 3ITKA 2H18A 4W1PA 2PD6A 1OZFA 1Z4JA 3GZ4A 1I0IA 3E5NA 4OFXA 2SBTA 5AI6A 4CLRB 4ETWA 3M34A 2ZSFA 3JQ9C 4LRWA 3I2KA 5BN4B 3TX2A 4KXYA 5K6TA 1XF1A 3OZVA 3NBXX 1NLUA 1H4SA 1GZHB 5BUCA 4LF4B 1BXGB 4IUBS 1YA8A 3CRVA 4W9MC 2P2ZA 5MHTA 4KX3A 2G0TA 2WJIA 3WWCA 3ZXIA 5LFAA 3A58B 4HVCA 3PHIA 1RRMA 3OM1A 2DHDA 3CZRA 5IKEA 2AJDA 3ROMA 1B3RA 4G4IA 1EK6A 2GHTA 2ZYAA 3EIQA 1Y5LA 4C7XA 3OM8A 1HZZA 4MR8A 3T4PA 1FS6A 2IHKA 1W36C 2UUPA 2J7PD 1VLLA 4YNBA 1L4BA 2GKOA 4X7RA 3DTVD 4ZQFA 5BT9A 4ALMA 3AVXA 4CMIB 2CBXA 3N8NA 2OHFA 1SZPA 1KI3A 2AR0A 2AL7A 2IQ5A 3DDZX 3H2BA 3PYXA 5CEFA 3A6KA 3P19A 1H05A 1FVHA 5EXDA 2BGGA 5B36A 2ISCA 4MUYA 3BWBA 3WLNA 4M7WA 4CV0A 1YO6A 4UM8B 3A9CA 3MN1A 1T8RA 3LMKA 5BNFA 3BXEA 3EPHA 2H2IA 1C7ZA 4JP8A 1TO1E 2XB9A 2EX0A 2FUG1 1GJRA 1RJFA 2B2XA 2QJWA 4LIPD 3SYRA 4KE6A 3G8YA 4D4HA 5DHTA 4EYKA 3LCVB 4AMUA 2BSQA 1U8EA 1GEGA 1WO8A 1X7WB 3M9LA 4H7PA 4OMCA 1EDEA 1BXRA 2GILA 3D81A 2BFFA 3DJFA 4KN5A 3U7EB 1EK1A 4AUNA 5EPEA 2G04A 5COQA 1JSLA 2COEA 2F1HA 5LSAA 4EW3A 1GTG1 4GLJA 2FPXA 3NC0C 4IVPA 4QUGA 4MV3A 2HWKA 3D3QA 3DUFB 1G5IA 3TXYA 1Z63A 4IRXA 4HAWA 2QZZA 1U5BB 3ROFA 3M6IA 4WESB 1CX9B 2E4XA 1SAYA 1YBAA 2R9VA 3FBWA 3MS2A 4YT5A 2Q2NA 4I4TB 5AHWA 5CLJA 4UEWA 3ZY4A 3P32A 3PUKA 2QVXX 2HBQA 4MUEA 4Y18A 3RWMB 2EZ8A 2P2SA 2VDUE 3KKMA 4BLWA 1R5OA 3FCEA 3KQLA 3BERA 2DB3A 5GJBA 1H5UA 1PJQA 1XZDA 2FWJA 2X1LA 2ZSAA 1E62A 3FCYA 1T36A 3GEEA 3GRRA 2G9NA 5CA0F 1WUJS 3ZWVA 4CKEA 4EBFA 3PC6A 3T0FA 3TR0A 2R4QA 3HDJA 4J6FA 2R6HA 4D74A 4KR3A 3SZOA 2Y8EA 2TYSB 5A4AA 2YJ6A 1QB8A 4Q1CA 4Q1EA 1SC6A 3D54D 4DHEA 1IPFA 5DN6D 3WBKA 1X77A 2JATA 2V7QA 3B5JA 1T9KA 5GIPE 3G8CA 2C2WA 1NVMB 3BYZA 1QNLA 2IF2A 1NI5A 3AX6A 5BSVA 4GKAA 3AL2A 1W1UA 1Y4ZA 2HNAA 1PFGA 2CY0A 2I6GA 1JGTA 2FN4A 4MYUA 4QRHA 4WPGA 1J2TA 3LKDA 4CUZA 1T2AA 1F6WA 1GWNA 2PWAA 2KI5A 2DFLA 3OZIA 4X8MA 1O6CA 1CYDA 1YQGA 2XCQA 1BMFA 2J6CA 4I5GA 3ULKA 3QEBZ 2IEZA 1T6ZA 4XVQA 2EBFX 1VI6A 3LLMA 5AM1A 2PRSA 3KB8A 5J59A 1QS0B 5JXWA 2WVAA 1MB4A 1KI7A 7AT1A 5AUOB 1EVZA 3CVYA 5LLDA 4DCNA 1GCOA 5LIPA 3CR8A 1A8SA 2NSLA 3P96A 5K8VA 4MQLA 1QQAA 1OX5A 1H22A 2B82A 2PKYX 1G6Q1 4BBZA 5BN5A 2P0YA 1FTGA 2IOFK 2J07A 3OQIB 4JP3A 4DJFC 1T1IA 1EB9A 4LXHA 1BVYF 9LDTA 1MKYA 3UYLA 1TMKA 4MUIA 3WX0A 1B0AA 2BISA 2X4DA 3G82C 3N2KB 4ODIA 2GA8A 2DUJA 5CM8B 2G4VA 3SYKA 3KUXA 2VAPA 2W4QA 1XB2A 1JDZA 2OBLA 2YVAA 1G3MA 3WGVA 1KZ1A 3SX0A 2NVUA 1UDAA 3N7AA 2JGEA 2XMGA 4CIYA 2VQDA 1UXOA 3CN7A 2R1ZA 2WICA 2YDXA 5HDBB 4IGAA 521PA 2O8BA 2RHWA 2ZSUA 3AO0B 5JATA 3SE7A 4I19A 5K5EA 2JGDA 1LC0A 2NNLD 2VJNA 3P52A 3DT8A 4O33A 4OUDA 4Z9AA 3WXBA 5BRAA 2GK6A 4IF4A 1RQLA 1AKNA 1M2WA 3H1AA 5EJ2A 2ZRLA 4MICA 4CV3A 3LY7A 5AO9A 2RH9B 1WHTB 2C2KA 3WBJA 3MSXA 2G4CA 2W83A 2FWAA 3TIVA 1E58A 5F52A 5KYYB 1GQSA 1COWD 2NZYA 3PWKA 4JOSA 4OO3A 1TZKA 5C7LO 1N6OA 1ZVKA 4K9OA 3W7AA 1CEXA 4XJVA 4D81A 4AY2A 2GDJA 4CHTA 2A14A 1TCCA 2FV8A 4QJIA 1PBNA 2FMTA 3QWFA 4BP9A 2A5GA 1OAAA 1MVOA 3PC3A 1P1KA 4QTXA 3BGOS 4LJ8A 4MJ7A 4MW5A 4N5DA 4CQMB 3ZD7A 3I2JA 1E2GA 4M0MA 1EUZA 2F3UA 4IV5A 4PYMA 4EJSC 2YH2A 3C5VA 4XLTA 2R8XA 1I7NA 1CFZA 1QIMA 1NW8A 3INGA 2VI5A 4DMUB 5FO1A 3N5KA 4LV5B 4GX1A 3H5VA 1UM8A 2B35A 4C4OA 3EZNA 4EY7A 2YWEA 3D7KA 4YAOA 4JNCA 2RGBA 2EL9A 4ALNA 5K0ZA 5H83A 4Y0NA 4F4IA 1GCGA 2FRDC 3I6QA 2YFHA 5LQDA 5F5LA 1GHTA 1NPDA 3PC7A 4WIAA 4QREA 1P81A 2WKRA 2ZYVX 4X65B 3PUWA 2VJCA 4H6VA 3LIIA 4TTIA 2ZI9A 2AXQA 2BSAA 3OZGA 4V2UA 3KSAC 1MAUA 5HKKA 4XE5A 3BWMA 1M5RA 3S6JA 1N1MA 3LWZA 2O8VA 2RC5A 3TMKA 1TM3E 2B5VA 1C80A 4ALLA 1DAGA 2P9JA 1BHO1 4IX9A 2CVOA 3REQB 1CZLA 3OY2A 1BRMA 1V26A 5A9SA 3AVUA 1JFRA 1VPTA 3HZRA 1HM5A 3RF6A 3VSBA 3HXQA 4Q03A 2ZB4A 3WY9A 1ECJA 2DY1A 2GF2A 3I04A 3ELUA 3COZA 3NKVA 4NBLA 4V0SA 1NJ8A 2GEJA 4OXIA 1EP3B 3PHJA 2Z8YM 4L4XA 4KQCA 4PAMA 2EVWX 4I6JA 1JG7A 2SNIE 2WAMA 1F2TB 3UXEA 2NUBA 1LRJA 2RHJA 4G9EA 3OE5A 2A35A 3PLAE 4POOA 1OYWA 4PYKA 2A7QA 2G08A 5E6SB 3DBHB 3DAGA 5BN1A 2HNBA 4MQEB 4QFDA 1UWLA 2VHWA 2WU1A 3BA1A 4QZVA 1HFJA 3A05A 1CY6A 1GZ5A 3GOQA 3QOFA 4YXWA 2D06A 4KO8A 5G3ZA 4F96A 4ZYTA 1AQYA 1SUAA 5CH5A 4OY3A 3IP6A 1QCYA 4JU9A 4KO2S 4CIBA 2HA3A 4Z4IA 5JARA 4WK0B 1XTKA 1XYYA 2OXTA 3TL3A 1ILEA 4QYIA 4GOND 1KR5A 4OQ4A 4AKIA 2FG5A 3O83A 5EIHA 5EWJA 5HA5A 2GAOA 3BGDA 3J80A 4X97A 2W6OA 1ENPA 3KRTA 5LM3A 2JI4A 3IE2A 4MI3A 5CYFA 1T3GA 1EDBA 1U5CA 2PO5A 2ZIXB 4KCGA 5LBTA 4BWYA 3LVRE 1UBEA 1MV5A 5KJCA 4B33A 1YGYA 2AOTA 3KZVA 3ZI7A 2UUBB 2Y2UA 1OFGA 5DX1A 3JWJA 3ACDA 4N54A 1JWAB 2BZGA 4LTMA 1IONA 1DRWA 4PO3X 2JRCA 2X4GA 4OFBA 4K3UA 2DJ5A 3A6ZA 3ZC3A 4PV7A 1QF7A 3AESA 3UYKA 4Z0TA 2VF7A 2OCXA 4NNJA 1OFUA 3JS5A 4JY7A 1T4CB 3WHPA 4M37A 5F51A 4HB3A 3H86A 5TQ2B 4DXDA 4HYYA 2XNKA 1DV2A 2CHUA 2GB4A 1T3TA 1ISGA 4FWBA 4OIMA 2ZB7A 3FPCA 3QOWA 3ONDA 8ADHA 3H19A 1GPMA 1ZNYA 4MUMA 1TAUA 4YJGA 5DTMA 3UB3A 5EE0A 1OGIA 4OJNA 4CWAA 5EVJA 2FSGA 4BGDA 1ST2A 3GV0A 1JIQA 4PHCA 3P9SA 1NBHA 4Q82A 2BBSA 1DIAA 3K9LA 4QTUB 4WNAA 3WGLA 2IGBA 1NBEA 1M8FA 4RJIA 1YCHA 3SM3A 1CHNA 3ZCUA 3WYDA 1OLUB 1IXSB 1MQ9A 3KKKA 5HF6A 1DLJA 1HRDA 1FSPA 1Q5PA 3W0LB 3KD3A 5B1DA 1H2YA 2R8YA 4EHHA 3MCWA 3TX6A 3GCZA 1N92A 3QYJA 1QG2A 1SC1A 5H4GA 4JEHA 3NHWA 4BB9A 3LPNA 2PGNA 2IF0A 4UE2A 2HA7A 4L02A 3K1ZA 2W22A 2W6JD 4Z86A 3HGTA 3UUFA 1B1AA 1MDBA 1A8UA 1X9HA 3RC7A 1CZRA 2EJWA 4COKA 1JEYB 3ZHVA 1AD2A 5AW0A 1JNXX 3A1NA 4G63A 3V3KA 2VTVA 3NHFA 1G9TA 2ZI3A 1Y7HA 1AHNA 1HE5A 3CE9A 4GBMA 4I9NA 5ITVA 1UZNA 5D6OA 1YRQA 1IDOA 2PBZA 2FMFA 2XE7A 3DD1A 3IT1A 2VH2A 2YMQA 1G7TA 2H65A 4EI2A 2JLUA 4P31A 1OQAA 2AA3A 3TR6A 3HYCA 2WTEA 1Q15A 3H3XA 1SC4A 4FUQA 1PYDA 4V0OA 3D6JA 2PBFA 4Q3LA 2ZP1A 3G5TA 3IDAA 1ODTC 2Q6TA 4RORA 1E0DA 3LUHA 3S2GA 2O8CB 4Q3NA 4AQYB 1RAEA 3D6VA 2QGNA 2PYDA 4MGIR 1XWFA 1J22A 3A31A 4JVSB 1IUNA 2D62A 1BSVA 4IWYA 4KP7A 4EAQA 2UZ0A 3ESBA 3WYAA 4H1WA 2OAQ1 3L8DA 4UU1A 2NU6B 1E7QA 1M2VA 1R0YA 2EKDA 3K32A 2WSBA 3TOSA 3R8FA 4BFCA 3D1LA 4JJAA 1NQ5A 1AMOA 2QU8A 4MPTA 5E0OA 3EK2A 1BNCA 1GAWA 3K4PA 3I32A 4MRSA 5DNAA 3UKOA 4DOMA 3KSMA 2QM7A 3U2QA 1XEFA 3LTNC 4Q19A 4AX8A 3BEOA 3MJCA 3G7UA 2VQFB 1INLA 2AJTA 3R4VA 1AKTA 3G1TA 1WNFA 3K6KA 5T4EA 5KX5A 2WC1A 2VYQA 3L84A 2W6NA 3P9PA 2C54A 3ZV4A 2OC4A 3AC0A 4LXXA 3B7PA 3TE6A 5BQXA 3FMVA 3E35A 4PZUA 2CKMA 4YMVA 5KSWB 1SXJE 5KWEA 4D8UA 2LR0A 1W76A 2H2GA 2ADOA 2HB6A 2GFIA 3QPVA 4RD6A 1QC5A 3UMJA 3ZHSA 3EA5A 3ICVA 1N3BA 4Y9RA 4UNIA 2HPZA 1U2ZA 4GKBA 2DQ4A 4YYEA 3FMGA 5JPIA 3B2EA 4CNQA 2F00A 3GJ6A 3IUBA 1A9RA 5TY0A 1QVVA 1CUVA 2OXIA 1AK9A 2H54A 4LZWA 1XCMA 2FE1A 5ECYA 1W2WB 4A8HA 2PZJA 1KARA 2EG9A 1T3SA 1YR6A 3AP1A 3QEJA 2PT7A 4DC1A 5EEHA 4A9AA 1FBTA 3AV0B 3NYIA 5KI6A 1ZMXA 2H2FA 5COBA 1HE3A 4XWAA 2EHJA 1V16A 1JKMA 1Q11A 2OZVA 4TT3A 4Z0HO 5JD3A 3U9LA 1DAKA 3DYIA 1OOEA 1A88A 2YWFA 3IUPA 1DC3A 3FHTA 1ACLA 8ABPA 3OZCA 3QRWA 1CKEA 2MJLA 4MUJA 4Q7LA 4QGBA 1H2BA 421PA 3BIFA 4BLUA 2GA9A 1BEZA 3OZWA 4M1QA 4EB6B 2FPRA 3LDGA 3ZBPA 1RABA 2WT9A 3BORA 3LP8A 1DFIA 3ZZUA 5BSWA 2LGJA 4DZZA 1VRWA 3I92A 4MMXB 1CR2A 2J5BA 2Q3BA 4E70A 1HE4A 1C0IA 4LZOA 2W6ID 4BECA 4NNOA 2JJYA 2CXUA 1PK7A 2PAAA 5D5HA 2V5AA 1L5GB 2IU4A 4BGVA 2VQ6A 4WKNA 1OSNA 3K94A 3M1LA 4LSMA 1N4DA 3KD2A 3PNKA 3U1TA 1VCIA 2YC4C 4EA9A 5LA6F 2PMCA 1Z7YA 3DL2A 4U2DA 3T1QA 3TBHA 1X7HA 1U4OA 2B4KA 1K4YA 1R7RA 4QYWA 3QA3E 3AUXA 4UW9A 3P0IA 5E1OA 5K7SA 2XCLA 4G1EB 2Y99A 5LQRA 1YHZA 2QIPA 2MCFA 1JECA 1RHUA 3PXAA 3TR5A 1GN9A 4DTIA 4LDNA 1AHHA 1US8B 4J0EA 1T2NA 2CFRA 1Y4DE 4LBYA 4INAA 3BS4A 3EMVA 2D1SA 4JLDA 1E1NA 3E3LA 2WUEA 4L7QA 3BFPA 4QQNA 1GTSA 4V1CA 2RAUA 3G1WA 3O1IC 5EZYF 3X2EA 4B3BA 2XE8A 2XWJI 3U4CA 3SDZA 3WYFA 4BQNA 3GLVA 4Z4GA 1XQ6A 4NMLA 3TTYA 2AGVA 2JLQA 4XPIA 4WFIA 4F86A 2B0CA 3CF4A 4QM7A 2PXAA 2DUNA 2L82A 2AH5A 3QBDA 2JHCA 3VTAA 2D3TA 4R68A 2V0GA 2QA5A 4G67A 4JGIA 3PPIA 4KQKA 1L5HB 3K9QO 4X3OA 1Y5RA 4OYHA 5IHPA 4YAEA 3RFUA 2ZRBA 4DIMA 4EGAA 2JG3A 5B1HA 4L4RA 1SBZA 2ZWIA 4KOEC 5EYPA 3N2IA 3GD7A 4QAJA 3UHOA 4CKWA 4JOQA 5DYIA 1LNQA 1WCV1 2WM9B 3BFVA 4Z9YA 1HDIA 3QIVA 5CNMA 1AB5A 2XCSB 2VNKA 1VA4A 1GYQA 3EVBA 1T8PA 3QI2A 3RS3A 3UB2A 3R6LA 3DOCA 4DQUA 2X5KO 1U3UA 4G07A 2J4CA 2YWHA 3LYHA 4YWJA 4LRTB 5LN1A 3W3AD 2RAPA 5HUJA 3C3KA 5LUAA 1KDOA 3FHCB 2FSHA 3PPWA 5LDDC 4RMGA 4X3PA 4HEHA 4C01A 1SCUA 2GJ8A 2BONA 2OSVA 2FN9A 2I80A 2QL9A 3CBQA 3DOHA 3EZGA 3KJHA 2E5LB 1OH6A 1OIVA 1JX6A 2GBFA 1C8KA 3A4VA 3GEHA 4ZVQA 4BB0A 1OB5A 2IA5A 1JHRA 3JPWA 3JQCA 4LDRA 3P4YA 1HV8A 7YASA 3DAYA 1FX0A 2G3YA 3FOFC 4OK5A 3VVBA 2ATEA 2OBNA 3DC7A 1J5XA 4X1IA 4BO7A 1ZJ4A 1JVNA 2I2WA 4YRJA 3RT9A 1N2CA 2GYYA 5BRNA 4FC7A 1MABA 4MGZR 2VJOA 3VZRA 2VAVA 1NPTO 3SVZA 3R3SA 5EWLB 4MTCA 1M1XB 5H02A 2R00C 2ZZMA 1JAXA 2NAFA 3DWFA 2P2NA 3OT4A 4FZ5A 1GQOA 3NM6B 1YB4A 4UPVA 2PRKA 1A4IA 3WADA 3OJOA 3IEVA 2G0NA 2CD7A 4F9EA 2G09A 4B45A 4GL2A 4LVUA 5I7HA 3QUSA 4BWVA 3EZ2A 3UT5A 5FDFA 4YP5A 5IUJC 2QW8A 2QTNA 4N82A 3ZDYB 2V6IA 1FP1D 3MT8A 1TC2A 4W82A 2VPYA 3AV3A 3KHKA 2OCYC 3TD2A 1UOPA 3X44A 4PG8A 2GEVA 2YRFA 4R7ZA 2PE5A 2R8ZA 3Q8XB 1YWGO 3OTWA 3ZVRA 1L1EA 1XRNA 4BV9A 2GBCA 1WOMA 3MYRA 4HDSB 4J3FA 2WWWA 1WD7A 2O2YA 3KT3A 5G2OA 3N6XA 1P9LA 4DYDA 5BR7A 5KWJA 4RHFA 5GJCA 4XAQA 4IZ6A 2Q0HA 1SXJD 3M6XA 3NWJA 1C5KA 5EWMB 3ZXUB 3RTCA 4BVFA 4DANA 1I2AA 4MEJA 4MQMA 2FSFA 3FI0A 4PX9A 1XTQA 3OEYA 3N2ZB 4GI5A 3LOPA 5CMLA 1CP3A 4IUDS 3H1PA 3RS8A 3VR4A 3WS7A 3ZHXA 3CNLA 4EG7A 2H1CA 1O1YA 3VGPA 4MLCA 1P0MA 2H4YA 5K3OA 4RULA 1YCDA 2C9CA 1BD3A 1ULUA 1CJCA 2H4WA 1X2BA 1V0JA 2A1TR 2Q3EA 3GLHE 3OPYB 1FFEA 3WTCA 3J81A 1N78A 4RKWA 4WZAA 3A25A 4WA7A 4LC0A 4IBOA 1T5DX 2EFJA 3EQ6A 1DC4A 4LF7B 1K86A 4R40A 4R69A 3NDBB 3FMOB 2IZ1A 3KFVA 2PWPA 5JROA 1MTZA 1UAAA 1KDZA 3FETA 2FPOA 1UBUS 3HXMA 4HS9A 2GARA 2Q5HA 3K9BA 3DDSA 4QDJA 2ETXA 1P4HA 1YJAA 2JJ1A 2K2QB 1D8TA 1FP2A 3GROA 3LM8A 4O4JF 4TVOA 4ZQGA 3AW9A 2BYTA 4YCDA 4GMDA 2ATXA 4NCHA 4XLLA 3BC1A 1ZK2A 4BQIA 1O95D 5C34B 1NE2A 2KM1A 1PEKE 3GRAA 2JANA 3BJIC 3L6BA 3WWOA 1JR4A 5FP0A 5ECWA 3KX2A 3PD1A 3O95A 5FOWA 4MUGA 4BDSA 3SJ7A 1EX6A 5AJZA 3LUBA 1A98A 4HWRA 1N9KA 3ZGVA 5KX5F 5EHGA 3NIDB 2I33A 3LX6A 2GN8A 4P81A 1MRZA 4DLAA 3ANMA 4RGQA 1DJNA 5FPSA 3FTCA 4NYJQ 5HTKA 1FSFA 1GQYA 3FZGA 3L8ZA 4X85A 1JJAA 2DRIA 4HLUA 4MYTA 1NR1A 3E3OA 1UODA 4TWAA 1HORA 4OB8A 4YJFA 3AUAA 3PE3A 4KMOA 1FVXA 3HI4A 3ZDBA 3CNQS 2IE8A 1KY3A 1QNFA 5FF9A 5IH3A 3GVXA 5G4KB 1T10A 1NMEA 4G26A 4TGLA 3RFVA 2ZATA 5TE9A 4A7PA 1B8UA 3QYFA 2DPYA 4LYHA 1J8VA 4ID3A 2AJBA 1YDEA 1ZM9A 2IFTA 4P3YA 4ZZIA 1W4AA 4GGOA 5ES4B 3FZEA 4Z53A 4EMBA 3A28A 3VR2D 1LUAA 3BAFA 1PV4A 2M6LA 1ISMA 1VJ1A 3FSGA 4N12A 9LDBA 2ZE5A 1N0HA 4R6WA 4MS3B 3RR2A 3V2IA 3C14C 3QBJA 1C3XA 4KAJA 3R6WA 2BJVA 4X8OA 1DBRA 1IVSA 3Q12A 4V02A 3HU5A 1BVUA 4U8GA 4XX0B 5J43A 1LI5A 4BJ6A 1Z17A 3TPCA 4BTLA 4A4DA 1JEYA 4DLNA 4L85A 4I81A 1EWQA 3L8GA 3D64A 2JA2A 4LBWA 5CXQA 1GA4A 2H06A 4LC1A 1W36B 1NDHA 1M1UA 4YP7A 5BNTA 2V6MA 3CNBA 1K7XB 1OXKB 3K6SB 3RWBA 3KIPA 2WWXA 4FDLA 4LDQA 3QI7A 1L5WA 5DM60 4J76A 3L82B 4WBNB 3OFJA 1SXPA 4DCVA 1XV5A 4WKOA 2I22A 4DRYA 4ED9A 1K5HA 5K8JB 4P22A 1HNZB 3RBVA 2FUEA 1EBBA 4K0RA 5J47A 2OM2A 5SY6A 4WFQA 2EKQA 2JC3A 5I5EA 1QO0D 4H17A 1UH5A 4N47A 3UGKA 2C2MA 1LBQA 2RHOA 1SXIA 2G6BA 4LYJA 4V24A 1UEXC 2X77A 1QQ5A 3DW3X 4WDRA 4I2NA 3V4PB 5HZKA 4F2WA 1WY7A 4AURA 4E15A 3KJNA 1OX6A 1NUSA 4H08A 3TQRA 2H1LA 2VSOA 1T6XA 2BCJQ 1Z6QA 3L7KA 2HJWA 4I7EA 4LPSA 1YS2X 3E5RA 4L15A 4BLQA 1FMJA 3Q8LA 1BDHA 3A6PC 3KKZA 3AM3A 2ECQA 2G4LA 3V2HA 4UVEA 4URXR 1VCMA 1XLWA 3SYLA 5IANA 4L9WA 3RIHA 4DCCA 2Q7XA 2GBPA 3HDVA 5E9WA 4YLYA 3E58A 5I7WA 3ICCA 4G0UA 4JENA 1EVYA 3ZE1B 3U4HA 2V65A 3DQPA 3PRJA 1AQLA 3FPSA 3HJNA 2BC9A 3L7JA 2BR5A 3LL7A 1Z5GA 3Q3GE 4U6NA 1IVYA 4A6PA 4EG5A 2IYLD 3U3XA 3TIFA 4CMAA 1CY0A 1XFDA 2IZ0A 2AHOA 2HMYB 1I13A 3O94A 4HN4B 4FDTA 5B1IA 2QVYX 1QYVA 2GD1O 1KMHA 2V0NA 3H2GA 4QUBA 2Q2OA 3KHUA 4DLRA 4RGYA 7ADHA 4OB7A 1DWUA 1JB1A 1AX9A 4W5HA 1KFEB 1W34A 1XD9A 4CMEC 5EMHA 4NECA 5L8VA 4MV8A 1GUBA 3FXAA 5A0FA 5EJ9A 3AF1A 1ZMTA 2XUIA 3C7DB 4M87A 3ESQA 1G1MA 3SKVA 1DEXA 3IPXA 3ZGXA 1TKAA 4EJMA 2ORYA 5B30A 1E1YA 2CHVA 4P36A 4DBLE 3HY4A 3R3VA 3F90A 1F06A 2D2FA 3KZOA 3KETA 4UM5A 3SCZA 1F12A 3I9MA 5THXA 1T8YA 3CRRA 1C1XA 1FDSA 4DLLA 5M29A 1M54A 4GC5A 3PR3A 3E4DA 3F5QA 4L3WA 4FYVA 2ACKA 4FX5A 1C4OA 1OWLA 2DU8A 1JHAA 3H3FA 4KODA 2IY9A 3ZTTA 4OTZA 1JL3A 1LF0A 2IYQA 3M5WA 3C6YA 4NHOA 4UNSA 2G9UA 1BCRB 2OHIA 3GUHA 5DZSA 1JQ5A 3JQEA 3T6KA 3UATA 1JPNA 3FDZA 3IYLW 1JP7A 1DRKA 3FNHA 3QK7A 4KJXA 1O9GA 4M0CA 4YRDA 4BRWA 1F9AA 4CKWB 1A9XB 1XL0A 4DDKA 4EFDA 4NPAA 1JZSA 1TK9A 2P35A 3B5IA 3PQDA 5K09A 4BNJA 3MTIA 3FOBA 3OF2A 2E4UA 3TEFA 4DLXA 2NO1A 4K6OA 3QKUA 5HWSA 1RJDA 4DNOA 2BFWA 1ZA2A 3EC2A 5DSTA 1DWOA 3SDBA 3IO5A 3FYTA 1F51E 1J09A 1PZXA 3A1EA 2A3NA 3BRCA 3K70D 2ICAA 1KR2A 4EO9A 4X63A 4Y9DA 4EECA 4UM9B 2W5UA 2ERYA 3Q6IA 4E5MA 3A4MA 2C2ZA 3QFTA 3EGXA 4RH1A 4AZTA 2WD7A 2UUAB 4REMA 2QX6A 1Z0AA 3BGIA 3R5KA 4PPYA 2IIVA 4KLNA 1SHKA 3OLCX 1RZRD 1H6DA 2QSUA 3CSSA 3CW9A 2E5WA 2QVLA 3ILYA 3LOQA 1UM9B 4OA8A 1HKUA 3AEKB 4OK6A 3RUFA 2D1TA 4BB5A 5I7RA 4ZIRB 5B2FA 3EGEA 4DWVA 1U3VA 1J0AA 2AR7A 4WLOA 1LX7A 2NO7A 5DM70 2TMYA 4IZIA 4LE1A 4XD2A 3GCXA 4YMLA 1U7DA 1R16A 1NVVQ 5AJYA 3ZHCA 3AERA 1ESMA 4LXGA 3LKVA 1Y8RA 3WWEA 4PZ9A 3K5WA 1RWPA 5DRYA 5BO5A 7REQA 5C2JB 2Z3WA 5HQ3A 1GNLA 2RHMA 2I9KA 2BTOA 2VJMB 3G0GA 1B2LA 3QHAA 4F2PA 3KUKA 1OTXA 2PY6A 3CSUA 3OUTA 1J0DA 2QNRA 4LMAA 3B70A 4WXHA 3R6DA 3KB1A 2HC9A 3G5UA 4I14A 4KHPB 3K0KA 1YDFA 2X58A 4ZHQF 3UMMA 5IP5A 3NAGA 1EXDA 5LA6A 1T34A 5E4YA 1N5MA 2QRHA 2YV1A 1E7MA 3N6RA 2Y1CA 3UJ9A 2H1OA 1C9JA 2X7JA 2VDRB 2HYDA 3DTYA 1ZG3A 3V46A 1I0LA 5I7FA 2G1JA 1MAWA 2V8OA 1QTQA 1X3LA 2QP9X 1G2IA 1U2RA 1WPRA 1RC0A 4CR7A 1AIPA 3MT0A 4E5UA 5DNUA 1CLUA 1ZOLA 1GY8A 4YV2A 1V39A 1KO7A 1RYDA 3FCXA 1E1RA 1GGEA 3X43A 3IODA 5A9RA 2AZXA 1Q83A 1U2EA 5DXJA 5AXCA 3NC4A 3RI3A 3WMXA 3H83A 4D3ZA 1CD5A 1FEZA 3BOSA 5FWYB 4DCSA 1ZD3A 5JWOA 4M55A 1E96A 4UVIA 3PUYA 3O2NA 2H00A 1T4DA 3TSCA 1VPEA 3R41A 2CDAA 2Q4RA 3Q8WA 1JIVA 4JKIA 2YOGA 5DWDA 4MP8A 3H4IA 3LF2A 4OAOA 3DHWC 1GD1O 2JIBA 4J9VA 4OYRA 3RYTC 2JFPA 3GVCA 3AF3A 2H3EA 4R3WA 3KXDA 5DEOA 4O8ZA 1T3LA 2NSDA 4AO8A 3X1ZA 1YE3A 3ZGLA 2A2ZA 1A50B 5KYTA 1HSZA 1Q1BA 4N49A 4MVJD 3AY7A 1OY1A 5FWAA 1TFUA 4P5DA 3ZU5A 4AU1A 5LLTA 3WP0A 1YJBA 3O9MA 5FOUA 1HMPA 5EINA 1UKVY 5B3AA 1P7PA 5EP1A 5AW9A 3A4NA 4WECA 2GH1A 2Q1XA 5FBVB 2I3AA 2QGFA 2CEAA 1TEXA 2EZ4A 3BDIA 3G9ZA 3DR5A 3RUEA 1AKYA 4XDGA 1TF2A 5DBHX 3LBNA 3GIWA 3LGAA 5AK4A 2VUSA 2M6KA 1GADO 2IZ5A 2QMOA 4ZO9A 2BELA 4HX2A 4D45A 3ZIAD 4S2UA 4G8BA 4M99A 2ZLBA 1A4UA 4UAVA 4AG3A 3T1YB 2BGUA 8MHTA 1QZ3A 1QZZA 3PF8A 5C4MA 3UOGA 1SURA 4KX5A 4MH0R 1JHQA 1KYIA 2ZWVA 2HK6A 3S81A 4MUFA 1BGVA 1XQXA 2R00A 4Y2UA 3VPFA 1ANKA 1CJMA 1FXSA 3KO8A 2PUAA 1ZN9A 4Q39A 5AI5A 5ELMA 3TF5A 2JVJA 1FSZA 3OAAD 1XMIA 3RVDA 3OOSA 1SCKA 2YZNA 3B89A 4B6GA 1VPWA 5CB4B 1X74A 2G67A 3G7NA 2JFUA 3IAXA 2VDNB 3X1KA 1JJVA 4EARA 2RONA 1HDOA 2Q5FA 2ZE6A 4RJ2A 4U2KA 3QV1A 1ZD1A 5F5XA 5KYNA 3FYHA 3JQ7A 4WESA 2PIDA 3PLNA 3FN4A 4BFZA 2X4LA 1YFJA 3EDOA 5A3QA 5JCPA 1YQQA 5JPDA 4PO8A 1ZVMA 5H8WA 3CRZA 1YA6A 2VXOA 1EFTA 4ZTUB 5HYVA 3QMWA 3IJRA 4YXFA 3PA6A 5JRZA 4CRWB 2JHGA 4ER7A 5ESDA 1O6FA 3OIFA 4ITRC 4NEHB 3PTLA 3F73A 2PT5A 3DBVO 1DQSA 3ANXA 3HU1A 5I47A 2WUFA 2GDZA 2P7IA 2HZ7A 4R1OA 4MZDA 3W1VA 3C39A 3CRNA 2L0XA 5FBLB 1V8PA 1J20A 3STTA 4GZ6A 3O4GA 2QUAA 3SWWA 1R1DA 3U5ZB 3U7HB 3IQHX 2XVMA 4BMCA 1PK9A 2FZ5A 3I2IA 2J0SA 2W2LA 4RH3A 4A91A 5FIUA 5FD8A 1J9ZA 4TTTS 3SQWA 5FPTA 1IQ0A 3SM9A 3NM5A 4K46A 4L57A 3G9QA 3H6GA 1V3TA 2K2WA 2QG9A 4RK1A 2ZS8A 3STVA 3M4JA 4Z9XA 2ONZA 1CJBA 4OBBA 2H7CA 2DULA 3EVAA 4BPRA 2IXEA 4XSHA 5MGBA 4MIOA 3FZNA 3CSDA 4FHFA 4LDJA 1WG8A 2OUIA 4H4CA 2CYAA 3OURA 1YFKA 2Q3LA 3DFIA 3DOOA 1FFDA 3GA7A 4L76A 5F77A 4Z7OB 4G4SP 2CWDA 1GM5A 7GPBA 1MC8A 2C8VA 1FQJA 1FVFA 1NKSA 1D8AA 1QIGA 4BX2A 1CB7A 2XEXA 1OFVA 2YBDA 4MV6A 1YDMA 1UMKA 4DV7B 1SBIA 3TSOA 4L3OA 3I73A 1SCDA 1VBKA 4EY4A 4FXPA 3ZLTA 1NDQA 1ZJJA 1FLNA 1RJ9A 3VH2A 2IUSA 2RGEA 4LYYA 4HAZA 3IP5A 3V42A 3KE9A 3T99A 4HKTA 4LF9B 5AM0A 5HE8A 1HYQA 4KYUA 4P3PA 4C87A 4YY3B 1E2LA 3WLIA 4A27A 4ECAA 1P8JA 1U0RA 1W73A 4Y1FA 1QCCA 2OGSA 5E7IA 1GG8A 3LP6A 5E9QA 3P0FA 1A8PA 1KI6B 1KP2A 4BHTA 4D8VA 4EY3A 4QJ3A 5LDHA 4GW3A 3CH4B 1DRVA 4UC0A 2ZG6A 3H9BA 3GHYA 3E81A 4DIEA 3R09A 2J0QA 2FQYA 1WCYA 4HQFA 5BYKA 1B6RA 3VPXA 4FFPA 5A03A 1M75A 2P3SA 4QLOA 2HSZA 2FGKA 3P7MA 1PS0A 2VSYA 4NNPA 5IC6A 4R3UC 4Z3DA 3HWSA 3QU7A 4Z8XA 3WC4A 2P69A 3LUAA 4Q0MA 1VCHA 2QTCA 3OE7D 1GRRA 4AKSA 3NAZA 1OHHA 2DBZA 3ZDXB 4RCZA 2QV7A 4PLZA 4C0JA 4ENPA 4CKBA 2JASA 3D0RA 3NEYA 3PDCA 2QX4A 2O5CA 4P8RA 3WLSA 1V47A 1WXXA 3NP7A 3U7JA 2AUTA 2P9HA 4U9UA 1M66A 3M6AA 2BT4A 1MX3A 4H7EA 4M9ZA 5EAIA 3U26A 2GO1A 1SKAA 5JCOC 4IZOA 2QDKA 2PWZA 2DHRA 3HV0A 3OJXA 2X9GA 5F2KA 4CTKA 1XK7A 1CRPA 5A7HA 4WGFA 5JCZA 1WAMA 1T0BA 1YNOA 1USGA 3HCNA 5CHEA 4BVJA 2AG8A 1MQSA 1BJTA 1RADA 3WIOA 4RVUA 5DI9A 3RC8A 1R4ZA 2WF9A 4OOEA 3QMMA 3B9BA 2RGYA 3NUGA 1Z5ZA 1GNRA 4KN8A 4CG1A 4KFTA 2D74A 2ZVJA 3TTSA 2NZUG 1NNSA 3LDFA 5GQSA 4F6RB 4O63O 4QODA 1U8CB 2H08A 3VKHA 1X92A 3CLSD 4YPFA 3GAMA 1FYEA 4EABA 1JJIA 2N42A 3EXIB 5C1DA 2AI3A 4KGDA 2COKA 4HLUC 4JCOA 3SU8A 3HJCA 5KS2A 4JYPA 2XE6A 1M2KA 4CEJB 2IQIA 3D2LA 1OH8A 1GPYA 4OM7A 5ALWA 5EEGA 2UZ1A 3WR5A 5E0KB 3OP4A 4TV8F 1RCTE 4KSYA 2QWXA 3NGMA 4J0IA 4Q7QA 1MAHA 2OV6A 3GDHA 1IZ0A 2LDBA 2Q5QA 3KP1A 4N65A 5H4HA 5F1YA 1L7QA 5JJLA 2DR2A 1Q21A 4NBSA 3GLIE 4JK3A 2E6KA 3F6BX 3NO4A 2D0PB 3PUXA 4J16C 3OF5A 4R41A 2M32A 1OU0A 5LQJA 3WG9A 3B1ZA 2YOHA 3F4BA 4IH4A 1XEXB 5CURA 5I4IA 4RJJA 4JLAA 2V6GA 4KQHA 2IV3A 1VGQA 1VC2A 2O3TA 2WIDA 3QITA 1RHRA 4MR7A 4EB3A 1NG1A 1W4BA 5CDHA 1JHXA 1H3NA 2CYBA 1DDIA 1JVBA 5I48A 1ZK3A 3TTXA 3H8SA 5F98A 3P0EA 2D54A 1CT9A 1GTVA 2LNDA 4U2GA 2X0IA 1CQWA 3DHNA 4TMWA 3IV9A 2LD4A 1TM4E 1MW8X 2O3SA 1YS9A 3PIDA 3EGXB 1IXRC 2B7CA 3N7TA 1BE1A 4FFWA 4WLFA 3P2OA 3VMMA 4JJFA 4FB5A 1JLMA 3L05A 1WIWA 4CIAA 1GAXA 2EG5A 1ZO8A 5IBRA 4K6FA 3AP3A 3FGZA 5JV5A 2XBLA 3KVYA 1GKYA 5HZMA 3KQQA 4B3RB 2AXEA 2XCUA 1GAQA 3RBAA 4AYXA 4C7VA 1PDWA 3PX7A 4KWEA 3BMOB 2F64A 1AQUA 2HRBA 3JR7A 3DAHA 1ZC4A 4ARAA 2PWYA 2AG1A 3W1WA 2QP4A 3PT5A 4MUKA 3P9NA 1PJ4A 1SKQA 4LZAA 3RHSA 1AKQA 2QR5A 4EI7A 4FR5A 2ILTA 4JSTA 3VH3A 4I55A 4E03A 5JQWA 2B4RO 3PSAA 4XCXA 7MHTA 5KNDA 2ZZNA 1J0XO 3EVTA 3FKQA 2Z95A 1Z3CA 3DBOB 1KMMA 3H2HA 5IMBA 5KTTA 4FMCB 3MGBA 1QZTA 4MJXA 5ES3A 5GM1A 4AUKA 1VCNA 3F9CA 2CN1A 1QHEA 2ID7A 2G8LA 9ATCA 3PGVA 1STOA 4JJ7A 4TTVA 2GBLC 3KOOA 4D4GA 3K70C 4F5EA 5MF6A 5HZGA 1RI2A 3VPSA 2X0JA 3F3MA 3ZWYA 5I8WA 1JAYA 1BXGA 3OLXA 5CCXA 1NFRA 1OLXB 2W2XA 3EDCA 1OLUA 3HUFA 2A9QA 1EUDB 4J0HA 1G9SA 5IBQA 4A8TA 2BGMA 3RM3A 1FMTA 3MF4A 4LBZA 1UZAA 4HXYA 3X1MA 2YN0A 4QNRA 3OZEA 5EJ7A 1VL5A 4F04A 1V4VA 4YQYA 4WFJA 2WEKA 3G2MA 4WKBA 4JLSA 1PFUA 3FVTA 3S2UA 1OX4B 5JI3E 4RD0A 3KVVA 1NVXQ 4N0EA 3K73O 4B1FA 1U1EA 1U99A 3Q0EA 5FWYA 3IDZA 1PLLA 4F06A 3AWIA 2A5JA 4YJ2B 1DO0A 3DKKA 2CEKA 4HN9A 3DG9A 4UOZA 4MYSA 1QK3A 1TAHA 4P4TA 4R51A 2NO0A 5JTTA 3TMAA 2D8AA 3IQFA 4Z9BA 4DILA 3TGWA 5A1TA 3DOIA 2CVPA 2OCAA 2FQXA 3H9UA 3VISA 1N0VC 5DHQA 4TMTA 4EIWA 3MLBA 3QKSA 5GWXA 2NSYA 1U9IC 5C5IA 2VZ8A 4F2DA 1JSRA 1ZJWA 1T8SA 4XDHA 3NVKI 2WM8A 3BL6A 1B8VA 4O02B 2I66A 2J5RA 3OO1A 5D7NA 3TJMA 2J09A 3FPHA 3NTLA 4IQFA 4WGGA 1HE8B 1U0SY 5BYBA 2K7FA 2J30A 1DDGA 4KE7A 3DKPA 2JJQA 2V9CA 3NH9A 1S3FA 1W0JA 4KIWA 3MAJA 1VPVA 2P7HA 1IXKA 1FRZA 3I76A 1YR1A 2WF6A 2WW8A 3GVIA 4R1TA 3TGLA 4FWIB 4MLZA 2QN7A 4YRTA 5EIEA 2YWCA 2J9ZB 4FMDB 4P4LA 2QRZA 4NAVA 3FNIA 1UMDA 4JL5A 4WN9A 2QJRA 4CW7A 1X1EA 4G0OA 1WXFA 2AXNA 4BV3A 2CL5A 2N3ZA 1EM8A 2R47A 2ZIGA 3JTEA 2BCGY 3QG5A 4IILA 1ZGZA 2DQYA 2Z8ZA 3AUJB 1FPQA 2PUTA 4JJIA 2GCOB 2OO7A 4QPJC 3QHQA 1VZ3A 3F74A 3ZK9A 2P90A 3MILA 4QUEA 2QVGA 4CM6A 1VDMA 3G13A 1DKMA 3PDJA 4TLDA 3W3AA 4YAWA 1R0KA 1EAYA 3DZKA 5DNVA 2AVNA 4LHZA 2TRSB 4MVYA 4DDHA 5BWCA 2XNJA 3EZLA 2XRFA 3HCFA 1AGXA 3ZIDA 4GPIB 4BRZA 5ELLA 2XH8A 3TPZA 1TTTA 4DJTA 5CUQA 5IUNC 4E09A 4L3VA 3V9PA 1VIYA 2GPTA 2AYXA 3HCWA 4IO1A 1QKKA 3EPRA 3HCAA 5E38A 5K4GA 4KR6A 4Q4JB 4ME6A 2WSSA 1A7KA 1EMDA 1Z06A 2FWRA 1Y7TA 3MIZA 4BVEA 1X6VA 3UJPA 1MP0A 4QTTB 1KMNA 2FG7C 2HTEA 4XYBA 1BVRA 4DE5A 2ZBUA 2VNJA 3LC7O 1XD2B 2IYFA 2PFKA 3EIFA 4PYNA 4M9CA 4QTYA 1E2NA 3ORRA 4I50B 1DOHA 3FROA 3A9RA 1PEYA 1V48A 2YS6A 3MMZA 1D7OA 2C5FA 2VK4A 2ZJ8A 3N74A 2DAPA 4DM7A 1M34A 2BHTA 5B57C 5ICGA 4DR1B 3EODA 4E2XA 1QVWA 4NG4A 5ELXA 3NHJA 2F1JA 1EJ0A 1FFBA 1D2AA 1RM4A 2WA1A 2W4MA 2JEOA 5BN5B 3WLQA 3V1NA 3U4QB 3ORFA 3UB4A 1IOZA 5KYXA 4BOYA 1T5LA 3C8DA 4ZI7B 5HFJA 2QRPA 4HDKB 2CVHA 2ZEJA 1FDRA 2Q41A 1SFRA 2ZI5A 1KXJA 2PRYA 4M1TA 3WMFA 3ZCXA 2R96A 3AJRA 1VLMA 1CRWG 5BN3B 1JDNA 1QVZA 1WXGA 2N9UA 3IXMA 3K9HA 4H35A 4K87A 4M88A 1RLUA 2OYCA 5INTA 3ZVKA 3OECA 5JSUA 3OQJA 1I4TD 4BU0A 4DMRA 2H0QA 2XHZA 4DJDC 3L1JA 5IT4A 5FOSA 5AVTA 5K6RA 3JQBC 1N5LA 1NU8A 1C7RA 2FCRA 1B7GO 4XW2A 3TMYA 1NW4A 1VLVA 1XO1A 3BHIA 3CNHA 1A5BB 4KHZA 4P4GA 3RK1A 3SIRA 1ZU5A 3WGNA 2BGNA 2PDAA 3DEYX 5F7JA 3WL7A 4F3NA 3RRFA 2LCIA 4LMRA 3ROKA 5I7SA 1BJRE 3E5MA 4GKKB 1EFRA 2UYGA 1XU9A 1N6KA 3NG1A 3T5AA 2W48A 3W8FA 5EIBD 5D5PA 4IKPA 1WMAA 4MRAA 1XLVA 1TAQA 1PD1A 1MZVA 4OP1A 5MFZA 4LYFA 4JDPA 1VRCA 1DWQA 4NJMA 4TKZA 4XIFA 5AUNB 2JI7A 1G1AA 2VTEA 4RS3A 5KTYA 4B4KA 1DTWB 2A0FA 3IVMA 2G06A 4M53A 4O4LF 4UBIA 3WJAA 2C1EA 3AF5A 2OQVA 4CM9D 2PD4A 2DCUA 4UCQA 1Z0SA 1ZYUA 4NBKA 2CYCA 1Z29A 5FB3A 4HXGA 3QTTA 4WT7A 1HDZA 2TECE 2RKBA 4KLZA 4AZ0B 3HXOA 3THXA 2D1QA 3IULA 1PDOA 1EU1A 2J87A 3FCOA 3KALA 4MS1B 5BSGA 3C6MA 3DYBA 2LW7A 5LUBA 3I23A 5ALEA 5D8DA 2B4QA 1RQPA 4Q3DA 3FPBA 1I6LA 1S1CA 2RKWA 3WL3A 3FFBA 4HFMA 4BMZA 2HA0A 4DR6B 5DW0A 2FPUA 1WQ3A 2NU9A 3RKSA 3JCZA 4ZIRA 5F2EA 2O50A 4Y2XA 2WD7B 4EZIA 1Z6XA 1T8WA 3BL5A 4URUR 3IAS1 3KSZO 2VUHB 3SXUA 1X7YA 1IEQA 4L27A 4HPXB 4R2LA 1E2BA 4IDOA 4NZPA 1R88A 4O1IA 2W2QA 4EBBA 1V96A 3LUDA 4AM8A 3O4HA 5ADWA 1BKYA 1JWBB 3HSYA 4LBVA 4M1MA 5FNVB 4NOKA 4CZ2A 3SC4A 5LP6F 2G76A 2C96A 4Y1GA 1VHLA 4EYEA 1XZ8A 3D7NA 4US2R 1ISJA 1TVEA 2X1VA 3ADPA 4E3WA 1WJGA 1S6YA 2Y1LA 4PVCA 4I8XA 4GVPA 3NM4A 1KH2A 1AH2A 2GTPA 1GKKA 1S8FA 4DB2A 1XZMA 2NZJA 4CLOA 3LRPA 2F4NA 5I9TA 8GPBA 1GUAA 5EZYA 1Z4IA 3EXFA 3ZZMA 1UKEA 1IJBA 4ESOA 2I6SA 4DJEC 1Z0ZA 3TSYA 3F97A 3VDXA 1KYTA 1S1MA 3GWGA 2JLZA 1YE8A 2ZU6A 3AZPA 4BMNA 1IWPB 1CS4C 5KPJA 1GZSA 3TZBA 3D8NA 1QR6A 1PQWA 4QOEA 3CUKA 2C5HA 1EBFA 4LI0A 5LOVB 1RXSA 4LCBA 3DXZA 3VO9A 1Z07A 4NZOA 1DARA 4PYIA 3VYWA 2QPAA 2VJQA 1P19A 3FGNA 2CSXA 1DJMA 4QO8A 1DT3A 5DHRA 3WK9A 2DHCA 5LZ8A 1K89A 2JZOA 4BRSA 1W59A 1AGNA 3BXOA 3NNDA 2FVXA 5ALQA 4A0SA 1VSBA 1OB2A 4S2EA 4ZARA 1QOPB 3S70A 1NTOA 4N7RA 5K4HA 4WXYB 2VJAA 5HJEA 1PZEA 3HA5A 1HC7A 1J0EA 1J1ZA 3E82A 4TLLB 4E13A 1WXDA 3V7FA 4C7OB 1N1GA 1U3TA 3O3MB 4TN1A 3LXRA 3M6UA 2X7XA 5KSPA 3V7YA 1KJNA 5JY1A 3V2UA 3OFND 5I3ZA 4I36A 2OCPA 5AW5A 5SICE 1SU6A 1C0EA 1DADA 1WUIS 5DX8A 3VUEA 3FTEA 1QH8A 3IUEA 4FIZA 2JBHA 3KKNA 4B4DA 4F3YA 2C29D 2FZGA 4TKVB 1XZJA 3VYRB 3HM2A 1N5JA 3F6YA 3HJGA 1ONNA 2OGWA 3DOFA 2VDWB 3Q98A 1JKXA 4I1UA 3ZIAA 4LFCB 1M5UA 1ULTA 1WE2A 3WGZA 3MJRA 5FOVA 5B58C 3WGTA 4HGRA 2BEUB 1CJUC 4S35A 3IP9A 4GD3Q 1KYWA 4CMEA 2OYSA 4FN5A 3GLIA 2B37A 1ZMRA 2X22A 3U3OA 5KIAA 1KYVA 4ZAVA 2C92A 5KAPA 3MWLA 1Q0ZA 2YRWA 5ALIA 5BVGB 3GARA 4LX0A 5IF3A 2NU7A 1JA0A 1DBWA 1NR7A 1L5ZA 1UF9A 1VMAA 1W0KD 4IH9A 3RIEA 4BFTA 4K2AA 3LLVA 1N4AA 1Z08A 5CDFE 3QMVA 2QM0A 3WK4A 2AF4C 3VOTA 1W9MA 3HCDA 2VDWA 4RL4A 4F11A 2BKEA 1Z2EA 5D1NA 1MRNA 4ZU3A 2BKLA 2GI4A 3RANA 4K1LA 4XQGA 3OLYA 3HCBA 3IPRA 5K3DA 2QT1A 4B6SA 4ZZ0A 4IZHA 3U3RA 1KAGA 3FMFA 2ZS9A 1NQUA 1OWOA 1H9AA 1I2BA 1VJ0A 1WZIA 5HGJA 4CT0A 4H7HA 4D6YA 3ZHYA 1UDBA 3LD9A 2IY7A 5C8YA 1N2GA 1OBVA 4TKLA 5GZ3A 2X41A 2VJLA 2Y0PA 4WUTA 2F7SA 2JEZA 2VK8A 4MO2A 2GGSA 4URZR 5CJ2A 1QS0A 1KIMA 3JVEA 2XVYA 4HGYA 4NVRA 2P78A 5FHQA 1Y1RA 4CQNA 4MRNA 4MS3A 3TQQA 2PUWA 1SBHA 1KJ8A 3N8IA 1J25A 1SK8A 4QOJA 3EXG1 2E37A 4IGFA 4M21A 3TNFA 4ZJYA 3ZWCA 5DASA 5ICSA 2UKDA 1RIIA 3HLYA 3ND5A 3JXEA 4K5QA 3WQHA 2QBYB 2D1RA 4IS2A 2IWRA 5A2QA 4QL3A 2RHGB 1W5AA 2PPLA 4NZMA 4P0TA 1RZ3A 3VV2A 3UCEA 5JBNA 5L3SA 3CFYA 3ZZ0A 4F7WA 1ZN8A 4NDZA 4BPBA 1X15A 2OXFA 5K0EA 1QBKC 1GAEO 4JXKA 5T57A 2DUUA 2QP3A 3L79A 3QKIA 3WFZA 4H1VA 4AK9A 5JECA 2JGLA 2V74B 3ES9A 3OZXA 1UP7A 1QU2A 1TCUA 3GEDA 3IAM1 1IHDA 2DF8A 2JFHA 2Q1SA 2C07A 2Q9BA 3W2EA 2W42A 5J2UA 1H8HA 1JDSA 1H6CA 2Q3DA 2XNHA 3BCRA 3CLHA 1NWCA 3MBIA 1FJXA 2P3LA 2BTEA 1P9WA 2INGX 1LXCA 4IDGA 3DQZA 4BO1A 1GZUA 1ZRMA 4GMHA 4FIDA 3NGXA 1XYVA 3A7EA 4FUTA 1WDLA 3IBTA 2JGRA 5U4XA 3VOAA 2ZJFA 1MA0A 2CDBA 1DIBA 1WETA 3SFTA 3Q6NA 1MOPA 4NYMR 2O8BB 3BXHA 4O4JA 5E7QA 1KORA 1JAIA 4Q9NA 1CR0A 2H8KA 4Y6PA 2VJPA 2REXB 4PWYA 1PNVA 2IKSA 3K16A 5DCLA 4RC9A 1NUPA 3T15A 3COJA 1WB9A 4PYOA 1ARZA 2D59A 1DFGA 2H59A 3CGGA 4MHTA 2HLDA 3GMSA 1VSVA 1GR1A 3DVSX 5AVVA 3IX7A 3NAQA 1LRLA 4P53A 2P6UA 3WIUA 5JEEA 1EESA 1DTEA 2CJYA 2QN8A 4YRIA 4XWYA 1OHHD 2WF8A 2ZETA 5JD4A 1IN7A 4OBWA 5I7OA 2MR6A 3NUZA 1VIDA 3RLFA 1UBJS 4A2QA 1UC9A 1JE1A 2DWPA 3OO0A 2ZRHA 4FU0A 1Z35A 2QR3A 1DT5A 2P30A 3FR7A 2Z04A 3EC1A 3MG9A 1D2EA 4LYAA 4MYCA 3WLEA 5BSKA 2RIPA 1C8BA 3VO2A 3TUIC 3O7WA 5BVHB 4DM4A 1SXJA 3MGGA 2PLRA 5IVDA 5T6BA 2EFEB 1F1BA 4Y3UA 1SQ0A 4TTSA 2BFEB 4MTLA 3Q7IA 3T3IA 2Y6VA 5DGTA 3HFGA 3FZYA 2Y92A 3QJGA 4IAOA 5K1ZA 1ULHA 5A0VA 2WV9A 1K88A 3BIJA 2NZ8A 1FTSA 3K9NA 3T94A 1NG9A 5HILA 3CJRA 3TFOA 4IKOA 3CW8X 4U0JA 5IBCA 1HYGA 3DMNA 4MAAA 4HTAA 3TDNA 1IBRA 1ORVA 3WGQA 1MV8A 3I4LA 1YZYA 3CINA 3AILA 4HLCA 3JALB 2I2AA 4J1TC 4CIDA 4E1VA 5FFFA 6YASA 2EKLA 3ENZA 1I51A 4FINA 1MJGM 4R8KA 3B85A 4TMYA 5REQA 3T7RA 1JHPA 1L7NA 3V8VA 1R37A 3OWXA 4I6EA 3V7WA 3EEBA 4JBGA 2YJTD 4IHJF 5CDUA 1E3LA 3G2JA 5JYBA 2Z6UA 1L5MA 4MQEA 1CQJB 5EWJB 3MRTA 2PMBA 3G7SA 3KHTA 1LBSA 4GU5A 4TL7A 5GONB 3V55A 4KN9S 4AIIA 1JMVA 3OQOA 1NONA 1P1JA 2PS9A 1EFVA 4QRIA 4XGQA 2A9FA 2BEKA 4PPGA 5T8KC 1UT6A 2GKSA 2WM3A 1VE6A 1L5YA 2FZLA 4UATA 5KKCA 2ZCUA 3S2YA 1N8SA 3H2JA 1RRFA 3WLHA 1TJYA 1PI3A 1FNCA 2SHKA 2G9RA 3KTDA 4DZRA 3JU3A 3P5BA 5DT9A 1P1BA 4OI0A 1NAIA 1V71A 5AVZA 4LGYA 4RZ3A 1DJQA 4MW0A 3M4XA 1D03A 4QEDA 1TCBA 3CF4G 2QLMA 5FOTA 5BY2A 5IDXA 1CNFA 1UOQA 2JFWA 5A5GA 4W5TA 2ZE8A 1RMQA 3B38A 3B9QA 2WHYA 1Z2AA 3OEHD 4KFSA 2PRIA 5EHIA 4AN1A 4DEYA 3WZLA 2JCVA 1WOYA 3IO3A 1MIOB 2YBEA 4X6LA 3L04A 4D02A 1GRVA 1ODIA 1S3GA 3O73A 2C7RA 2Z2KA 4P2GA 3ESZA 2AZMA 1DAMA 3SK0A 4MWZA 3VNUA 2A1UA 1I3LA 3ECSA 4DR4B 2I8CA 4M7OA 2WHXA 1QIJA 4UAUA 4A82A 4NCXA 1ZRSA 1NIJA 5ADHA 4D57A 4EH1A 1Z6ZA 2EBUA 4FYJA 4L4UA 2NUAB 4NBNA 3LY9A 4AZ3A 4RETA 2ODPA 3GZTB 3CPJB 1NUQA 1EQ2A 2ANCA 2NXEA 2VPQA 3ANSA 4JYMA 4XYGA 1NVVR 4RVFA 4CM4B 1GPWB 3OG9A 3Q9NA 1PRYA 1QGUA 1W87A 2PX2A 2FN3A 4AJHA 1OU4A 4WOKA 4UZSA 5H80A 3RO7A 2YQ4A 2VF4X 3PEEA 2WU8A 4JOCA 1KMCA 2GAFA 3A2NA 3LUPA 1WUYA 4NYIR 4WCDA 3GLHA 2NTEA 4GOKA 3DTNA 4PX3A 4XQ9A 4P4UA 2YN2A 2H7YA 2R68A 4RD2A 4M0KA 1MN6A 1XN4A 2GNOA 2VXCA 2P40A 4YXWD 3TI9A 1J2YA 4PZEA 3NRBA 1GQRA 1ZMOA 1Y5NA 1LPPA 2J48A 3CXUA 3HUEA 3JAWA 4FBLA 4LGCA 5K0LA 3IT2A 3DPUA 2GXSA 1ZHFA 3PUVA 1JA9A 3MW8A 1FFSA 4LUCA 3RVRA 3DEHA 4LC9A 1ENOA 3IMKA 2OZPA 4GGMX 5HMMA 3GB9A 5TQ0A 4F92B 1ZQ9A 5T4HA 1NXTA 1LSJA 2ZYGA 1B14A 3HJHA 2XNCA 4GOMD 4W7SA 2HXSA 2E48A 1V5FA 2DPGA 3BH0A 3DO5A 1TLTA 2FW7A 3SHTA 2XODA 1L4YA 1R64A 1RBMA 3IUYA 2JZCA 4IG9A 4XDZA 5HM6A 3JATA 3MBKA 1M2NA 2ADMA 3GAAA 4JD5A 5H9VA 1Y3HA 1JJFA 1XDBA 3DZJA 3MJ4A 3PJDA 4TUYA 3GEMA 5LKAA 3CUEF 4G0YA 2QX9A 2WMDA 4BEWA 4MSUA 4R9RA 3WRYA 1SVIA 1UJ6A 2MINB 3DE4X 5I9SA 3TBFA 3ROEA 2VTBB 2DKNA 4C14A 4TVBA 3TB6A 3IIIA 3BGSA 5C80A 3SJZA 3HP1A 3IE0A 1C2TA 4H3SA 1KAQA 2DWUA 2GHQA 1M6NA 4QECA 1CZKA 1SKYE 2IYOA 4GICA 4J2HA 4PCAA 3ORHA 4RZIA 4NDNE 4TMKA 4YJ3F 1SULA 5DBEX 3WMEA 1JHMA 1V8ZA 1OFHA 4JJZA 3LBFA 3RTGA 4BLTA 2ZVDA 3LCMA 4MW7A 3WLKX 1BE6A 3SJAA 2Q8NA 1UBLS 2D5AA 4JI1B 2PYIA 4X6UA 1M2EA 3NTUA 1JTEA 1GN8A 1PZFA 2OAGA 1M0EA 4HLNA 4IICA 1E1DA 3VPCA 3ZR4B 2FKAA 1QVRA 2N1MA 3TGPA 3BRWA 2QD3A 3M6MD 1BEUB 1RM3A 1YQUA 1ZGJA 3KM0A 1MQ8B 3AK4A 2JJ2D 5G1NA 1LPOA 1R6TA 4L9RA 2QZSA 1KEUA 1TMYA 4NIMA 3RSSA 4HGNA 3VZBA 2G80A 4BO2A 5J2UF 2BKUA 2YICA 2QN9A 3AFIA 2NU8A 3UPUA 3LBYA 4ARIA 3R9XB 3QEKA 4IOMA 2RMKA 2PLWA 3FPFA 3WLRA 2R6DA 2YHSA 3CWQA 3LX4A 4MKXA 1EJBA 3UVEA 2GD0A 3CCBA 3ZDZB 3B6IA 3P8ZA 2YYSA 3QFFA 1GGNA 1P9RA 3MYYA 2GYUA 3NBQA 3NFRA 4QXQA 4E1AA 1DZIA 2O2ZA 4Y6LA 3L5KA 2DC1A 5F2OA 4ZYVA 2OP1A 4M1WA 4RS4A 3OOWA 1RJWA 4NV3A 4KFRA 3KELA 3NORA 1TM5E 4LFBB 4GM0A 3B1YA 4F5WA 1CJKC 1HFEL 4GSLA 1DAHA 3DGEC 4X60A 3BSFA 1EFRD 4PAWA 3II6X 1OT3A 1SY7A 3S68A 2O52A 3AUSA 4RPCA 1XRPA 1NR5A 3K0AA 2JIZA 5FA6A 3CEJA 4KZPA 2XTMA 2CMDA 3MRSA 1BOOA 2J0UA 2Y2VA 1A1SA 1ISRA 4NY1A 5KTMA 4UEOA 3W5UA 1NY5A 1Q3HA 2UYYA 2VYVA 3TIGA 2VHQA 1QP7A 3ZJTA 2V54A 3NIFB 4R8MA 2F8MA 4MKIA 3DKRA 5DP1A 4EHLA 1ZNQO 3PEVA 4RF4A 2WJAA 1LKZA 2GRJA 3OQHA 3SS7X 1LJ8A 1QPBA 4BNKA 1CQZA 3OD1A 3VO8A 4Q4JA 4UMDA 1V9SA 1SBQA 1WP4A 4KPUA 5IKXA 3MD0A 4GEKA 4PZCA 2EC5A 3CO0S 1C4KA 1F2VA 4L5BA 4LRYA 5CFOA 4Q4HA 1QHSA 1E2QA 5HUHA 4LHWA 3KQSA 1C0KA 4NHEA 2FEPA 1YD7A 4RPJA 2C4HA 5L6LB 2X8JA 3K0AB 4CG2A 2ZCVA 2QBYA 5EJMA 2RBEA 4DJAA 4D3FA 1F8FA 3Q5EA 2ZOSA 4JR2A 4RX1A 1Y5MA 4MJLA 4NYMQ 1O77A 4JBIA 2X8WA 5KC8A 5JJBA 3GC6A 3IBGA 1QZUA 1HT2E 1DIOB 4RMNA 4ZVUA 2VSNA 3K9FC 2WMYA 3LO8A 3HO6A 3GDOA 4XCVA 2XRZA 2I3ZA 3IKVA 3OOYA 4ND5A 1M0WA 4TS4A 4NF2A 1YB5A 2IEAA 3AKYA 4LGMA 4NU5A 4X00A 5A3VA 3EVCA 1TU0A 3M6VA 3IRVA 4OI1A 1GARA 4C29A 1L5HA 4YRAA 2D0DA 4RADA 1NN1A 1F5SA 2HTFA 4ZWNA 5H3CA 3UJ7A 4CQMA 4GWGA 2MSCB 4FGSA 2NTNA 4XPIB 3H65A 3ROQA 4D1YA 2HX1A 6ABPA 4CKCA 5KC9A 2OE2A 2R6AA 4LF8B 1TEVA 4D3SA 5KNDD 4HJRA 2FY8A 3ICOA 4TYMA 4ZZ1A 1HZJA 1K9SA 2QTVA 2REOA 1G3UA 2OB2A 3ZZ1A 1NL3A 4OM8A 5J4LA 3DYVA 5JQGF 4MPJA 3H7AA 3MQFA 3C6QA 2JJ1D 3K92A 5EUMA 1AN0A 1ONOA 4WK4B 1VFPA 1DG9A 2C2XA 1YK1A 3EPPA 2HJHA 3N0WA 1H0RA 1MJHA 3G85A 5ALXA 1BIFA 4EQ6A 1I4LD 3K8YA 4LJ9A 4AROA 3ZU4A 1OI2A 2E4ZA 1NV9A 4FYYA 4U02A 2Q2VA 1R8YA 4LSWA 4RBNA 5TPZD 2B1RA 4E7PA 1G2QA 4J2OA 4N3NA 4QWMA 3GY0A 5JAUA 1UWVA 2XWSA 5CX1A 1GNQA 5JANA 3FG9A 2F59A 1FK8A 3FI9A 4MNTA 2IUFA 1U0JA 3GBVA 1NYRA 1C1DA 3WJ1A 3THWA 2YHIA 2QTHA 2UVPA 2ZIEA 5K3BA 4HEJA 2C0CA 3M2PA 1T6BY 3V1TC 1WBBA 1O97C 4JI5B 3WO0A 3L9XA 3MCZA 2EQ5A 2B8EA 2XDWA 1YQTA 4IDHA 2QW1A 4X1IB 4A0QA 4TXHA 1PUXA 3O8QB 3TKYA 1L5VA 1J8MF 2ZK7A 3BQNB 1GKIA 4KBGA 5IT0A 1FRFS 1R4NB 2CKDA 4IW3B 1P2FA 3I58A 4V39A 4Y2PA 3M3DA 4L2IA 4JBNA 4HF7A 1LFAA 2AG5A 1YBFA 1EWRA 1G6KA 3I3SR 4QYMA 1Y80A 2H2AA 1FNBA 3FOWA 4D25A 1YQEA 1E8MA 4HN2A 4MB0A 2QE7D 3HKEB 2BHSA 1TLFA 4RF5A 1U0OC 3A9VA 4HDRA 4JX8A 4YMHA 3RAFC 1A76A 1PZNA 3NS7A 1OLSB 1RLJA 3ZDRA 3GT4A 5MN6A 2FOIA 3E4CA 1U5AA 1B26A 4RTJA 2GD2A 1QDEA 1O57A 4OUKX 1CUAA 2FMXA 3ENWA 3ODGA 4DR2B 3W8DA 2PL3A 5ANRB 4LZJA 4JUCA 4LHSA 3TH5A 4KDCA 1QG0A 3WQBA 4ZCIA 4GRIA 2VDJA 1Q19A 4JVOA 3U0VA 4DCUA 4Z49A 3P4UA 3QMPA 2D2IA 1NW9B 2VEOA 3U44A 1VM6A 2QN1A 1KQGA 3R3WA 1HQCA 3UW1A 4JMPA 1SCAA 2NOAA 5B64A 1F2UB 5DOZA 2VHJA 1W29A 3KT0A 1S2OA 2L17A 1SWWA 3DZDA 4G3XA 3SR4A 1Y9ZA 3AUTA 3CF2A 4HBZA 4L5CA 4W8GA 1UK6A 1IOWA 4QC2A 1XZLA 4CMCA 1LBHA 2FSVA 1U7HA 3ENNA 1I1OA 2ZT6A 1B42A 5THKA 2EKPA 3RFXA 1P18A 1TPYA 4BO4A 3T41A 4P7GA 3BIWA 5EXEA 3ZE0B 4FZVA 5BWNA 4L9SA 1ZH4A 1P3Y1 2Q6KA 3RSLA 5HKKD 2G70A 3KVRA 5ALKA 3TN7A 5KAMA 4Q7JB 4UHBA 1QUFA 3D02A 4DLKA 3HRHA 3FRHA 4JP2A 3GHHA 3IR5A 2H52A 4PSDA 3ANYB 4GYJA 5EFOA 3QY0A 3W4JA 4DUPA 2HMSA 2YIVX 2JKYA 4KMSA 4L4YA 4EJSA 3QX7A 1PVVA 2CNDA 4RVSA 4MQ6A 2VK2A 3NV9A 3QGMA 2OV3A 1D2NA 2Y1XA 3EIXA 4K9NA 4MDFA 1HR0B 4G0VA 1ZZGA 2ZU0C 1PHPA 4AJEA 2D1FA 2EARA 3IKJA 1NYQA 4ESEA 1U7UA 5JAIA 4KLRA 4DGQA 1YSCA 5H7XA 3RYFA 4URFA 2IXTA 1KZ7B 1O5TA 2GUGA 1SZDA 2ES4A 3RVQA 1P1CA 1E61A 4MEAA 2WFLA 3DT6A 1UK7A 1LPNA 3GELA 2Z1MA 2IP2A 3TEJA 1V8FA 4WADA 2XTAA 4TQGA 4LOJA 4KGZA 4NQRA 4R31A 1AUVA 2CF6A 3C41J 2VL7A 1YOVA 2PUVA 2ZM5A 1C30A 3RAEC 5CB4A 4QBHA 4EOGA 4CF4A 1V95A 2YRXA 5BUSA 1G9XA 4UHDA 4M7RA 1FFXA 4H59A 2VRCA 3E9NA 4EY6A 4N01A 3K0CC 4RTRA 2CUTA 4OLJA 1P2UA 4HAUA 5DBFA 5AWFC 5THQA 3VC2A 1PG2A 1CIPA 3ITNA 4F91B 4K9RA 1JKJA 1U1FA 3CUVA 3OPYA 2GN2A 4MV5A 4B6RA 1Y9DA 4R9NA 5LQNA 2NV6A 1YZUA 2VP9A 3T9FA 4EX6A 1CUJA 2WNSA 2JGJA 4N3GA 1DQRA 2XWBF 4JQCA 4QSHA 3PHLA 2OG2A 3B53X 4HNUA 2V58A 1PJLA 2HD4A 2YIDA 3D3WB 1QLHA 3FPEA 1UXKA 5CB8A 1XCJA 1DOZA 1YIOA 1EFPB 1ICEA 3NHZA 2FDRA 1QX3A 4KYTA 3K6SA 1E4OA 3E22A 4YASA 3L41A 4ZRDA 2CLEB 3PJEA 3WHKA 4AS2A 5CFQA 3BXFA 2GZHA 1XVAA 2HNKA 2XE4A 3E6AA 1FFXB 2CZGA 4OMUA 3MJDA 1B0ZA 1XK6A 4JQSA 1WUTA 3TW0A 3ZQ6A 3N2YA 3S8MA 3KCNA 5BSUA 4CQJA 2GHIA 3DZIA 3H1FA 3SOZA 3HI6A 4WJLA 2I34A 3CE6A 2H85A 4MIEA 4PLVA 5KJ1A 1ID8A 3U62A 1EE9A 3QVSA 4ETNA 1ZGAA 3AYZB 2YXEA 2XB2A 1C3LA 2H1FA 1LDBA 3H1BA 4YROA 3N3AC 5HCIA 1T0IA 1G4HA 1S4QA 2JFGA 4BQQA 1L6RA 3GUVA 2HF2A 1D2HA 1F0KA 4W5OA 3FNEA 4G0NA 3ZD6A 5G1OA 1JUDA 2A5DA 3VKWA 3ZJUA 2YVLA 4ZK2A 5FNZA 2DE0X 1SD2A 4F9GA 3W9YA 3RB8A 1BEEA 3BCSA 3A06A 4WCVA 4BC1A 4XR4A 2XCIA 5I9IA 3CIFA 3WLOA 3QELB 1FRVA 1XF9A 4HQOA 4IOKA 4R2WA 2PKXA 1YDGA 3ABIA 3TAHA 4F9TA 2O48X 5BN3A 2OFOA 5CFRA 1Z4QA 4NR0A 1YRYE 4QXPA 2CXTA 1VB5A 3BSWA 2Z4SA 4UUQA 4Z6KA 2WYUA 3UWDA 4BJ1A 1L4LA 2VP6A 2YWBA 2HDHA 2VAMA 3K2EA 3PCXA 5B7GA 1H0HA 2IW3A 1ZVQA 4DIUA 2DTXA 1JHOA 2FQQA 3HDQA 4J3NA 4OQQA 2X0DA 1ZINA 2JJMA 2YV2A 3FPGA 2Q0QA 3ZDEA 2WQZA 5AD1A 2XXBA 4P6VF 3RU7A 1LY1A 3GPCA 1BROA 1LW7A 4YP0A 3A1FA 4DMHA 3LPMA 4G2TA 4N5HX 3B6JA 3VQTA 1U2DA 2C2OA 2QRGA 5L3RA 2FWPA 4AMZA 3I52A 4FGWA 4GP9A 1C1YA 3JYHA 2B69A 3KXLA 1ZD8A 2ZKIA 3KT8A 4KH1A 2AYYA 3L46A 3RTEA 3RAPR 2C57A 3O2JA 3TVDA 3ZN2A 1ENZA 1Y9AA 4CF7A 4FWTA 5JG7A 1XCLA 1Z47A 2CBZA 1LNZA 2A0XA 3G0IA 2JGDB 5FWNA 1GITA 1E89A 1R8SA 4B5LA 5BSTA 2O7SA 1G8GA 3N0RA 3ZY6A 1OYVA 3AJEA 2TSYB 3WQRA 2RHTA 3HSKA 3N8DA 1Q0LA 3PDIA 2ZSDA 5DSXA 1W8DA 1YIDA 5TJHA 4ZMRA 3PUZA 4QPCA 4P3XA 1NQTA 4CU2A 3N07A 4IDEA 1LS1A 1NF2A 5GPBA 4EPWA 4TTJA 1C29B 1GUYA 4HK4A 3ZWBA 1G20B 1DC8A 5KTRA 3HBJA 2FNAA 1FFAA 1PT8A 2YXNA 3CR3C 4Y2YA 3VPDA 5DGDA 5BVHA 3G8DA 4PQYA 1FNDA 2FEAA 3QPAA 3IQXA 5E8RA 2R8RA 1D3AA 1C9DB 1FDWA 1JLLA 1K98A 4ER3A 2QMEA 4F3KA 1SO8A 1QO7A 1Z22A 1V7ZA 2YCBA 2I78A 1KSGA 3ZUGA 4XVRA 5A6SB 1XDSA 3Q3CA 1GU1A 3RSZA 3NHAA 4IJ5A 3M1YA 1XNJA 4RIEA 1M2GA 1UXGA 1H6AA 2BFEA 2XQVA 4LWPA 1OFTA 3K8OE 4YA6A 2O06A 2YY6A 3UANA 4UXHA 3FKSA 3WLMA 5ALHA 1HNNA 1S3SA 4HG2A 3MCUA 4LQDA 4Y8VA 5GOZA 4NTZA 2WDPA 5A04A 1JFSA 5ALNA 1HTBA 3Q5GA 1I2CA 4PQRA 3IPLA 2HHHB 4U7HA 2RGCA 3WWDA 3SY8A 2FJPA 3BN3A 1EFHA 3OTIA 4L7VA 3NHMA 1XELA 4ZGWA 1USVA 1Y3AA 3QE0A 4J90A 4P32A 3VHQA 1RKUA 3U9SA 4CUJA 6REQA 4DUZB 1X3SA 4XQ0A 5IEJA 3KZCA 1C7EA 3GLQA 3WDSA 4AXBA 4ZKEA 4GLBA 1RC1A 3UHFA 3WSWA 1IM2A 5KDLA 1PQ4A 3VU9B 1RPNA 2WYVA 3QXSA 3OOEA 4RYLA 3JD3A 4BKQA 3IQZA 4YFVA 4QNMA 4ZVNA 2H5EA 5C8VA 1CPYA 1JQJC 5MDHA 3DWGA 4MI1A 1Y8RB 2FX3A 3GP5A 2GCGA 1FLDA 2G25A 1DJOA 4FYIA 3K1TA 3ISTA 1IRIA 1XQYA 2ERCA 3MCTA 3VC7A 3ZHBA 5LMCA 2GO7A 3CVUA 1QU3A 3OI7A 3R9WA 5LQUA 1ZRNA 2N46A 3PHHA 4FQ7A 1AKVA 3SX2A 2XRMA 3IP1A 2JF0A 4IIYA 4RK4A 3UQZA 5AJWA 1TPZA 2II6A 1GL3A 4IDBA 2WNIA 3G0DA 1F2TA 2BM9A 4F45A 4O2AB 4ND1A 4W5JA 5FI5A 5C1IA 3FRIA 3KLBA 3O8BA 5IPFA 4RDXA 2XGSA 2P4UA 4F3CA 1O6BA 2AEEA 1FP7A 4E31A 1Y6JA 1ZXXA 2ZT7A 1JG1A 4KQFA 1NBMD 3G79A 2VRBA 1AN9A 1POXA 4KPFC 3QJYA 3R44A 3F8TA 4RV5A 3VPBA 1PT9A 4E11A 4CCSA 2VF2A 2FSPA 1GRQA 3OHMA 1WF3A 4JR1A 5JAHA 5LKRA 3SR3A 3KOXA 4O4HF 3I9FA 2MSEB 3PNQA 4M3NA 3TZ6A 1R27A 3QLJA 1Q14A 4R1LA 5FUMA 5IC5A 1O6ZA 2XSZA 4RLFA 4XJTA 2ZIXA 1IPHA 3HVHA 4QDOA 3VKFA 1KSJA 2P5SA 3B7GA 4G25A 1E6LA 2AWNA 4X1KA 3T5MA 3ZLJA 2IP4A 1XTPA 2GUWA 4GLFA 4W9NA 4YJFB 4HEA6 2ZUEA 1NW7A 1LZKA 1SG6A 4U7JA 5GV7A 4J75A 3QKTA 3PWSA 3VU8A 2RHBA 3QFSA 1DBIA 1BS9A 1QFZA 4TTPA 4WOPA 5GIOE 2CJWA 3SXPA 3KWLA 4MQ5A 3HR7A 1OGJA 1DKUA 3D5TA 3VOSA 5JXJA 1J42A 4UU7A 2H5LA 4BKMA 3H4MA 4ZVMA 5GOTA 1WVGA 5DKFA 4IIGA 1YRLA 3L7NA 1T2CA 1LNSA 2XECA 3U4IA 4R84A 2V6JA 2YZGA 3K9WA 5DXFA 5I5GA 4Z0NA 2WSIA 5AUQA 3UPDA 5LZ9A 6ADHA 1W36D 1GO2A 1FFCA 5DEIA 4U7FA 4YT4A 2FP4A 1C9EA 1ZA1A 3VU1A 4MO9A 2O2DA 3VJRA 1HOTA 4X62B 1MLDA 1TL7C 3TRHA 1U2TA 1ZKMA 2YJ5A 2AK3A 3W5VA 1PAUA 3LQQA 5K0NA 3N2EA 1QHIA 5KTNA 3UOWA 1Y8CA 4GI7A 4BWGA 4F4HA 3A70A 1QDUA 2YJ3A 4ZQCB 5JVDB 3OLQA 3VJMA 2H6EA 4W5QA 3UFXA 4DYHA 1ES9A 1ZI8A 2DKFA 4CT4B 1ODJA 4BAUA 4J2TA 5F2NA 1U7WA 3OMWA 5KJ6A 3H11A 4IIJA 2X1HA 4GPZA 3S2SA 4BC0A 1PCXA 4LQLA 3FTNA 3I0NA 4ZCQA 1JHVA 5KVCA 2F67A 4P54A 1SOVA 5AI8A 1ZM3A 3KJXA 3QG1A 3CEPB 3R6GA 3W6PA 4M8IA 5FUWA 4HDMB 4G5GA 3U0BA 3JTMA 4Y6GB 3VZPA 1ZNWA 1K5PA 3EH1A 5J4KA 4YHHB 2IODA 3MUOA 4BUZA 3I5XA 2MINA 4PCVA 3MM4A 5FADA 3SN6A 4NEQA 4V3BA 3VI4B 3S8YA 3BK7A 1IOVA 3OU6A 3IR7A 2FPMA 3BBLA 3SF0A 1BFUA 1EUDA 2I87A 2P9GA 4KAAA 4FSHA 3X2FA 1ZPDA 5CGQB 2FJ0A 3IALA 3EVEA 1P9NA 1QTRA 3CRW1 4Q3CA 4U00A 2DMRA 3QVJA 1VLHA 1HDGO 1YE5A 3HKDB 4WCFA 2B1IA 4WSOA 1TRHA 5KDDA 1A9QA 4QDZA 1V37A 2AFIA 2I6XA 3HPQA 1R6UA 3AL0C 4KN6A 5B4VA 3FAKA 3I42A 5MGNA 5CH8A 5JS1A 2HRCA 3KEOA 2HQRA 1QRSA 4Y67A 5H81A 3QSGA 2PBRA 3NVMB 2Y27A 1QM5A 5ICFA 2QMHA 1SA0B 5CNIA 2O7RA 4DCMA 2VYFA 1IATA 3HJAA 1Q7GA 3OH8A 2EFHB 5HEKA 3RGWS 1O03A 1KI2A 1UDRA 2AOXA 3T5TA 2B7BA 4H2DA 5A4KA 4C4YA 2YWRA 2ZPAA 2LE0A 5FTNA 5IVPA 1ESNA 1MXHA 2CNOA 4FHEA 3IL2A 1N9GB 1PBTA 4P34A 1U80A 4K40A 3LVQE 3BMQA 4F4UA 2YL2A 2GHRA 2GMWA 2HK9A 3AIK