2ATFA

X-ray structure of cysteine dioxygenase type i from mus musculus mm.241056
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
186
structure length
186
Chain Sequence
ELLKPRTLADLIRILHELFAGDEVNVEEVQAVLEAYESNPAEWALYAKFDQYRYTRNLVDQGNGKFNLMILCWGEGHGSSIHDHTDSHCFLKLLQGNLKETLFDWPDKKSNEMIKKSERTLRENQCAYINDSIGLHRVENVSHTEPAVSLHLYSPPFDTCHAFDQRTGHKNKVTMTFHSKFGIRTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and mechanism of mouse cysteine dioxygenase.
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase
molecule keywords Cysteine dioxygenase type I
total genus 56
structure length 186
sequence length 186
ec nomenclature ec 1.13.11.20: Cysteine dioxygenase.
pdb deposition date 2005-08-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2atfA00
5K8SA 3BB6A 2ZCWA 2BNOA 5E1RA 1CAUB 5C8WA 3WW4A 3LOIA 4XF3A 1NE4A 2PFWA 5JR7B 4XFFA 3QOPA 3FZ3A 2XKOA 3USSA 5I0RA 2EA7A 4IETA 2O1QA 3JZVA 1HW5A 3EJKA 2XHKA 4MH0E 1OMIA 1QXJA 2GC1A 2GAUA 3SCFA 1UW8A 4QGNA 4LLOA 4QX5A 3OGJA 3EHKA 4H7LA 2B8MA 2IXIA 1O4TA 5I0UA 3S7IA 3H1MA 3RYPA 5LEJA 2IXKA 3CO2A 3EO6A 1LR5A 1H1IA 3PNAA 4AQ6A 1DGWA 4LUMA 2K0GA 4HN1A 4HBNA 2Q1ZB 3I54A 4GULA 4X6RB 5EZWA 3IDBB 1I5ZA 4Q0VA 3LA3A 2P17A 3G7DA 2CGPA 4ONUA 4LA2A 1O3RA 5J7MA 5FPXA 1FXZA 5FQ0A 3H9AA 3WW3A 2ATFA 4R8HA 2PHDA 1WA4A 2N7GA 3IBMA 2K9ZA 3OD0A 1PM7A 4IERA 4D7TA 5I91A 3U0ZA 3D0JA 4QGLA 4MZUA 1UPIA 1DZTA 4LA3A 4KWKA 4B29A 2PAKA 4I0BA 2IXHA 5KBFA 3H1WA 4IEPA 1YUDA 3O14A 3RDIA 1DGRA 1J3RA 4BHPA 2XLGA 4HSLA 3DV8A 3E6DA 5FLIA 3SCHA 1OFNA 2Q30A 3QACA 4Q0UA 2VECA 3U11A 1FI2A 3FJSA 1OD5A 2H6CA 3RNSA 4L2NA 4I09A 4HVOA 1I6XA 4AQ2A 3FHIB 5KHJA 2XLAA 3U10A 4F8AA 1QWRA 4FAHA 3H8UA 3C3VA 3SHRA 1RTVA 4DINB 1ZZ9A 2MNGA 4XFIA 4KWJA 2ET7A 3E5UA 4IEVA 2VQAA 1CAVA 3FX3A 2WC2A 2CAVA 2PQQA 2DCTA 4IEOA 2IC1A 4XF4A 1O5LA 4RD7A 2IXCA 1NE6A 1EYBA 5D1IA 1ZRDA 4J1WA 5FLJA 4BH9A 2UYBA 2QVSB 4EWAA 4KU7A 4FT8A 3NKTA 4WBBA 2D5FA 3RPQA 3H50A 1SFNA 4JVAA 4J1XA 2IXLA 2Q0AA 3DKWA 2I45A 3ZDSA 3HIFA 3RZZA 2WFPA 4LEJA 1CGPA 3KGLA 3CEWA 1PMIA 1ZZCA 2C0ZA 3M3IA 2CV6A 1G6NA 2Z2SB 4LUKA 4F7ZA 4MGZE 4MV2A 4FAGA 2XLFA 3CF6E 3IIAA 1J1LA 2QDRA 4OFGA 1X8EA 5KHKA 5BUVA 5LRSA 1YFWA 2PA7A 3NW4A 4IEQA 2OA2A 3ACLA 2IXJA 3FFQA 1RL3A 3BU7A 1YFXA 1VP6A 3M70A 2PHLA 1LRHA 3CLPA 4QM9A 4PIYA 5I0SA 4XFCA 5BPXA 4I01A 1O7FA 1UIKA 2V09A 1CAUA 1J58A 3MDPA 1EPZA 1ZRRA 1CX4A 2F4PA 2E9QA 1YFUA 3IDCB 1EY2A 3PVBB 2D40A 1VR3A 3BALA 4I02A 4LTAA 4IEUA 4HVQA 4AVBA 1VJ2A 4KWLA 2BGCA 1QXRA 1OI6A 4XFHA 2XL9A 4CYDA 1UIJA 5FLHA 2QCSB 1ZZ7A 2D5HA 2H6BA 4PIZA 1GQHA 1Y3TA 1J3QA 1X8MA 5KHGA 1CAXB 4JV4A 4UBHA 5JSOA 4Z82A 1ZVFA 4EWDA 3E6CC 2D93A 3B02A 3NVCA 3FWEA 4AXOA 1X82A 1ZRFA 1TQ5A 4JTOA 5AVPA 4HLTA 4EV0A 3I59B 4IEXA 2OYZA 2XGXA 1EP0A 2ZKLA 4A2UA 5I8YA 1RUNA 1H1MA 4QMAA 3DL3A 2GU9A 1XE8A 2PTMA 1Q5OA 4HN0A 3NJZA 3E5XA 3SMHA 4BYYA 1RGSA 2Q4SA 4BIFA 2OZJA 5BXXA 1UD1A 4QGMA 1CAXA 4XEZA 2BNMA 3MYXA 3GYDA 5C6CA 3L2HA 1ZREA 1RC6A 3HQXA 1X7NA 3D82A 1ZZ6A 5JSRA 2VPVA 4ZU4A 5I8TA 3I59A 5CVRA 3KGZA 4HZFA 4YSFA 3E97A 3H7JA 5J48A 2QJVA 4I2OA 1NZCA 3CL1A 3H3UA 1JUHA 2BYVE 4UXAA 4KL1A 3WW2A 1Q3EA 2BNNA 2ETEA 1YLLA 1FT9A 4IEZA 4R52A 4MX3A 2QNKA 2CAUA 4Q29A 3EQEA 3H7YA 3LA2A 3LA7A 2UYAA 2H0VA 3CJXA 5I0TA 4HSJA 5FCCA 4EWEA 5FPZA 2FQPA 4JTNA 4XF9A 5CU1A 4N9HA 4WZCA 2PYTA 2OPKA 4XFBA 4YNIA 4ORFA 5I8SA 3S7EA 4MGIE 2EVXA 3NSTA 5E16A 1YHFA 5T3NA 4MUVA 2HJIA 3RYRA 2PAMA 3LWCA 2KXLA 5LEKA 3H3ZA 2OZ6A 4QM8A 3RYKA 3TNPB 3GBFA 3LAGA 3UKVA 3MZHA 1ZZBA 2HKXA 1CAWB 1O5UA 1QY4A 4X6QB 4QXKA 1XRUA 3ROUA 1RUOA 4XFAA 4D7SA 3NL1A 4L11A 1DZRA 2O8QA 4YYOA 1O3SA 2Y0OA 3TNQA 3I7DA 1Q43A 3IWZA 1ZX5A 4IEYA 1SQ4A 3MPBA 1UCXA 3E5QA 2BEOA 2GH2A 2UY9A 5KHIA 4Q0PA 4YARA 3E6BA 3DN7A 2B9UA 2Z69A 2ET1A 5FDBA 4Q0SA 3ST7A 2XL7A 5BV6A 5J3UA 3VHRA 1SEFA 4N9IA 4ZU7A 3UKTA 3ES4A 4P9GA 3ELNA 4AVCA 4AVAA 5HI0A 2XKPA 2PAEA 3KSCA 1IPJA 4NVPA 4TLFA 1LB2A 4O9GA 4MGKE 1WGPA 4LULA 1ZZ8A 1Y9QA 4XFGA 3HT1A 4MGYE 5JSPA 4XF0A 4XETA 4PIXA 5F1RA 1O3QA 3ETQA 3BCWA 4IEWA 4HMZA 1WLTA 4O9EA 1NXMA 4UBGA 5KHHA 2UY8A 1U12A 3OTFA 2GC2A 3H1YA 3KMHA 3OF1A 5JAXA 1J59A 5BY5A 5FQ0B 3SXWA 3R6SA 5CADA 3FE5A 4I3PA 4OLLA 1O3TA 1ZNPA 3HT2A 2EAAA 5I93A 4FBFA 1V70A 2GC3A 4E2QA 1ZRCA 1IPKA 4ZU5A 1CAVB 5EFUA 3LZZA 4META 1XE7A 1CAWA 4HVRA 3WW1A 1NYWA 4E2GA 2FMYA 1LKNA 3KCCA 3SCGA 2GZWA 1YFYA 1L3JA 3BPZA 4XF1A 4Z07A 4PJYA 4EROA 3D0SA 2GC0A 3EBRA 4K8FA 2MHFA 1GQGA 5LRRA 3ES1A 4YRDA 3PLQA 2B5HA 4I0AA 4KU8A 4WVZA 1J3PA 2MPFA 4IESA 3UKNA 3S0MA 5JCTA 3N4MA 3OCPA 4E2SA 1YWKA 4Q0QA
chains in the Genus database with same CATH superfamily
3AFKA 1QOTA 2XR4A 4EQVA 2BV4A 2ZCWA 4GMP0 4XJZA 1VALA 4Q2FA 5E1RA 2VZSA 1NCQA 1GR3A 1ZRIA 1QU0A 2YDEA 4NE9A 4P9IA 4TWTA 5FYUA 5A80A 1LJ7A 5LK5A 3ZYGA 5JR7B 3PUHA 4XFFA 4AK3A 3RZKA 2R062 1FPN1 1UOGA 2DVBA 2WS92 3MICA 4WVMA 1GZCA 2D44A 3USSA 1MEC2 3OSDA 2EA7A 4SLIA 4EE2A 4IETA 2O1QA 3AMPA 4P00B 5H9RA 3I2HA 4AEDC 5A6YA 1UYZA 2D6PA 2Y6KA 2PHFA 4FP2A 3W21A 2JEMA 2W95A 4QKNA 1LODA 1UW8A 1WCKA 1L7QA 1W99A 3OGJA 2HWC1 2OUHA 5FBZA 1ZYBA 2Y34A 5FP7A 4H7LA 4LE3A 4XUNA 3KV5A 4WM8C 1ZBE2 1BBT2 3S7IA 3WG2A 1RUJ2 1HB3A 1VMHA 3O1UA 4XDQA 1U5IA 2RS12 3ZSLA 4FTEA 3BTZA 1Z0HA 4TYSA 5HXMA 1FNZA 3PJQA 2IXKA 3EO6A 4K9SA 2DF7A 4GA9A 4Q1PA 5FPAA 2VTXJ 4FPGA 2WZR2 4OI1A 3PNAA 1QNWA 4CU8A 1GWLA 2C26A 4LUMA 1H8VA 4HBNA 2X05A 2JWPA 1YQ8A 3WP4A 1MZ6A 5IVBA 1DQ6A 3POEA 4AI3A 2HYKA 3DEMA 2HEWF 2NMNA 4O7XA 1OF3A 1H8TB 5FZMA 3TAYA 4ATFA 4CUBA 3K75B 3M1HA 1SPPB 4YG6A 5GZGA 3Q8AA 3HWJA 1J1TA 1DDLA 2WQZC 1CONA 4AEJA 4HONA 3PDQA 1VBA2 2E7AA 4A42A 1GU3A 1QJFA 2ZX4A 4GALA 3VBSA 5FPLA 2AACA 1ND2B 1U5YA 1W0NA 1F9KA 2QQIA 3H9AA 1NXD1 2LRPA 4N53C 4R8HA 3HN3A 1WA4A 3MLLA 5GLWA 4NIDA 1TMF3 3OD0A 5FZBA 4DOUA 3WCRA 3ZX7A 5C3RA 5GLTA 4ITCA 4QGLA 4MZUA 3I2OA 5L9VA 1UPIA 3C2UA 1HXS2 4PT6A 3T2PA 1TZOA 2XBO1 4GJZA 4K40A 3AMMA 2ZGQA 1FYUA 4MLOA 4I0BA 3O1VA 2QBXA 3AP5A 2VMHA 5CKQA 1RUC3 5C3OA 3ORJA 2RS51 2BW8A 3UETA 4UFLA 5CBLA 4IE7A 1ACCA 4HSLA 1H30A 2E32A 4K8RB 2Q1FA 5I0DA 4R4XA 1OOPB 5FZ0A 5FLIA 1UN1A 3VD3A 3KHCA 1OFNA 5DAQA 5A7WB 4CUGA 4COVA 4Y24A 3U11A 1BEV2 1FI2A 4Y1ZA 2A5ZA 1Y9MA 2ZOEB 4QX7A 1VBD2 1OD5A 2WFF1 2XONA 3ZR6A 2DTWA 2ZPXA 2YBKA 1NCQB 1F8VA 4XCAA 1OD3A 2SBAA 3OPZA 3RNSA 1L7LA 4L2NA 1KITA 1DYKA 4JGYA 5ABJA 5HV4A 3VKLA 2HWD3 1RXGA 3V0BB 1LHNA 1KFXL 1UZ0A 4NWWA 3U10A 4F8AA 3JUUA 4YW3A 3ZFEB 4QX0A 5LCWL 4EYUA 1LGNA 5JZGC 2RM21 3VHPA 4NMIA 4DINB 1UU6A 3TN93 4YGEA 5FJHA 4LXLA 3INAA 4KWJA 1VAKA 2B4KA 3AKQA 3VDBA 2VUCA 4A7ZA 1CZTA 1UMZA 4BQ2A 4Q4Y2 5BNPB 1O5LA 1AR93 1RUI1 4BMEA 1W6MA 5E8AA 4Y5SA 3QH6A 1FV3A 1RVF3 3POFA 3G6JB 4AGRA 1WZXA 3R05A 1JZ7A 2XJVA 1MS1A 5FLJA 2JDKA 3T0BA 2FDGA 2GDFA 4AGVA 3PMEA 2K2SA 2YHJA 1W6QB 4BK4A 2QVSB 4EWAA 3IDEA 4GXLA 2QDNA 1MS0A 3WEZA 5K0UC 3MEPA 4YW6A 1ND2A 2CTVA 2BFUS 4DFSA 1BMV2 2I45A 3ZDSA 3ZPOA 2ZAAA 5K0UA 3TBDA 1RUH2 2DCJA 5FMCA 5FOBB 2VG9A 2C4XA 5L9RA 3VZJA 5A1LA 4LK7A 3LSDA 1CGPA 4JGZB 1W2AX 5IATA 3MIDA 4AZZA 2C0ZA 3M3IA 1YI7A 2WZEA 4YM2A 2OX0A 5FO9B 1YRZA 4LBQD 3CU7A 2HLEA 1ODMA 4OMDA 2ZEWA 5CFCA 2OPWA 1DYOA 1RITA 3PIJA 4KG8A 2ZXQA 3C7FA 1X8EA 4OFGA 5DPNA 3RI8A 5LRSA 3IZOA 4LO6B 3BTYA 4L9BA 3NW4A 3RWNA 2KR2A 2WO2A 3AKPA 4XUQA 3RWKX 3J4UH 1PMJX 4UF0A 3FFQA 4FXKB 3DGTA 4RGGA 4LJHA 1LRHA 3CLPA 1FNYA 3GJAA 3ILFA 4XFCA 2QQPA 4QDSA 1LEDA 4Z2WA 4OZXA 2ZZQA 2G9ZA 3ZYFA 4FVVA 4HXCA 3V0BA 1RHI3 4WZFA 5DAPA 1IG0A 5IVCA 5JXJA 1NT0A 2F4PA 4JGZC 1UZYA 1EAH1 3GZUC 1J83A 3NKGA 4LBLA 1CVNA 3ZKUA 2WT1A 2ARBA 3ZXJA 3MI8A 4HVQA 2YGLA 5LATA 1UX7A 5EV7A 2BGCA 3VKNA 4W65A 1QXRA 2GMMA 1OI6A 4KH9A 4QDQA 4XFHA 1JZ8A 1EUTA 2R30A 1LU2A 4FPYA 4WM8B 4BJ0A 1QJU1 1YXWA 1HN0A 5ISLA 3ZSKA 4RHV1 2R1BA 4DEQA 2B45X 4CDUB 1IQDC 1X8MA 3VD5A 3OBTA 1XU1A 1JS9A 3DF0A 1CAXB 4IGOA 4JV4A 2XVKA 3ME2A 4Z82A 5FWEA 2ZJCA 2QTWB 4Q4Y3 1DGLA 3NVCA 4NHYA 4XYXA 1SG3A 3H8RA 1DF0A 3B93A 1HXS1 2HEVF 4HLTA 5AVPA 3I59B 3WG3A 1JHNA 2OYZA 1EP0A 3LDBA 3GHMA 4LNVA 1NCRC 4L99A 1VBD3 5FY7A 3VBSB 2A3WA 2VBBA 4ISRA 4HKLA 1E5HA 1N1TA 4QQOA 1H2LA 4OI0A 1OQ1A 1Q5OA 1JYCA 4JDOA 1D4M1 1WWYA 2HWD2 1RGSA 4BIFA 4BU2A 3DYOA 3ZM8A 2VXJA 3CKHA 3WDVA 4QU1A 4LBQB 3THTA 1YNAA 4C8DA 1NUKA 1F5JA 4GH4C 2Y6JA 2DYCA 4BMBA 2TUNA 4GIQA 1ENXA 3L2HA 1RC6A 1AL23 1NOVA 1X7NA 2ZA9A 4MGQA 1R1A1 5H9SA 3N7MA 3ZFEA 5CFDC 3KLSA 3ILNA 5CEHA 4E8DA 5I8TA 1SCRA 1LGBA 3EB7A 3GZEA 3KGZA 5T5PA 4YSFA 2WNEA 3E97A 1UPSA 1QEXA 5EJ3A 2A71A 1AUYA 3NO8A 4ZONA 3ACGA 3MFCA 3CL1A 2P6CA 5BNOA 3I49A 4Y1UA 2BYVE 2UWBA 2ZBJA 1AR72 4KL1A 4XURA 1APNA 1KRIA 1RUG1 3JD73 5AC92 2JX9A 2VOXA 4MX3A 4XQDA 4Q4X1 4N53B 5GZEA 2E51A 4QU2A 1OF4A 3WNMA 3ZN5A 1ND2C 4KMQA 3POYA 4GB32 4C1XA 2VNOA 3AXEA 3LA7A 1C8NA 1OLMA 5I0TA 1K12A 3HR9A 1F4HA 5A7PA 1XYPA 1RMU1 2R1DA 2VOVA 2OW4A 4JZRA 2JDYA 5C4WB 2OXBA 2YBSA 1C5HA 3WHUA 4CDUA 1QDOA 4G4FA 4UFHA 4OMCA 5GALA 4YZ1A 1MPXA 4XF9A 3IPVB 3ZMNA 3ZN6A 4OUSA 1BKZA 1FMD3 2PYTA 4WZCA 4ZZ5A 1AR82 3UYJA 2RDRA 4YNIA 1I9RA 1LHUA 4ORFA 4AOCA 3BU0A 4BXSV 2DFBA 5JMOA 2RM22 3ZR5A 3NSTA 5E16A 1PO21 3U1XA 3D5OA 1WLDA 4YZ4A 2A6WA 3ATGA 5FKCA 3UT0A 2CY6A 5DDJ3 1QGLA 2KXLA 1GZWB 3CNAA 1A8MA 2OZ6A 1UY2A 1ULFA 3P1IA 3GBFA 5CFCB 1Z78A 3MZHA 1VBB1 3DXUA 1FATA 5IK7A 4CUCA 4C1WA 5FYTA 1XRUA 3OPTA 5FZHA 2GMEA 3LB9A 4E9KA 4D7SA 1C3HA 2VOKA 2HWF3 4YYOA 4P14A 4CEYC 1CWPA 3HEIA 3GCWA 3UESA 3JB4C 3R4SA 1Q43A 3IWZA 1Q8QA 4IEYA 2ZX1A 4YG0A 2A6XA 3CMGA 3NWKA 2H0BA 1CZSA 4Y33A 3ZYRA 2WABA 4Y1XA 4Q0PA 3VZLA 4FTBA 1GOFA 3T30A 3DN7A 2ERFA 2E31A 2VOWA 4ZXEA 4AQTA 4ZS3A 5HCAA 3WNKA 1AVBA 1JN2P 2Z69A 4PDWA 5JZGB 4M3CA 5FDBA 1K5MC 1YQCA 4JCKA 2BVBA 3ZOIA 5LZ6A 3M3QA 1W6PB 1W6NA 2XL7A 5FBJA 3OD4A 2VOTA 2V72A 1SEFA 3PU3A 2VZVA 4QHBA 1US3A 3TEYA 4M0NA 1PVC2 5HI0A 2PAEA 5FPVA 1SFPA 2XQRA 4QPGA 5FMDA 3ZFFA 4FCAA 3NQHA 4TLFA 2QQNA 1LB2A 1QQP1 4MGKE 4M3CF 1IS4A 4URTA 3BGAA 1ZZ8A 4W4ZA 2E53A 2C1FA 4FPLA 2WZPP 1S1AA 2LROA 1GP5A 2YU1A 4MGYE 5JR2A 4O61A 2BFUL 5JSPA 1JU3A 1FOD2 3GALA 3R4DB 4XETA 1ZA4A 2HWE1 1ASJ2 3BCWA 2EALA 4FPFA 2FBEA 4IEWA 3BTAA 4HMZA 4A45A 4TZDA 4CDWB 3IDAA 5JXHA 4N43B 2XJPA 1CR7A 2GNMA 3BKZA 2VR4A 2VW2A 2P5BA 1KD7A 1UY3A 2NN8A 3N35A 5JIUA 1AL22 1RUJ3 4LORA 1OQEA 3OF1A 1JW6A 2IUWA 1SHWB 1SLAA 4Q4V1 1N1YA 4IUGA 1WMXA 5JOWA 1J59A 1DQ2A 5FQ0B 3SXWA 3R6SA 2GALA 2XHNA 4CCJA 2LW8A 1DQ5A 4DXRA 4DZGA 4RQPC 4YW4A 4QB1A 3FE5A 1QJX2 3T3YA 4B7EA 4DIQA 4OLLA 1E5SA 3ZLIA 4ARXA 4QAWA 1PNFA 5A7SA 3WQ0A 1X33A 2EAAA 3A4UA 3MIEA 1OKQA 4E2QA 2JD4A 4OULA 3AMNA 1C4RA 4ZXKA 4H7MA 3D8CA 1WCQA 3VBFA 1E5RA 2GNDA 3VV1A 3AZXA 4NN0A 1RXFA 2W92A 5DUVA 3M3EA 4HVRA 2BGPA 3UGGA 4Z8BA 3MHZA 4BQ4A 3VUOA 4HL0A 4NR1A 4K7JA 5AVAA 2FMYA 3MO4A 4RFRB 4DXSA 5DZGA 5FZ4A 2WDBA 2VMDA 3NAPA 2DBIA 1RUD1 1OVPA 2D3SA 4K8FA 2GN7A 1KGYA 1U0AA 4K20A 5DZEA 1GZ9A 4CP0A 1GBGA 1GQGA 3JBG1 1FPN2 3VBRA 4ZY9A 1BQPA 4KU8A 4RHV2 4JAAA 5F3CA 3BUCA 1J3PA 4PLNA 3M3OA 4Z2AA 3JD72 4LITA 5AC93 4D6RA 4TSVA 4WM7C 1VAMA 1MS3A 3NRUA 3T2TA 3LFMA 5DUXA 1YWKA 4Q0QA 3K51A 4JKKA 1C1LA 4Q1RA 2C24A 4GMP1 3VD7A 3UV9A 4BK5A 3ZXFA 3BB6A 3HD8B 3KV4A 2HWB3 3O0WA 4BQ1A 3GZAA 2BNOA 5FMOL 2J1RA 4IQPA 1OQDA 5C8WA 4EN6B 3WW4A 4P9XA 3PTYA 5C4WA 2PFWA 2Q8CA 1UY0A 3QOPA 1UZZA 1AR71 2XUEA 5A3OA 3VB9A 5LASA 5F2WA 4K1ZA 3SH4A 2YUEA 5BNOB 5IAXA 3AYCA 5BNNA 1RUD3 2WIIB 1OPOA 4GD4A 5IVFA 2YC0A 1HW5A 2ZGKA 3EJKA 2XHKA 1A78A 2R0HA 4MH0E 4B4PA 5A3LA 1LENA 1A34A 2RV9A 2WSUA 2GC1A 2XXZA 4RQPB 2PHUA 1IG3A 1ENRA 4BPZA 2B46X 1B09A 2DCYA 3HNMA 4AWDA 1AR81 5GZCA 1V9U2 5JWPA 4N43A 1O4TA 1DGWX 1HRI3 1NY72 4YVSB 1REDA 5F5CA 1F4AA 4IGPA 1OKOA 1OA3A 3BIEA 3RMXA 3K46A 1VBA1 3A22A 3PL0A 5FZLA 4NIGA 1DU3D 1VBE3 3GGLA 5JPMB 4LHKA 2W1WA 4DMIA 3VBFB 4H14A 3CBNA 4AQ6A 1AX2A 2A6YA 2B9VA 4IE4A 4NRQA 4HN1A 2BBAA 1W90A 4AI9A 1ENQA 2X5IC 4GULA 3IDBB 2B39A 2RJ2A 4PBPA 1I5ZA 3LA3A 1AR63 1OH3A 4LBMA 4LHSA 3IAQA 1ENSA 2DBNA 5GLUA 2VW0A 2DWRA 4ASKA 3B01A 1LHWA 1VRH1 4RS5B 3G7DA 3JB8A 2HWE3 4CPBA 1O8SA 3VBOC 4LA2A 4PI2A 5JXIA 1T6GC 5A7OA 3GNEA 1DYPA 1FXZA 2EF6A 1LU1A 2J22A 2PHDA 1KS5A 3IBMA 5FJKA 3POSA 1X50A 4IERA 4Y5Z0 4OHWA 2ZX0A 5I91A 3BTXA 4AVSA 4OCTA 2W91A 3WNLA 1MZEA 1DLLA 1W3VA 1Z7S2 3ALQA 3AXDA 4MXVA 2BZDA 4LA3A 2R071 4KWKA 2ES3A 4B29A 2A6ZA 5IUQA 3RFRA 2PAKA 1MS8A 4PI0A 1ULEA 1F31A 4LHLA 4DUVA 2MEV1 4RR3C 1SFYA 2ZHKA 2IFWA 2VCBA 4Y20B 5DUUA 1J3RA 2XLGA 4UAPA 3SKVA 1Z7S1 2Y26A 3DV8A 3NV4A 4IW3A 4S2HA 4KGQA 3D4KA 3T1MA 4KWUA 1LCLA 2ZHMA 3P3PA 1VIWB 4QB6A 4E4SA 1S0JA 2ZGRA 4AR2A 5F32A 2JIGA 4I09A 1ZBA3 3A23A 3AP7A 1G8WA 3N9NA 3ZXDA 1I6XA 4GH4A 2KA3A 4AQ2A 1PO12 1BK1A 2J1AA 3ACFA 3DYMA 3V56A 5IHRA 1XNAA 2AH2A 4LBOA 3A0KA 1PGL2 3ZXAC 4FAHA 5IT6A 4UYBA 4OI4A 5A3TA 3C3VA 5EJ1B 4CDWA 1RTVA 3TEWA 2MNGA 4XJ9A 4BQ5A 2ET7A 3ACHA 3AZYA 3E5UA 1W8NA 4CCKA 4OHYA 2W08A 3URFA 5C8CA 2X8KA 1RINA 1VBB3 4IEVA 1IS3A 2FDKA 3K2OA 3FX3A 2WC2A 2CAVA 2J1VA 2DCTA 2PQQA 4IEOA 5D2AA 2EIDA 3GM8A 2PN5A 2WNVC 3VBHC 2D6NA 4CDXB 2ZAHA 3K4DA 3MIBA 4CEWA 4BH9A 4IV1C 5F7UA 1MZ5A 5LY2A 4NOTA 5F39A 4AFDA 2Y64A 1NA1A 1EPWA 5CG8A 2D6MA 1S0BA 4WBBA 2D5FA 3RPQA 5J1XA 1XBFA 1SFNA 3WV6A 2OS2A 1HRI2 3MIFA 5A3WA 4DXZA 2UURA 5A3MA 1JTZX 1UMHA 1OUSA 3HOBA 4GJYA 3S5AA 1A6CA 4B4RA 4ZPIA 2RMU3 2AEZA 2WFPA 2RDNA 4LEJA 2IVJA 1H8TA 3NJVA 3TWIA 1ULGA 1JOJA 3MLKA 3N9PA 2Z79A 3KGLA 1GQPA 1RUG3 3JD71 3VBSC 5IVEA 2CV6A 4XC9A 3MPPG 1UAIA 1CQ9A 4F7ZA 1C8M2 2XLFA 4WM7A 5L7OC 2G9FA 4XE9A 5A3UA 4FPJA 3O1RA 3RZGA 1M06G 1YQ2A 3WQ7A 2QDRA 1Z7S3 5FY9A 2C9AA 2C9KA 3FUOA 3ZXEA 2RMU1 4IEQA 3ACLA 2WO1A 2JD9A 2ZTNA 2MEV3 4QWNA 3B69A 1AJOA 3BU7A 1UZWA 4AEDB 3B9CA 3M70A 3FFZA 1LESA 4QM9A 1FMD2 4XXAA 2IWGB 2W68A 4AFBA 5J96B 4I01A 3HNBM 4XIKA 1O7FA 3JCIA 1I1EA 4YW1A 2Y6HA 1ZRRA 1CX4A 2W94A 3IDCB 2LTNA 1HQWA 3AP6A 2WT0A 3CQOA 4N43C 5EP9A 2W9XA 3VBFC 5HPOA 2DUOA 4BXFA 3IIIA 3BALA 2UWCA 3VL9A 4LTAA 4U2AA 4Y4YA 1COV2 1OPMA 4AVBA 1AYM1 4KWLA 4DQAA 2PXJA 1VRH3 3U4SA 1UIJA 5FLHA 4LO7A 4FFFA 2H6BA 5FP9A 4TTGA 4NAOA 3AKTA 4COUA 4CXYA 1AR61 5A3PA 4NWVA 3Q9OA 2VC9A 1HXS3 2D6LX 4O65A 1QH6A 1YO8A 4UF0B 5HCBA 4R4ZA 2XG3A 5GJ6A 3AVRA 2MEV2 2V4VA 5FK7A 1ZVFA 3I2IA 3KF5A 5H9QA 2V5YA 4EWDA 4YM0A 2O0OA 4XHXA 2Y60A 4P5YA 2JDUA 2PHTA 4P9LA 4LKDA 3U37A 1ZRFA 1D0HA 3KQRA 1WMEA 3LF7A 4H55A 4QXBA 3WY6A 1VBA3 4XACA 4EV0A 1QOOA 5BNOC 5FYMA 4HETA 1JZ6A 1K5MB 2TNFA 2ZKLA 4KBZA 4G3YC 3B3QE 3VBOA 5C33A 1GFF2 1QJU3 1RUNA 2LS6A 2E7QA 1AR83 3DL3A 1QJY2 1TG7A 3J26N 4AI1A 1XE8A 2PTMA 4XVHA 1IQAA 3VLBB 4BWOA 3SQOA 1MQTA 3O1SA 2XMLA 4HN0A 4Q26A 1BYHA 3NJZA 2XJQA 4ASMB 3SMHA 2W2IA 5FZKA 5DDJ2 2ARAA 2FCUA 3LDRA 3W9AA 3H8OA 3OBRA 1MACA 1MR5A 1RHI1 2P34A 4E4DX 5DG2A 4RS5A 3LGRA 4ET7A 2W0XA 3RZLA 4QGMA 1BBT1 1GV9A 4CEYB 4GWJA 4XEZA 5F5IA 2AR6A 3NAPC 4QQLA 4E27A 4D0QA 1D0GA 1GMMA 5C6CA 5J36A 3KV6A 2J1TA 3HQXA 4COYA 5A33A 5JSRA 1HJGA 3DPRA 5FYYA 1RUF2 3OEBA 2ADDA 4QQPA 4RR3B 2FMDA 2HWB1 1WLCA 3RI9A 1W9SA 4MADA 4V1PA 5CFCC 5L7OA 4GMP3 2RMU2 3T08A 4HZFA 1PNGA 2IVIB 3VZOA 2WJSA 1R1ZA 5A6QA 4MO3M 1GUIA 2VZPA 3LEKA 3H3UA 3LEIA 1RUG2 2EIGA 4QPIB 5AC91 4HFSA 1Q3EA 3W20A 5F6KA 3WINE 4I30A 1Q8OA 2GSYA 1ND3B 1FT9A 1UKGA 2VO5A 4IEZA 4R52A 4XCBA 3ZYPA 4AEDA 5BNNC 1NKGA 3ZXGA 4XBQA 4AFMA 5FXXA 3I2FA 1CJDA 4CDQB 4Z1VA 3LA2A 2VTFA 1OHFA 1VBB2 3B7MA 2H0VA 4HSJA 2VCMA 4XBNA 2P3JA 3A0NA 1RIRA 2Q5TA 1JXNA 4DY3A 4NHXA 1VB4A 2DFCA 4RS5C 2D43A 1E5IA 1YC61 2FQPA 2QFEA 1HRI1 4PQQA 5CU1A 4QB2A 4D6SA 4MXWA 4LT5A 5D8AC 4N9HA 2WINB 1AYN1 4XJWA 2XDVA 2OVUA 5I8SA 4XFBA 5EXOA 4LKSA 3O1TA 4MGIE 1JBCA 2EVXA 1GOGA 3WUCA 5FZIA 4UFIA 1S0IA 1YHFA 4AEKA 1CPMA 4H3WA 3RYRA 1UY1A 1W8WA 1AYN3 2PAMA 4N7IA 4N90A 1AR91 2RS52 4FP3A 3SEEA 4LE4A 2CGOA 1K3IA 2ZX3A 2DUPA 3PUAA 3LAGA 1DG6A 3K3OA 2HKXA 1AHSA 2DTYA 2IFRA 4OZOA 1XYOA 1HB1A 4UOJA 2O8OA 2E6VA 2XH6A 1JMUB 2VVFA 4SBVA 1V00A 3K3NA 3NL1A 4L11A 4YGCA 2P4EA 3PTRB 5FYSA 3GZTB 3N9OA 1VBE2 2GP3A 2AZ5A 1POV0 2A70A 5C5UA 1NA1B 2JDNA 5CG9A 1LOAA 5EQUA 3I7DA 4NPMA 3TNQA 5FXWA 4N7UA 2W1QA 4WM8A 2ZEYA 1SQ4A 4V2VA 3T4VA 3H0OA 3MPBA 1O91A 1UCXA 3E5QA 4RA0A 4QPWA 3VZKA 3PUQA 3OGSA 3DXTA 4NAMA 2B42B 1V6LA 2ZGMA 3E6BA 5FKBA 4CCDA 4DUXA 2E33A 5FOJB 4LKFA 5CA6A 2B9UA 2VUAA 1UXZA 4BZ4A 3X29B 4EZ4A 3LEMA 3O0VA 5FPBA 3JBG3 2ET1A 2D98A 1GZWA 4Q0SA 4GKXA 3ST7A 2RS53 1OLRA 1BBT3 1D7PM 5BV6A 1PK6C 4HG6B 2W1SA 2BERA 2Z42A 5DG1A 5JIAA 3Q8FA 5FR3A 4ZU7A 1XQNA 1ULPA 2JG9B 1UO9A 1JH5A 3QCWA 4RFT0 4AVAA 4ZS2A 4DUWA 4N53A 4E8CA 5FZ3A 4ZZ8A 1LGCA 4NVPA 3GBGA 2VCCA 4AHYA 2VCAA 3FN9A 4HK9A 1D4VB 1HX6A 1OXCA 2VH9A 3HT1A 5DAWA 4QPIC 5IWFA 2ADEA 3NNGA 4LOTA 4NIIA 1UX6A 4R9DA 5AFBA 1C57A 1S2BA 4QPIA 2R0FA 3AZVA 3KHBA 4XW3A 2RG4A 2VNRA 2WSVA 1WLTA 4O9EA 3V65A 1N3QA 1ND3A 1ULCA 3MV11 4AGGA 1QOSA 1V6JA 1PGW1 2DCZA 1NZIA 5FYIA 3RJ2X 5JZGA 3J7LA 1IS6A 2KM2A 1RUJ1 3GF6A 4XUTA 4YFWA 5LBBA 4KG0A 4UW6A 1H2NA 1W6NB 3DCQA 1XOYA 4NRMA 1O4ZA 2YV8A 3ZIXA 5A6XA 4B1LA 4DXTA 4Y22A 1OVSA 1UWWA 1HIXA 1SMVA 2L9LA 5CADA 3CJIB 4S2FA 5FY0A 3MF9A 2YGMA 1VLNA 2GN3A 1AYM3 1PVXA 2YPDA 4I3PA 4K3UA 4Y5TA 5F6LB 2XUMA 1LNSA 4PDWB 3HT2A 3ZYIB 2QUOA 1GNYA 1DZQA 2GNTA 5FP4A 4PCRA 1GICA 5I93A 1HV0A 2ZGLA 5DUWA 1IPKA 1QQP3 1WW6A 1CAVB 1CN1A 1W8FA 5EFUA 4ZU5A 4D94A 3VHOA 4JHZA 1B35A 4XXPA 4TXWA 4E2GA 4KGGA 4AAXA 1FMD1 4LLFA 1US2A 4RSUA 3OGRA 1BVP1 3CIHA 3GDBA 2ZEXA 1RUD2 1L3JA 4CDWC 5C3SA 1D4M2 3NNMA 4PJYA 3TYJA 4C0HA 2ZHNA 3EBRA 2IZWA 5FZOA 2WNUB 1IGOA 4R9CA 4KBBA 1WD3A 1BVVA 4A44A 5JMCA 5T5OA 2UU8A 4UT5A 3WVJA 1BHGA 3UKNA 4B1MA 2VZTA 2CWSA 5EIYB 4QPGB 5JCTA 3N4MA 2W46A 3IAPA 3AMQA 3OCPA 5FMBA 3KT1A 1RUC2 1YQ6A 3MUZ1 4E2SA 2WN3A 2Y38A 3CJIC 5IK4A 2Y6FA 5BNPC 2NM1A 2CDPA 1EV13 4LQRA 4CDQA 2R49A 5FY5A 5L9BA 4GWNA 1CAUB 2D7FA 2DVAA 5ANQA 1R1A3 1XXNA 1NY71 5A7NA 5JLVA 3VDDA 1Y4WA 1HB2A 1PHMA 1LOFA 3N36A 4EJRA 4CCCA 2X53S 4CCEA 1O8PA 1WCSA 2AENA 4Y3OA 2NP0A 5DZFA 4AE2A 5I0RA 3FHQA 4JDNA 1HRV1 1XSRA 2BJSA 4COWA 1OUXA 4YWAA 5DDJ1 1XC6A 4V2WA 2PELA 3KCYA 2FDHA 4LBKA 3SCFA 5A3NA 1OLME 1C28A 2DVFA 4QGNA 4EN0A 3LIGA 5KXDA 3FLTA 2PQSA 2DV9A 5GKAC 4FXGB 1ODNA 3VL8A 1XNTA 1HB4A 2VZUA 4X8PA 5L73A 3WDYA 4CCNA 3ENRA 5FFOC 2B8MA 1NLRA 2WWUA 3I4IA 1QJZA 5I0UA 4JRAA 3H1MA 2QQOA 4JGZA 4TN7A 4CRQA 3RYPA 4IXLA 5CFDA 1RMU3 1UOFA 4AEMA 2EXIA 1RVF2 5LEJA 1HLCA 1MS5A 3CO2A 1LOFC 3ZSMA 4Q4Y1 2OIIA 1ZBA1 2P1BA 3VD9A 1LR5A 1H1IA 1WBFA 4Q4X3 3T0DA 4L0PA 1DGWA 1W6PA 4FFIA 1XE0A 3C7HA 3I54A 4X6RB 4LR4A 4U36A 1VMJA 1F35A 4Q0VA 5IK8A 4D8MA 2P17A 5G04L 2YROA 2FHRA 2J1SA 1RHI2 1UF2C 3MLJA 4HK8A 4IGQA 4IV1B 4K6BA 1PZ8A 4NIHA 2JG9C 3UJQA 1V6KA 3I3DA 2CWMA 1W06A 1WW4A 4ONUA 4R9AA 1CD3G 5F37A 5J37A 5FPXA 2Z4FA 3EYPA 2R073 3WW3A 1Y9GA 2Q8DA 3CDZB 3FBMA 1H8TC 4AHWA 2N7GA 4GKYA 1IHMA 5GM0A 3OBAA 1UXXX 1PM7A 1WBLA 1WMDA 2PHXA 4CZSA 4XQWA 3D0JA 3U0ZA 4PF5A 3LEGA 4FSJA 1DQ4A 1DZTA 1TNFA 3V0AB 5IJRA 1GNZA 2JIJA 4FPEA 4M3CE 3Q8EA 4BIOA 4CP9B 1QDCA 4NIAA 5KBFA 1GWMA 1UYYA 3R4UA 3H1WA 4S2DA 3VZNA 3RDIA 1YUDA 4BM8A 1DGRA 1V6MA 2HBTA 2P6HA 1VBD1 4CU7A 5J09A 3VDAA 3E6DA 1CJPA 3T2OA 2JG9A 2GNBA 1H0BA 2Q30A 4OI2A 5FZ9A 3SCHA 3NV1A 5CISA 1H6XA 1POV3 5LBEA 1GP4A 2VECA 3FLRA 1SLTA 3AZWA 4Q0UA 5JOZA 4AHXA 1DCSA 3FJSA 3RZHA 5AFEA 1W39A 4K21A 4FTSA 2WO7A 3KV9A 4FPCA 3SC7X 3VGIA 3RQ0A 4HVOA 3OBZA 5EYXA 1W05A 1W2UA 2BDRA 1HV1A 2W47A 3FHIB 1EV12 1VBE1 3OUJA 5BNNB 1Q8VA 3SKJE 3FLPA 4P9JA 1HDKA 4NRPA 5B4XA 2FCVA 5EWSA 1ZBE1 4HPKA 5EJZB 1ZZ9A 4OVEA 1NAEA 4XFIA 1XU2A 2WUHA 2ZGTA 3C7OA 5CB7A 4B8EA 4LO5B 2OUJA 2PHWA 3WSOA 1CAVA 1JODA 4FQ4A 1LOGA 1G9FA 2ZGPA 1WA6X 4OYUA 1NE6A 1S0EA 1OOPA 1RVF1 1KDMA 2VQUA 4NPLA 2LM3A 1RUI3 5D1IA 4J1WA 4JKLA 1R1A2 2JDHA 4W6XA 2BP6A 1D2QA 3NAPB 4CDUC 2VTXA 2R042 4FT8A 4KU7A 1DIWA 5JPNB 1AR73 3USUA 3H50A 4JVAA 2X5IB 3F95A 1PK6A 1JYIA 4AI2A 5A70A 1W9WA 2ZX2A 2VVDA 3I8TA 2VMFA 1S2KA 5DABA 3WG1A 2JG8B 2XJTA 5FIXA 2WA3A 3RZZA 1VE0A 3AM2A 3TEZA 2HWD1 5IFPA 1CESA 3B00A 1BMV1 2J7MA 4CEWC 1W3XA 1PMIA 1ZZCA 3PU8A 3AB0A 3ZSEA 3HN1A 5EPAA 1H6YA 2BOIA 2X29A 4FAGA 3CF6E 3C7EA 3VN4A 4YZ2A 3THDA 3VBUB 5E89A 1J1LA 2WLQA 4LMFA 2QQUA 2G19A 1OH4A 1W6MB 5B2GB 1H2KA 1PGW2 2ORXA 5BUVA 1YFWA 5A7QA 1IKQA 3SISA 1RUI2 2HEYF 5CKMA 2IXJA 2RDSA 5FZ8A 3ZN4A 1RUC1 4Y1VA 1RL3A 4FOYA 4A4AA 4DB5A 4YVWA 5APAA 1VP6A 2J1EA 2PHLA 4BE3A 4OUMA 3RGBA 4PIYA 3GHNA 5I0SA 2R6QA 4YVWC 5FO8B 5BPXA 2VZRA 3VBUC 2EXJA 5C70A 2A6VA 4JGYC 5ABJC 4CA9A 4XQ4A 1BK0A 1CAUA 1J58A 1H4GA 1TMF1 2O14A 4CTEA 3NNLA 3MDPA 3LE0A 4XUPA 4CEWB 2E9QA 4FPKA 5FP3A 1E57A 1EY2A 1WCDJ 3PVBB 3I2KA 4QXCA 1N47A 4BQXA 1DQ1A 2VMEA 2FZ1A 4I02A 2JG8C 2QQWA 5KXBA 5FYBA 1RB8G 3T4HB 2XPJA 4WM7B 1X9PA 2XL9A 3OJBA 4CYDA 2FD8A 2WN2A 4P9WA 2WKKA 1RJ8A 4PIZA 2RM23 3GCXA 4Q4V3 3BODA 3AL5A 2VUDA 4XZUG 3IMMA 2EXKA 5FUIA 2J42A 4AF9A 3IT8A 2JB8A 3I3BA 5KHGA 1TNRA 1UYXA 1HJFA 3ZKYA 3AKSA 3POWA 4UBHA 5JSOA 4D6QA 4CU6A 2XWJB 1H2MA 3BIWE 5DAXA 4YW7A 2WR9A 2D93A 3MF6A 4AXOA 1LTEA 1TQ5A 3LOBA 2ARXA 3ITQA 4JTOA 3H8XA 1QJEA 4IEXA 1C8M3 2XGXA 2AGSA 4A2UA 4HT1T 5LA0A 4JHTA 1W9FA 5IW0A 3D3AA 1H1MA 4YFZA 1F2NA 2JDPA 2GP5A 4QMAA 2C6SA 1ONAA 2AEYA 4I3GA 3SNMA 3ZFGA 5FYVA 2HWC3 1W0PA 4XMIA 1QKQA 1K45A 5T5LA 2Q8OA 5FZOB 2YY1A 3VKMA 2W3JA 3LIHA 4JX0A 1J84A 3E5XA 4FQZA 1VPHA 4C91A 3HQRA 4BYYA 5A1AA 3KB5A 4MGSA 2JE7A 2VVEA 4LK6A 1PVC3 3NV2A 2YXSA 3POGA 3TEXA 3ZYJB 4QPGC 5BXXA 1OLQA 1GP6A 3R0RA 3JU9A 3KVBA 1GWKA 2D97A 3GBWA 4EN7B 1CAXA 1R081 5FZFA 1GNHA 3MYXA 4JQRA 1KS4A 4FOVA 1ZREA 3WUDA 3NV3A 2ILMA 4HANA 3WQBA 3ECQA 5FY4A 3J8F2 2VPVA 4ZU4A 1Y7BA 1DP0A 2LUWA 2ZMLA 3I59A 3AVSA 3Q8BA 1LULA 4MSVA 5CVRA 2X10A 3VKFC 1GKBA 1MZFA 2DUQA 1Q56A 2CGNA 5CAZA 2YC4A 3WDUA 3NJYA 5C8CB 5C9AC 3U4XA 5K4LA 4LOSA 2QJVA 2QQJA 2AYHA 4Q8KA 1JHJA 1JUHA 1POQA 2VBDA 2W39A 4UXAA 1BEV1 3KVAA 2DU1A 2HWF1 2VM9A 1NLSA 1WUVA 2XVGA 2BNNA 2ETEA 5G05L 2OQ6A 2W1UA 4YVWB 2YFZA 2FDJA 5F8PA 1ASJ3 3ZIWA 3LDKA 2CAUA 3P6BA 5F5QA 2WRAA 1SLIA 1W6OB 3LD8A 3VDDC 1REFA 2RR11 3OUIA 4CDXC 3DECA 1W8TA 4WVWA 5CYYA 1XNCA 1KJLA 4XAEA 2BPA2 5J98B 3AMHA 1FV2A 4QX3A 1DBNA 3Q8CA 2Y6GA 1CPNA 1ND3C 4Q5OA 4XIOA 3S7EA 3U14A 2XB6C 1PO23 3POIA 1R091 3K77A 1C1FA 4PBOA 3I2DA 4UW5A 4OHZA 4NROA 1JYWA 4NJ4A 4EZHA 4MUVA 2HJIA 1PZ9A 1OC1A 1VRBA 1QIQA 2WA4A 4R9BA 2WT2A 3LWCA 5IFTA 2GH8A 3WF4A 3POJA 1VB2A 3ABZA 4QM8A 3TNPB 3IB3A 1ZZBA 2I2SA 5SV5A 1CAWB 5FREA 1G9DA 1NLQA 3T09A 1W04A 1FPN3 3AZZA 4MVTA 4QKBA 4XPVA 2WS91 4Z92B 4G9SB 4W6YA 1VMFA 4GZ9A 1MS9A 4YZ3A 2FDIA 3KD4A 1AJKA 4XFAA 1JZ4A 3K4ZA 1RUOA 5DXDA 1DZRA 1W03A 2O8QA 3OYWA 1DQ0A 4BQWA 3WD5A 1QJY3 4W8JA 1BLZA 2NPIA 2Y6LA 1K5MA 3VBOB 2RHPA 4DY5A 3BOPA 2ZMNA 5ACA2 5T55A 2JKBA 2ZACA 1PK6B 3K48A 2WNOA 2WWSA 2BEOA 2ZS6B 2XBO2 2UY9A 4YARA 5FUPA 1BXHA 4L92A 1PIV2 2JG8A 4J6GA 3L2YA 4LO4B 4CPBD 4M4PA 1AL21 1ALYA 1QHDA 1SBFA 2D6OX 2X09A 2WLPA 4AFAA 4LPLA 5JUVA 1R082 1WKYA 2JKXA 3OUHA 4RQPA 4GB33 3ZFEC 5ANNA 4ES9A 4FPOB 4IE0A 4CEYA 2QQKA 4DPNA 3AL6A 3POBA 4N9IA 1QJX1 5JOYA 2VE1A 4QX8A 1OA2A 1UZVA 1QF3A 3ES4A 4P9GA 1MVEA 4A3XA 2A3YA 3VDCA 3ZPYA 1PGSA 3W5MA 1D4M3 3F2ZA 3KSCA 1TMF2 1COV3 4RL7A 4M4RA 1G9BA 5KR7A 3J7NA 1N1SA 2R041 3T2QA 2BOJA 4LULA 1H9WA 1A3KA 3MW3A 3ACIA 2WNVA 2PHRA 4XFGA 1QH7A 3VBHA 2R16A 3HBZA 2P3IA 5ERLA 3U07A 3ZFGC 1GYKA 4XF0A 2RS13 1AXZA 3ETQA 1P8JA 5C8CC 1LHVA 4IV3A 5FK8A 4LO8A 3WF1A 3PVOA 5KHHA 5FRAA 3U75A 2UY8A 5CZKA 5LA9A 1FOD1 1U12A 3LPFA 3WDWA 5A33B 1UL9A 5B4NA 4IE5A 2WFF2 1JOBA 3M4FA 4MHUA 2GC2A 3H1YA 4D69A 1TME1 2TBVA 2XJUA 3O5SA 1AR62 3KMHA 5A32A 4RHV3 5JAXA 1LECA 5BY5A 2ZHLA 3OGVA 3IKWA 2JE9A 1S0GA 4URAA 5BYNA 1DFQA 4PDWC 3V64A 3DKQA 2ORZA 2UWAA 2A75A 1JOPA 1I5PA 2Y8KA 5F3GA 3WX5A 1PIV3 1YI9A 1MQTB 3WCSA 2CL2A 2BTVC 4CP1A 1EAH3 5C3PA 3EXUA 4A41A 1V70A 2GC3A 2JECA 4YLZA 5L7OB 3LZZA 4META 2EXHA 3DYPA 4CCOA 2ARCA 1XE7A 3APBA 3WW1A 1O4YA 4YM3A 1YEWA 1XPWA 3O0XA 3IPVA 3P5BA 3RMYA 2NLRA 2VZQA 1LKNA 3KCCA 2QQMA 3KF3A 1YFYA 1UU4A 5DAVA 1OFSA 5LY1A 4EROA 1VBC1 2ZGUA 1QMJA 3AKRA 3D0SA 2GC0A 5ACA3 3KT7A 2VNVA 5LB6A 1H1AA 4LBJA 5FZAA 3A21A 3AC0A 3ES1A 4YRDA 5LRRA 3M8LA 1WW7A 3I97A 2B5HA 3PLQA 3RSJA 1RUE1 4I0AA 4WVZA 5BNPA 2QE3A 4COZA 1AXYA 5IK5A 5FO7B 3ZYHA 1SACA 3C7GA 5T52A 3JBG2 1MQTC 3S0MA 5F3IA 4PF1A 5FPUA 4OQ9A 1XNBA 4ASLA 1XJAA 2BWCA 1REEA 1RUF3 1WCUA 2VZ1A 4L8QA 3KT4A 5K8SA 1AR92 1EAH2 2CSGA 5FXVA 1PO13 3O1MA 1UYPA 1W9YA 3TB0A 1W8HA 3ZXLA 4A6OA 3LOIA 1RUE3 1QNYA 3B94A 3N7JA 4GAZA 1NE4A 4QPYA 4XF3A 1JZ2A 1JI6A 1NQDA 4JGYB 1V6NA 2NQYA 5ABJB 1PX3A 3FZ3A 3J7MA 3ZSJA 2LALA 4RN5A 4J25A 2XKOA 4DS0A 3VD4A 1VBC3 2OQ7A 1URXA 1KJRA 3S5QA 2XVLA 3JZVA 1XB9A 3PJYA 5A7WA 1BZWA 1OMIA 1QXJA 2WO3A 4XJAA 1Q8SA 4AVVA 1SBEA 1XYNA 2RS33 4RYDA 2GAUA 5A32B 4DO0A 4Q4W2 1JYXA 4JDMA 4LLOA 4QX5A 1AX0A 1GLHA 3LFIA 5HV0A 3EHKA 2VUJA 3M3CA 5EHDA 1STMA 3ZMOA 2YU2A 2IXIA 3WNPA 2E7TA 2DU0A 3TN91 4QDRA 4ARYA 1I3HA 3DUIA 4INDA 5FYZA 1PIV1 2RE9A 2PLV3 2VULA 1TE1B 2J1UA 3OG2A 3H3LA 1A8DA 4GWMA 1GSLA 1OURA 1LHOA 1U5ZA 5C5TA 5M0TA 2WL1A 3ON7A 3AYEA 5T50A 3BI3A 2K0GA 1SCSA 2CU5A 1TME3 2AREA 3E1F1 3ZFGB 2E26A 2Q1ZB 4XBLA 2D3RA 2WFF3 2R063 3W58A 5C3QA 5K0UB 1O59A 5EZWA 5FZ7A 5F3EA 3WF2A 1DLCA 2HWC2 2I07B 1PMHX 3FUQA 4LKEA 1LAJA 1IOAA 5D8AB 3WF3A 1AZDA 3CZJA 1DHKB 1T2XA 4MGTA 3FBYA 2W52A 4AI0A 4YW5A 3S57A 3OEAA 2ID4A 4QT6A 2CGPA 3AYDA 5JXGA 3P3NA 1O3RA 2AUYA 3IMNA 4PLMA 3UGFA 5J7MA 2C5DA 3MV01 5F9TA 5IAVA 1JUIA 5FQ0A 1UOBA 3BOWA 2XBO3 3ZFFC 1F5FA 1WMFA 2ATFA 4YGDA 1F15A 1L7RA 4NHMA 4CDXA 2K9ZA 1R092 4D7TA 1YQ5A 1BJQA 2FZ2A 3AJYA 3WNOA 1S4CA 5GLZA 4ATEA 1AF9A 1UQXA 4LBQA 1O6UA 1W6QA 5HBAA 2TEPA 3UL2A 3OPWA 1S55A 2IXHA 3A7QA 3ZYBA 4PHZA 2WAOA 5FZGA 1QXPA 3MUY1 4Y22B 3KCXA 3SH5A 4IEPA 3O14A 4GB31 4BHPA 3QLQA 1GZTA 1IPSA 3CJIA 3IM0A 3SH3A 1NG0A 2JJ6A 2NYYA 3EMRA 3ZVXA 1W0OA 3QACA 4FPHA 3RZJA 4P9YA 4XJ8A 5JI7A 3O12A 3WNXA 3ZO0B 4A7KA 3HPNA 5HCHA 3PIGA 5L19A 3DPRC 4HKOA 4IDZA 5FZ6A 4C0BA 2Q8EA 4KQ7A 1YCIA 1LOCA 3UJOA 2EICA 2H6CA 5GLVA 4XUOA 2WNVB 3N9MA 3OGGA 3VBHB 3VDDB 2D6KA 1JYNA 3MIHA 1YJLA 3IN9A 4YG3A 4CP2A 2HWB2 5KHJA 1M4WA 4AQSA 1W8UA 2XLAA 1TVGA 5FYCA 1QWRA 3WF0A 4S2GA 4OQ8A 4CSWA 3ZXKA 2DVDA 3H8UA 3SHRA 4FFHA 3V0AA 2F17A 1QJU2 2DURA 2WS93 2ZGOA 1ULOA 4LBNA 2RVAA 3PVNA 1MEC3 2JENA 2ZGSA 2ZMKA 2WZR1 2VQAA 5H9PA 3HVDA 5BNQA 2JDAA 1WD4A 3PURA 3W59A 2IC1A 1B35B 4XF4A 4RD7A 3PUSA 2IXCA 1EYBA 4WVVA 4CCMA 3D6EA 4Q4W3 2NMOA 2RS32 2VGDA 1ZRDA 5D8AA 3DPRB 3RG0A 4CUAA 1PO22 5LK7B 4CCLA 2WZR3 3AYAA 3OYWB 2K46A 2OT7A 2VZ3A 4LHNA 5DQ0A 1YJKA 2UYBA 3AX4A 1JYTA 2EIEA 1PM4A 2HWF2 3BN6A 3NKTA 3ZDVA 1MVQA 1AYN2 1XSQA 4NHLA 4BDVB 2WQ4A 4J1XA 2IXLA 2Q0AA 3DKWA 4QKDA 5JDBA 1G7YA 2YG0A 4XZPA 4QQHA 5HXVA 2VAUA 5LW9A 3HIFA 2RR13 2P37A 2BQPA 2RJKA 2VQTA 3B9IA 1ST8A 1ASJ1 1HRV2 4LIVA 1R64A 2JICA 3CEWA 2BU9A 2QZ3A 4UW4A 4ZHNA 3U78A 4BOWA 2VBPA 3GJBA 4ZKTB 3LPGA 3WR0A 1NCRB 3TN92 1G6NA 2WZ8A 2Z2SB 4LUKA 1UU5A 2P3KA 4MGZE 4ISQA 4MV2A 1Y43B 3WLUA 3IIAA 4PLOA 2ZZJA 1RUE2 3HQUA 3VKOA 4YGBA 4A7YA 3LSEA 1OBNA 4GH4B 4F3JA 2WYSA 3LKJA 3ZN6B 5LBCA 3MW2A 4BQYA 1KEXA 5KHKA 1ZBA2 2PA7A 2DDUA 4PQ9A 2FDFA 2OA2A 2SLIA 5JI9A 1LOBA 3BPSA 4HPKB 2CHHA 3VBRC 2G9GA 4FOWA 1YFXA 4AYUA 2KD7A 5FZ1A 1JZ3A 3MGUA 2PMWB 5DMYA 1V9U1 3I2JA 3PVEA 1R083 1SLLA 1N3PA 5IVYA 1RJ7A 2VJXA 3PUIA 1PX4A 4BISA 4ES8A 1G9AA 1K5JA 1UIKA 4Q8LA 5CNAA 2V09A 3I3MA 3GXUA 2AC1A 4NO4A 1EPZA 2VZOA 1N3OA 1WW5A 4Q4W1 1PVC1 3RJRA 3T1LA 1YFUA 4UFJA 1UKRA 4KNCA 3WP3A 1EUUA 4D3WA 2YB7A 2OKXA 1SDDB 5FWJA 2D40A 1VR3A 2VU9A 3J8F3 5FTTC 4IEUA 1JYVA 1VJ2A 3SLIA 1MEC1 1WLWA 2HYXA 4NUBA 2P2KA 3THCA 3I3EA 3AP9A 4RR3A 2QCSB 4YVSC 1ZZ7A 1GANA 1AXKA 1UNBA 2D5HA 3AFGA 3S6PA 1HQLA 2YZ4A 2VNGA 5E6HA 3JXSA 1GQHA 1CIWA 1C8M1 1J3QA 1KFUL 1Y3TA 4FOQA 4UW3A 5GZDA 3WQ1A 1MS4A 2VD7A 1PGL1 2A73B 3MFAA 3QH7A 4XABA 1S0CA 2DVGA 2Z5WA 4A6SA 3WXPA 2WNUC 2YBPA 4W50A 4M00A 4QX1A 3E6CC 4B4QA 1UY4A 3THPA 4CXWA 3B02A 1AL0G 4OHVA 5FUNA 3FWEA 5SV8A 1X82A 4AG4A 4IV1A 2GMPA 2PLV1 3FC0A 5T5JA 1ULDA 2BWAA 5KC5A 5I8YA 5IVVA 1V6IA 3MBWA 4XTMA 4QD2A 4JKMA 5K9YA 3HJRA 1W9TA 2GU9A 1CIYA 1W2TA 4MHRA 2CNAA 4AW7A 1S2EA 1AX1A 3MW4A 4P08A 4MG2A 5FXZA 4DRVA 3TRSB 1IS5A 4AHZA 5LA2A 2Q4SA 2RR12 2OZJA 5GZFA 4DEVA 5K7PA 3KS7A 2HWE2 2X5IA 3S30A 5TSWA 3VBUA 4AFCA 1SPPA 4AL9A 5KXEA 3AP4A 1UD1A 4UI9L 2XWBB 4Q4V2 2VL4A 2BNMA 2A1XA 4FFGA 4IL7A 2VY0A 5L36A 1V0AA 3GYDA 4XILA 5KWRA 1G9CA 4XDPA 3J7HA 3ASIA 2VW1A 3D82A 4RGKA 1ZZ6A 3SITA 4FI9A 4QQ2A 4AVTA 1VAVA 3WT3A 1C5IA 1PO11 3HMYA 3L9JT 2WYFA 2EAKA 1KDKA 1W2OA 3ETPA 4DNYA 4EN8B 4F83A 1RUF1 4N8MA 3H7JA 4WV8A 3SEPA 5J48A 3VHNA 3B5LB 3QD6A 4I2OA 1NZCA 3NNFA 4AAPA 3WW2A 2R061 1HQNA 5LA1A 4E4HA 2WBKA 3I3QA 4RGAA 2Q1MA 3OB8A 3TOJA 1QQP2 4B7KA 1NX9A 1YLLA 5FY8A 4CXXA 2QNKA 3ZFFB 1W28A 2FCTA 1U5XA 4Q29A 3EQEA 3H7YA 2YMZA 3C8XA 4E4ZA 4YZ5A 1KXGA 3VBRB 2UYAA 2XQXA 5CKNA 1W8OA 3CJXA 1AYM2 1RUH1 2BGOA 5C4WC 5FCCA 4EWEA 3AJZA 5CIRA 5FY1A 5ACA1 1NCQC 4M0HA 1NA1C 2JDZA 2ZKNA 5FPZA 2VXRA 4JTNA 2ZGNA 3AK0A 2VMGA 2E63A 1GOHA 2YC2A 3OY8B 2OPKA 3KZ4C 3N3HA 1OOPC 4QHOA 5FV3A 3CZUA 3W5NA 5T3NA 2ZABA 1ZM1A 4D7YA 5T54A 1N1VA 2RS31 1CZVA 2R32A 3WDTA 1NCRA 4CVUA 1X36A 1H9PA 1S0DA 2W5FA 4M3CB 5LEKA 1H4HA 3H3ZA 4YM1A 3USUB 2WAAA 3RYKA 3M2MA 3UKVA 4FO9A 4H2AA 1RUH3 3N9QA 1IKPA 2P3YA 1JU4A 1O5UA 1QY4A 1VRH2 2I74A 2A7AA 3QBQA 4HOOA 4QXKA 4X6QB 2QQLA 5HCFA 2WWJA 2QKDA 3J9SA 1ZBE3 3ROUA 3WDXA 5JVVA 4BA6A 4YW2A 1SDWA 2QQVA 1NQJA 4MOAA 3M7AA 4P5HA 4K1YA 1O3SA 2VMCA 3T0AA 2JB4A 4XHBA 4XTPA 2CYFA 2Y0OA 3O7OA 1K42A 4OHXA 4QX2A 3BVCA 2JXAA 4BQ3A 2BUKA 4XMAA 3MIGA 1HKDA 1G86A 1ZX5A 1FOD3 2DCKA 4DRRA 3RVHA 1B35C 4MYEA 2HH9A 3WNNA 5DN2A 2GH2A 2R072 5KHIA 2V73A 4UFKA 5C9AA 2RS11 1POV1 4Q27A 3KQ4B 3N7KA 4BCUA 1SLBA 4XDOA 1OA4A 3ILRA 5EYYA 4Y26A 5E88A 5FZCA 3FHAA 1SBDA 4P02B 5FP8A 4JC1A 4QXHA 4Y1YA 3CHXA 1COV1 4B3NA 5J3UA 4MXWB 5FYHA 3VHRA 4UFMA 3UKTA 2V4AA 1V6OA 3PHMA 2R7EB 3ELNA 1QJX3 2W87A 1BCXA 4AVCA 1XNKA 2XKPA 4CDQC 5KXCA 3O1PA 4Q4X2 1IPJA 3OOXA 3WZ1A 4O9GA 1WGPA 2VMIA 1D2SA 5FAXA 1Y9QA 1SZBA 3HAGA 3KM5A 3RS6A 3NMBA 5F2SA 5C7GA 3WP5A 4EN9B 2PLV2 4HKWA 2XJSA 4JQTA 1RYYA 4PIXA 5F1RA 3PMSA 1O3QA 3OY8A 2QZ2A 5D21A 4NHKA 3N7LA 4AI8A 5F5AA 2JDMA 1NXMA 3K4AA 4UBGA 5FMOS 4WVMB 3WHTA 4GWIA 3OTFA 1XNDA 4W6WA 1UOJA 4GQ7A 1QJY1 1TME2 1Q8PA 1W2NA 3UGHA 3WG4A 1CX1A 3NNJA 1W8ZA 2WNUA 2Y33A 4IE6A 4UWDA 1TEIA 4Y20A 4L97A 4BB3A 3NJXA 1T6BX 5KC6A 3RRDA 4C90A 1UMIA 2A3XA 1S0FA 2VQ0A 2XJRA 4CU9A 4TLGA 4QHZA 3HNYM 3RZMA 3FMGA 2Y0IA 3JQXA 3O1OA 4BLJA 4LIUA 3J8F1 4YVSA 5A6ZA 3UNPA 1O3TA 2F6BA 1YIFA 1ZNPA 1YYNA 4XOGA 1OT5A 1KQRA 3N9LA 4QKFA 4FBFA 5C71A 2R043 5IYYA 3FL7A 4Y4RA 2F4LA 1ZRCA 2RDQA 1LEMA 3HBKA 3LCPA 4M01A 4CP9A 1LOEA 2BVVA 1YIPA 1R093 2V5DA 1CAWA 2BRTA 4X8NA 1NYWA 4A3ZA 1IZ3A 1V9U3 2WQ8A 4YPJA 4BLIA 5C9AB 4KI5M 3H42B 5A1FA 2JE8A 3SCGA 5FZEA 3WOGA 2GZWA 4CE8A 1VBC2 5JOXA 2BBVA 2D3PA 3BPZA 2G1MA 1HRV3 2YPJA 4XF1A 1RMU2 4Z07A 3WP6A 2EIBA 5LBFA 5FZDA 2YFUA 2YYOA 3VZMA 1PZ7A 2G4IA 5CFDB 2MHFA 2NZ9A 1HN1A 3I2GA 1X9TA 1FX5A 2HBUA 1W6OA 2CDOA 2ENRA 4XJUA 3KWVA 4OUEA 4IV3C 2MPFA 1FAYA 4JRLA 2RJLA 4IESA 1ZA7A 2ZEZA 3BYWA 4IV3B 5IVJA 1BEV3 1EV11 4XAAA 2B7YA 3LQCA 1OSGA 3JQWA 1DGRN 1SLCA 2XOMA 3UK9A 4I0WB 4NPRA 1JZ5A 5LWBA
chains in the Genus database with same CATH topology
3AFKA 1QOTA 4XJZA 2ZCWA 4GMP0 1VALA 4Q2FA 5E1RA 1NCQA 1GR3A 2YDEA 1QU0A 4P9IA 5LK5A 4TWTA 1LJ7A 3ZYGA 5JR7B 4XFFA 4AK3A 2R062 1FPN1 2DVBA 2WS92 3MICA 4WVMA 1GZCA 2D44A 3USSA 1MEC2 2EA7A 4SLIA 4IETA 2O1QA 3AMPA 5H9RA 4AEDC 2D6PA 2PHFA 4FP2A 2JEMA 1LODA 1UW8A 1WCKA 3OGJA 2HWC1 2OUHA 5FBZA 1ZYBA 4H7LA 4LE3A 4WM8C 1ZBE2 1BBT2 3S7IA 3WG2A 1RUJ2 4XDQA 1U5IA 2RS12 3ZSLA 4FTEA 1Z0HA 4TYSA 1FNZA 3PJQA 2IXKA 3EO6A 4K9SA 2DF7A 4GA9A 4Q1PA 4FPGA 2WZR2 4OI1A 3PNAA 1QNWA 4LUMA 1H8VA 4HBNA 3WP4A 1MZ6A 1DQ6A 4AI3A 2HYKA 2HEWF 2NMNA 3TAYA 4ATFA 1H8TB 3M1HA 4YG6A 5GZGA 3HWJA 1J1TA 1DDLA 2WQZC 1CONA 4AEJA 1VBA2 2E7AA 2ZX4A 4GALA 3VBSA 1ND2B 1U5YA 1F9KA 3H9AA 4N53C 1NXD1 4R8HA 1WA4A 3MLLA 5GLWA 1TMF3 3OD0A 4DOUA 3WCRA 3ZX7A 5GLTA 4ITCA 4QGLA 4MZUA 1UPIA 3C2UA 1HXS2 2XBO1 4K40A 3AMMA 2ZGQA 1FYUA 4MLOA 4I0BA 3AP5A 2VMHA 1RUC3 2RS51 2BW8A 5CBLA 4HSLA 1H30A 4R4XA 1OOPB 5FLIA 1UN1A 1OFNA 4COVA 4Y24A 3U11A 1BEV2 1FI2A 4Y1ZA 2A5ZA 2ZOEB 1VBD2 1OD5A 2WFF1 2DTWA 2ZPXA 1NCQB 1F8VA 2SBAA 3OPZA 3RNSA 4L2NA 1KITA 1DYKA 4JGYA 5ABJA 3VKLA 2HWD3 3V0BB 1LHNA 1KFXL 4NWWA 3U10A 4F8AA 3JUUA 4YW3A 3ZFEB 1LGNA 5JZGC 2RM21 3VHPA 4DINB 1UU6A 3TN93 4YGEA 3INAA 4KWJA 1VAKA 3AKQA 4A7ZA 1UMZA 4Q4Y2 5BNPB 1O5LA 1AR93 1RUI1 4BMEA 1W6MA 5E8AA 3QH6A 1FV3A 1RVF3 4AGRA 3G6JB 3R05A 2XJVA 1MS1A 5FLJA 2GDFA 4AGVA 3PMEA 2K2SA 2YHJA 1W6QB 2QVSB 4EWAA 3IDEA 4GXLA 2QDNA 1MS0A 5K0UC 3MEPA 1ND2A 2CTVA 2BFUS 4DFSA 1BMV2 2I45A 3ZDSA 2ZAAA 5K0UA 3TBDA 1RUH2 2DCJA 5FOBB 2VG9A 3VZJA 3LSDA 1CGPA 4JGZB 3MIDA 2C0ZA 3M3IA 1YI7A 4YM2A 5FO9B 1YRZA 4LBQD 3CU7A 5CFCA 1RITA 4KG8A 3RI8A 4OFGA 1X8EA 5LRSA 4LO6B 4L9BA 3NW4A 3RWNA 3AKPA 3J4UH 3FFQA 4FXKB 3DGTA 4RGGA 1LRHA 3CLPA 1FNYA 3ILFA 4XFCA 2QQPA 1LEDA 4Z2WA 4OZXA 2ZZQA 4FVVA 3V0BA 1RHI3 4WZFA 2F4PA 4JGZC 1UZYA 1EAH1 3GZUC 3NKGA 4LBLA 1CVNA 2WT1A 2ARBA 3ZXJA 3MI8A 4HVQA 2YGLA 5EV7A 2BGCA 3VKNA 4W65A 1QXRA 2GMMA 1OI6A 4KH9A 4XFHA 2R30A 1LU2A 4FPYA 4WM8B 1QJU1 1YXWA 3ZSKA 4RHV1 2R1BA 2B45X 4CDUB 1X8MA 3OBTA 1XU1A 3DF0A 1CAXB 4JV4A 2XVKA 3ME2A 4Z82A 2ZJCA 4Q4Y3 1DGLA 3NVCA 4XYXA 1DF0A 3B93A 1HXS1 2HEVF 4HLTA 5AVPA 3I59B 3WG3A 1JHNA 2OYZA 1EP0A 3GHMA 4LNVA 1NCRC 4L99A 1VBD3 3VBSB 2A3WA 4ISRA 4HKLA 1N1TA 4QQOA 1H2LA 4OI0A 1OQ1A 1Q5OA 1JYCA 4JDOA 1D4M1 2HWD2 1RGSA 4BIFA 3WDVA 3THTA 4LBQB 1YNAA 1F5JA 4GH4C 2DYCA 4BMBA 2TUNA 4GIQA 1ENXA 3L2HA 1RC6A 1AL23 1NOVA 1X7NA 2ZA9A 1R1A1 5H9SA 3N7MA 3ZFEA 5CFDC 3KLSA 3ILNA 5I8TA 1SCRA 1LGBA 3KGZA 5T5PA 4YSFA 2WNEA 3E97A 1UPSA 5EJ3A 2A71A 1AUYA 3NO8A 3MFCA 3CL1A 5BNOA 4Y1UA 2BYVE 2UWBA 2ZBJA 1AR72 4KL1A 1APNA 1KRIA 1RUG1 3JD73 5AC92 2JX9A 2VOXA 4MX3A 4XQDA 4Q4X1 4N53B 5GZEA 2E51A 4QU2A 3ZN5A 1ND2C 3POYA 4GB32 4C1XA 3AXEA 2VNOA 3LA7A 1C8NA 5I0TA 3HR9A 1XYPA 1RMU1 2R1DA 2VOVA 2OW4A 5C4WB 3WHUA 4CDUA 1C5HA 1QDOA 4G4FA 5GALA 4YZ1A 4XF9A 3IPVB 3ZMNA 3ZN6A 4OUSA 1BKZA 1FMD3 2PYTA 4WZCA 1AR82 4YNIA 1I9RA 1LHUA 4ORFA 2DFBA 2RM22 3NSTA 5E16A 1PO21 3D5OA 1WLDA 4YZ4A 2A6WA 3ATGA 2CY6A 5DDJ3 1QGLA 2KXLA 1GZWB 3CNAA 1A8MA 2OZ6A 1ULFA 5CFCB 3GBFA 3MZHA 1Z78A 1VBB1 1FATA 5IK7A 4C1WA 1XRUA 2GMEA 3LB9A 4E9KA 4D7SA 1C3HA 2VOKA 2HWF3 4YYOA 4P14A 4CEYC 3JB4C 3R4SA 1Q43A 3IWZA 1Q8QA 4IEYA 2ZX1A 4YG0A 2A6XA 3NWKA 2H0BA 3ZYRA 4Y1XA 4Q0PA 3VZLA 4FTBA 3DN7A 2ERFA 2VOWA 4AQTA 5HCAA 1AVBA 1JN2P 2Z69A 4PDWA 5JZGB 4M3CA 5FDBA 1K5MC 4JCKA 2BVBA 3M3QA 1W6PB 1W6NA 2XL7A 3OD4A 1SEFA 4QHBA 4M0NA 1PVC2 5HI0A 2PAEA 4QPGA 3ZFFA 4FCAA 4TLFA 1LB2A 1QQP1 4MGKE 4M3CF 1IS4A 4URTA 1ZZ8A 2E53A 2C1FA 4FPLA 2WZPP 1S1AA 4MGYE 2BFUL 5JSPA 1FOD2 3GALA 3R4DB 4XETA 1ZA4A 2HWE1 1ASJ2 3BCWA 2EALA 4FPFA 2FBEA 4IEWA 3BTAA 4HMZA 4TZDA 4CDWB 4N43B 2XJPA 1CR7A 2GNMA 2VW2A 1KD7A 2NN8A 3N35A 5JIUA 1AL22 1RUJ3 1OQEA 3OF1A 1JW6A 4Q4V1 1SLAA 5JOWA 1N1YA 1J59A 1DQ2A 5FQ0B 3SXWA 3R6SA 2GALA 1DQ5A 4DZGA 4RQPC 4YW4A 4B7EA 3FE5A 1QJX2 4OLLA 1PNFA 3WQ0A 3A4UA 1X33A 2EAAA 3MIEA 1OKQA 4E2QA 2JD4A 4OULA 3AMNA 1C4RA 4ZXKA 4H7MA 3D8CA 3VBFA 2GNDA 3VV1A 3AZXA 4NN0A 5DUVA 3M3EA 4HVRA 4Z8BA 3VUOA 4HL0A 4NR1A 4K7JA 5AVAA 2FMYA 5DZGA 3NAPA 1RUD1 2D3SA 4K8FA 2GN7A 1U0AA 4K20A 5DZEA 1GZ9A 4CP0A 1GBGA 1GQGA 3JBG1 1FPN2 3VBRA 1BQPA 4KU8A 4RHV2 4JAAA 1J3PA 4PLNA 3M3OA 3JD72 5AC93 4TSVA 4WM7C 1VAMA 1MS3A 3T2TA 5DUXA 1YWKA 4Q0QA 3K51A 1C1LA 4Q1RA 4GMP1 3UV9A 3ZXFA 3BB6A 3HD8B 3O0WA 2HWB3 4BQ1A 3GZAA 2BNOA 5FMOL 5C8WA 4IQPA 1OQDA 4EN6B 3WW4A 4P9XA 3PTYA 5C4WA 2PFWA 3QOPA 1UZZA 1AR71 4K1ZA 3SH4A 2YUEA 5BNOB 3AYCA 5BNNA 1RUD3 2WIIB 1OPOA 2YC0A 1HW5A 2ZGKA 3EJKA 2XHKA 1A78A 2R0HA 4MH0E 4B4PA 5A3LA 1LENA 2WSUA 2GC1A 4RQPB 2PHUA 1ENRA 4BPZA 2B46X 1B09A 2DCYA 4AWDA 1AR81 5GZCA 1V9U2 5JWPA 4N43A 1O4TA 1DGWX 1HRI3 1NY72 4YVSB 1REDA 1OA3A 3RMXA 1VBA1 1DU3D 1VBE3 5JPMB 4LHKA 4DMIA 3VBFB 4H14A 4AQ6A 1AX2A 2A6YA 4HN1A 1ENQA 2X5IC 4GULA 3IDBB 2B39A 4PBPA 1I5ZA 3LA3A 1AR63 4LBMA 1ENSA 5GLUA 2VW0A 2DWRA 3B01A 1LHWA 1VRH1 4RS5B 3G7DA 3JB8A 2HWE3 3VBOC 4LA2A 1T6GC 3GNEA 1DYPA 1FXZA 2EF6A 1LU1A 2PHDA 1KS5A 3IBMA 3POSA 1X50A 4IERA 4Y5Z0 4OHWA 2ZX0A 5I91A 4AVSA 1MZEA 1DLLA 1Z7S2 3ALQA 3AXDA 4MXVA 4LA3A 2R071 4KWKA 2ES3A 4B29A 2A6ZA 5IUQA 2PAKA 1MS8A 1ULEA 1F31A 4LHLA 2MEV1 4RR3C 1SFYA 2ZHKA 2IFWA 4Y20B 5DUUA 1J3RA 2XLGA 1Z7S1 2Y26A 3DV8A 3NV4A 4S2HA 4KGQA 3D4KA 3T1MA 1LCLA 2ZHMA 3P3PA 1VIWB 4E4SA 1S0JA 2ZGRA 4I09A 1ZBA3 3AP7A 1G8WA 3ZXDA 1I6XA 4GH4A 2KA3A 4AQ2A 1PO12 1BK1A 3V56A 4LBOA 2AH2A 1PGL2 3A0KA 3ZXAC 4FAHA 5IT6A 4OI4A 3C3VA 4CDWA 1RTVA 2MNGA 4XJ9A 2ET7A 3AZYA 3E5UA 4OHYA 2W08A 3URFA 5C8CA 2X8KA 1RINA 1VBB3 4IEVA 1IS3A 3FX3A 2WC2A 2CAVA 2PQQA 2DCTA 4IEOA 2PN5A 2WNVC 3VBHC 2D6NA 4CDXB 2ZAHA 3MIBA 4CEWA 4BH9A 4IV1C 1MZ5A 4NOTA 4AFDA 1NA1A 1EPWA 5CG8A 2D6MA 1S0BA 4WBBA 2D5FA 3RPQA 1SFNA 3WV6A 1HRI2 3MIFA 4DXZA 2UURA 5A3MA 1JTZX 1A6CA 4B4RA 2RMU3 2WFPA 4LEJA 1H8TA 3TWIA 1ULGA 1JOJA 3MLKA 2Z79A 3KGLA 1RUG3 3JD71 3VBSC 2CV6A 3MPPG 1UAIA 1CQ9A 4F7ZA 1C8M2 2XLFA 4WM7A 5L7OC 2G9FA 4XE9A 1M06G 4FPJA 3WQ7A 2QDRA 1Z7S3 2C9AA 3FUOA 3ZXEA 2RMU1 4IEQA 3ACLA 2ZTNA 2MEV3 3B69A 1AJOA 3BU7A 4AEDB 3B9CA 3M70A 3FFZA 1LESA 4QM9A 1FMD2 4XXAA 2IWGB 2W68A 4AFBA 5J96B 4I01A 4XIKA 1O7FA 3JCIA 1I1EA 4YW1A 1ZRRA 1CX4A 3IDCB 2LTNA 1HQWA 3AP6A 2WT0A 4N43C 3VBFC 2DUOA 3VL9A 3BALA 2UWCA 4LTAA 4U2AA 4Y4YA 1COV2 1OPMA 4AVBA 1AYM1 4KWLA 4DQAA 1VRH3 1UIJA 5FLHA 4LO7A 2H6BA 3AKTA 1AR61 4NWVA 3Q9OA 1HXS3 2D6LX 1QH6A 1YO8A 5HCBA 4R4ZA 2XG3A 5GJ6A 2MEV2 1ZVFA 5H9QA 4EWDA 2V5YA 4YM0A 2O0OA 4XHXA 4P9LA 2PHTA 1ZRFA 1D0HA 3KQRA 1WMEA 4H55A 3WY6A 4EV0A 1VBA3 5BNOC 1QOOA 4HETA 1K5MB 2TNFA 2ZKLA 3VBOA 4G3YC 3B3QE 1GFF2 1QJU3 1RUNA 2E7QA 1AR83 3DL3A 1QJY2 3J26N 4AI1A 1XE8A 2PTMA 3VLBB 1IQAA 4BWOA 1MQTA 4Q26A 4HN0A 1BYHA 3NJZA 2XJQA 4ASMB 3SMHA 5DDJ2 3W9AA 3OBRA 1MACA 1MR5A 1RHI1 2P34A 4E4DX 5DG2A 4RS5A 3LGRA 2W0XA 4QGMA 1BBT1 1GV9A 4CEYB 4XEZA 4E27A 2AR6A 3NAPC 4QQLA 5J36A 1D0GA 5C6CA 3HQXA 4COYA 5A33A 5JSRA 3DPRA 1RUF2 4QQPA 4RR3B 2FMDA 2HWB1 1WLCA 3RI9A 5CFCC 4V1PA 5L7OA 4GMP3 2RMU2 4HZFA 1PNGA 3VZOA 2WJSA 1R1ZA 3H3UA 1RUG2 2EIGA 4QPIB 5AC91 4HFSA 1Q3EA 3WINE 5F6KA 4I30A 1Q8OA 2GSYA 1ND3B 1FT9A 1UKGA 4IEZA 4R52A 3ZYPA 4AEDA 5BNNC 3ZXGA 4AFMA 4XBQA 4Z1VA 1CJDA 4CDQB 3LA2A 1OHFA 1VBB2 3B7MA 2H0VA 4HSJA 4XBNA 2P3JA 3A0NA 1RIRA 2Q5TA 1JXNA 4DY3A 1VB4A 2DFCA 4RS5C 2D43A 2FQPA 2QFEA 1HRI1 5CU1A 4MXWA 4LT5A 5D8AC 4N9HA 2WINB 1AYN1 4XJWA 2OVUA 5I8SA 4XFBA 5EXOA 4MGIE 1JBCA 2EVXA 3WUCA 1S0IA 1YHFA 4AEKA 1CPMA 4H3WA 3RYRA 1AYN3 2PAMA 4N7IA 4N90A 1AR91 2RS52 4FP3A 4LE4A 2CGOA 2ZX3A 2DUPA 3LAGA 1DG6A 2HKXA 1AHSA 2DTYA 2IFRA 1XYOA 2O8OA 2E6VA 2XH6A 2VVFA 4SBVA 1V00A 3NL1A 4L11A 4YGCA 3GZTB 1VBE2 2AZ5A 1POV0 2A70A 1NA1B 5CG9A 1LOAA 3TNQA 3I7DA 4N7UA 4WM8A 1SQ4A 3H0OA 3MPBA 1O91A 1UCXA 3E5QA 4RA0A 3VZKA 2B42B 1V6LA 2ZGMA 3E6BA 5FOJB 5CA6A 2B9UA 2VUAA 4BZ4A 3X29B 3O0VA 3JBG3 2ET1A 2D98A 1GZWA 4Q0SA 4GKXA 3ST7A 2RS53 1OLRA 1BBT3 5BV6A 1PK6C 5DG1A 2Z42A 5JIAA 4ZU7A 1XQNA 2JG9B 4RFT0 1JH5A 3QCWA 4AVAA 4N53A 1LGCA 4NVPA 3GBGA 4AHYA 4HK9A 1D4VB 1HX6A 2VH9A 3HT1A 4QPIC 1UX6A 4R9DA 5AFBA 1C57A 1S2BA 4QPIA 2R0FA 3AZVA 4XW3A 2VNRA 2WSVA 1WLTA 4O9EA 3V65A 1N3QA 1ND3A 1ULCA 4AGGA 1QOSA 1V6JA 1PGW1 2DCZA 3RJ2X 5JZGA 1IS6A 2KM2A 1RUJ1 3GF6A 4YFWA 4KG0A 4UW6A 1H2NA 1W6NB 1O4ZA 2YV8A 3ZIXA 4Y22A 1HIXA 1SMVA 5CADA 3CJIB 4S2FA 3MF9A 2YGMA 1VLNA 2GN3A 1AYM3 1PVXA 4I3PA 4K3UA 5F6LB 2XUMA 4PDWB 3ZYIB 3HT2A 2QUOA 1DZQA 2GNTA 4PCRA 1GICA 5I93A 1HV0A 2ZGLA 5DUWA 1IPKA 1QQP3 1WW6A 1CAVB 1CN1A 5EFUA 4ZU5A 4D94A 3VHOA 1B35A 4XXPA 4E2GA 4KGGA 1FMD1 4LLFA 4RSUA 1BVP1 1RUD2 1L3JA 4CDWC 1D4M2 4PJYA 3TYJA 4C0HA 2ZHNA 3EBRA 2IZWA 2WNUB 1IGOA 4R9CA 4KBBA 1WD3A 1BVVA 5JMCA 5T5OA 2UU8A 3WVJA 3UKNA 2CWSA 4QPGB 5JCTA 3N4MA 3AMQA 3OCPA 3KT1A 1RUC2 4E2SA 2Y38A 3CJIC 5IK4A 5BNPC 2NM1A 1EV13 4CDQA 2R49A 4GWNA 1CAUB 2D7FA 2DVAA 1R1A3 1XXNA 1NY71 5JLVA 3VDDA 1PHMA 1LOFA 3N36A 4EJRA 2X53S 1WCSA 2AENA 2NP0A 5DZFA 4AE2A 5I0RA 4JDNA 1HRV1 4COWA 5DDJ1 2PELA 3KCYA 4LBKA 3SCFA 4QGNA 1C28A 2DVFA 4EN0A 5KXDA 3FLTA 2DV9A 5GKAC 4FXGB 3VL8A 3WDYA 4X8PA 5L73A 3ENRA 5FFOC 2B8MA 1NLRA 3I4IA 5I0UA 1QJZA 4JRAA 3H1MA 4JGZA 4CRQA 3RYPA 4IXLA 5CFDA 1RMU3 4AEMA 2EXIA 1RVF2 5LEJA 1HLCA 1MS5A 3CO2A 1LOFC 3ZSMA 4Q4Y1 2OIIA 1ZBA1 1LR5A 1H1IA 1WBFA 4Q4X3 1DGWA 1W6PA 3I54A 4X6RB 4LR4A 4U36A 4Q0VA 5IK8A 2P17A 2YROA 2FHRA 3MLJA 1RHI2 1UF2C 4HK8A 4IV1B 4K6BA 1PZ8A 2JG9C 3UJQA 1V6KA 2CWMA 1WW4A 4ONUA 4R9AA 1CD3G 5J37A 5FPXA 2R073 3WW3A 3FBMA 4AHWA 1H8TC 2N7GA 4GKYA 1IHMA 5GM0A 1PM7A 1WBLA 1WMDA 2PHXA 4CZSA 4XQWA 3D0JA 3U0ZA 4PF5A 4FSJA 1DQ4A 1DZTA 1TNFA 3V0AB 1GNZA 4FPEA 4M3CE 4BIOA 1QDCA 5KBFA 3R4UA 3H1WA 4S2DA 3VZNA 3RDIA 1YUDA 4BM8A 1DGRA 1V6MA 1VBD1 5J09A 3E6DA 1CJPA 2JG9A 2GNBA 1H0BA 2Q30A 4OI2A 3SCHA 3NV1A 1POV3 5JOZA 3FLRA 2VECA 4Q0UA 1SLTA 3AZWA 4AHXA 3FJSA 5AFEA 1W39A 4K21A 4FTSA 4FPCA 3VGIA 3RQ0A 4HVOA 5EYXA 1W2UA 1HV1A 3FHIB 1EV12 1VBE1 5BNNB 1Q8VA 3FLPA 4P9JA 1HDKA 5EWSA 1ZBE1 4HPKA 1ZZ9A 4OVEA 4XFIA 1XU2A 2ZGTA 5CB7A 4B8EA 4LO5B 2OUJA 2PHWA 1CAVA 4FQ4A 1LOGA 1G9FA 2ZGPA 1NE6A 1S0EA 1OOPA 1RVF1 1KDMA 2LM3A 1RUI3 5D1IA 4J1WA 1R1A2 4W6XA 1D2QA 3NAPB 4CDUC 2R042 4FT8A 4KU7A 1DIWA 5JPNB 1AR73 3USUA 3H50A 4JVAA 2X5IB 1PK6A 1JYIA 4AI2A 2ZX2A 2VVDA 3I8TA