2ATKC

Structure of a mutant kcsa k+ channel
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
103
structure length
103
Chain Sequence
b'SALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVATATTVGYGDLYPVTLWGRCVAVVVMVAGITSFGLVTAALATWFVGREQERRGH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANTIBODY FAB FRAGMENT HEAVY CHAIN
publication title Molecular determinants of gating at the potassium-channel selectivity filter.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system/ion transport
total genus 41
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2005-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2atkC00
4DXWA 4RAIA 2NLJC 1OCZC 2EILC 4RUEA 2WLMA 4MW8A 4X88A 2K1EA 4GX0A 2X6CA 2ZD9A 4R7CA 3SPGA 2X6AA 4HYOA 3ABLC 5J9PC 4RUFA 3SYPA 2EIJC 2ITCC 2DWDC 3AG3C 4QNHB 4RO2A 3BEHA 5EBLC 3X2QC 4X8AA 4XDLA 1JVMA 1R3KC 3ASOC 3E8BA 3K06A 3T4DA 4LP8A 2A9HA 3WG7C 4G28B 4P9PA 1KKDA 3FB7C 3SPCA 2HJFC 2IH3C 3RBZA 2DYSC 4MTFA 1K4DC 3LNMB 3SYCA 4CBCA 1LNQA 4XDJA 2Q67A 4JTDB 2WLIA 4P2ZA 3AG1C 2WLHA 3K04A 4GX1A 4P9OA 4WFFA 3SPHA 4TWKA 4PA4A 2W0FC 2IH1C 3KG2A 2AHYA 4F4LA 5B1BC 4LCUC 2HVKC 2X6BA 5CBGA 2EINC 3T4ZA 1S5HC 1XL4A 3HPLC 3K03A 5E1AC 5EC1C 4G27B 4KFMA 3SPJA 3ZJZA 5CBHA 2BOBC 4PA6A 2Q68A 2Q6AA 2EIMC 4R8CA 4GX5A 2HVJC 3K08A 4ZBMA 3T1CA 1OCOC 3LDCA 1ORQC 3OUSA 2QKSA 1R3JC 1OCRC 4PA7A 1M57C 1V54C 3TCUA 3UKMA 3VOUA 3OR7C 4MSWC 3SPIA 4EKWA 2Q69A 2DYRC 4H37A 4R6ZA 5EK0A 4MVUA 2HFEC 4QE9A 2YEVA 5EBWC 3PJSK 3F7YC 5IY5C 3F5WC 3E83A 1J95A 3ASNC 4PDMA 3SJQC 5KUKA 4MS2A 4MVOA 2R9RB 4I9WA 4MW3A 5B1AC 2EIKC 2WLJA 3OGCC 4MVSA 4PDRA 3ABMC 3JYCA 2A0LA 5EC2C 3LDDA 3F7VC 3FB6C 4WFHA 3STLC 3SYQA 3ZRSA 4WFGA 2WLNA 3STZC 2HG5C 3AG4C 1G4YB 3RW0A 1R3LC 3OUFA 3RVZA 2ATKC 4X89A 1ZWIC 3EFFK 3GB7C 3LDEA 3IFXA 4MVRA 4QE7A 4MTOA 4BW5A 2ITDC 1V55C 4MVZA 3IGAC 5KUMA 3AG2C 2WLKA 3K0DA 4R50A 3R65A 4MVMA 3LUTB 2WLLB 4LBEC 4XDKA 1QLEC 4GX2A 4PA9A 3SYAA 1R3IC 2KB1A 2QTOA 2ZXWC 3ABKC 2DWEC 2Y69C 3OR6C 4JTCB 3RVYA 1K4CC 5BZBA 4OXSA 4MVQA 4P30A 5CBFA 2JK5C 2WLLA 3E8HA 1XL6A 4H33A 4MTGA 2OCCC 3K0GA 1OCCC 2WLIB 3E86A 3T2MA 5B3SC 3TETA 3E89A 3E8GA 2AHZA 4HZ3A 3FB8C 4PA3A 2A79B 4PDLA 3UM7A 1P7BA 4PDVA 4WFEA 3E8FA 4JTAB 5EBMC 4UUJC 4J9ZB 3FB5C 1BL8A 4J9YB 2BOCC 2P7TC 2H8PC 3SYOA 1M56C
chains in the Genus database with same CATH superfamily
4YY3O 2G38A 4LWSA 3T1YO 3HR0A 1BGYH 2UXXA 3B8NA 1KP2A 4RUEA 4DR3O 4ZIBA 3L70H 3EVKA 2WAMA 2UXBB 2LGWA 1SQPH 3Q4HB 4ICGA 1MABG 2VQFB 4CC6A 1FS0G 2PZSA 3FB7C 1NU1H 3UT5B 2PY5A 2QEXV 3AEIA 1Z5WA 1LNQA 2CH7B 2OIEA 5AG2A 2ZXWB 4XBFA 2Y69B 3SPHA 4PA4A 1JMKC 2HJDA 2DJVA 1XMOB 3T4ZA 5E1AC 3QO8A 2XAFA 5C93A 1XNQB 1NQTA 3K57A 1YTFB 3SJBC 1JCHA 2UXDB 4JI6B 4O4HA 4DR7B 2E5LB 2DE0X 4H37A 2EILB 4NTWA 2LW7A 1SQXH 4B7KA 3QF7A 4EB6B 1W0KG 5JQGB 3CCEV 5J2TA 3T1HB 3LDDA 4TUYA 2QJ1A 2OYQA 2BCCH 3AG4C 4BR6A 3K9AA 3QO5A 2ATKC 3EFFK 5DECA 4O2BB 2WLKA 2B1GA 2YIDA 3W7WA 2PYJA 1H2SB 4J7KA 3A8TA 4LF6B 3ZRXA 1AILA 2JJ2G 3G67A 5IJ9B 4IHJB 3K0GA 3E86A 5A9GA 2F43G 1Q86W 4DR4B 5CA0A 3A0HZ 2JS3A 1DGSA 4G2KA 3K5NA 2LFRA 3CC4V 4KHPO 4H44B 3FB5C 4X65O 4DV6O 1K73W 1XQ8A 2ZQMA 4RAIA 1XNRO 3H01A 2GTAA 4DV7B 2PF4E 2OT5A 5EBLC 1VQ7V 1GRJA 5JJJB 3CC7V 1VQNV 5BMVB 2Y48A 4QIWF 2HLDG 3MD0A 1V9PA 2WPDG 1ENVA 3KG2A 4JI5O 3BABA 1I94O 4YHHB 4O4HB 2ZIOA 2DQ0A 5LA6A 1TUEB 4GKKO 4R8CA 4B3RO 3CCSV 3UKMA 1F23A 2DYRC 1OCZB 4DW0A 5J2TB 5K1XA 4QE9A 4TUYB 5EBWC 1G6UA 2GHYA 4MS2A 2WWWA 1UPGA 1XHXA 3CCVV 1TAEA 3APOA 3AG7A 3KKYA 2XASA 3ABMC 5B3SB 4X9QA 3STLC 3ZHUA 2DYSB 4UCSA 4MVRA 4NR1A 2ZE8A 2YI8A 4MTOA 3JAWA 4R50A 3R65A 1SRYA 4CS4A 2YXLA 1K5SA 5CA0B 4FFKA 1PNKA 1TVKA 4MVQA 5IT9N 2XT9A 4LF8B 1FYJA 2JEXA 5B3SC 4WF9V 1OCOB 4FLZA 2QWPB 2E3CA 2ZDIA 1R73A 2P7TC 2H8PC 5CA3A 4AQYO 4OX9B 4GLXA 3VQWA 1SQBH 4B08A 1RPRA 2K1EA 3CP1A 5FPRA 4E2LA 1M5IA 3SYPA 3JARA 1FFXA 2D2CB 1H8HG 4FLVA 5BR8O 1NT2B 4X20B 5H2FZ 1ZLZA 3SPCA 3ZHTA 1L8DA 2IH3C 3RBZA 5C8YB 4HAMA 1ROPA 5LP6A 2P4VA 3N27A 1GMGA 1ZTEA 2HEPA 4FZ1A 5LA6B 2Q7GA 3PN1A 2LQTA 3ZMZA 5LL6Y 3CCRV 2X6BA 3LSSA 5IWAB 1D5NA 1IBKO 4U3JB 1Q7YW 4OPHA 3AK1A 5FL7G 4WCEV 2Q68A 5KX5A 1VF6A 3CRRA 3RGBA 4UFZA 5LHGA 1N36O 3SJCC 3TXSA 5KHJA 5EK0A 4JAVA 1VF7A 1YTFD 3ABLB 4CH3A 1OHHG 2ADPA 3JAWB 1MSDA 4MTXA 3D3QA 2B9ZA 2E74B 3FYIB 1WP8A 2E76B 5L3BA 4FLYA 3RVZA 4X89A 1OJHA 4LFCO 1GM8A 4IYHA 3H1LH 1WJZA 4NVPA 1YXBA 1IDSA 1ZUQA 4DRXA 1KECA 5GONB 4ZI7A 2JEUA 5KA5A 2JS5A 4FM2A 2Q4PA 1OV9A 3E8FA 5EBMC 4I0XA 5DN6G 3KZIZ 3JARB 1FFXB 3JD2A 1ZX3A 1Q6IA 4WBNA 2JRIA 4BWAA 4K3AA 2EIKB 4HNAA 2N04A 3M8AA 2ZDIC 2Z3YA 3ASOC 3T4DA 2CTWA 2DMXA 5LYJB 3JD4A 3RN4A 1VQLV 3VQVA 3CRQA 4L8JA 1AR5A 4FFBA 3SYCA 1WP7A 1WNSA 1QLEB 1LR1A 2YXYA 1IXMA 4I55A 1QHTA 5KX5B 2HHHB 3AK3A 5EZYB 3OEEG 5LP6C 3SPJA 1NVPD 1JFFA 2ZINA 3CCJV 1BSMA 2A7WA 4GX5A 4JV5O 1H38A 4UV8A 1VQ4V 3OR7C 4O4LA 5J2UA 1JJOA 1E1RG 4UB6Z 2B5UA 5IDJA 3ZHSA 4FVMA 5IY5C 2X7RB 2GDSA 1W2BU 5EYPA 1EBOA 3W7UA 3D3IA 1RM1C 3QG5A 3FB6C 3BCCH 2Q7HA 2WLNA 5LGUA 1S3JA 2CTRA 1L1FA 3FFQA 2WA3A 3QTCA 1DK1A 2Q7EA 1GN6A 1L0LH 1XMQO 2Z5UA 1NBMG 1VQ6V 3C3TA 1FAFA 3OAAG 2ZIMA 3CXHF 2LP7A 2Q0AA 4DV5O 3B09A 4I0XB 4NB5A 1WAZA 4TT3G 3G71V 4DV0B 4N23A 1OCRB 1N32B 3F7YC 4MW8A 2YC0A 3L72H 4GX0A 3OGIB 5B1AB 3EHBB 4D7TA 4FFBB 3P30A 1VQKV 2OCHA 3F5TA 5KMGA 2Q9LA 2PTMA 4LF7B 1QU7A 5IYCO 4I55B 1HWYA 4GT1A 3K3WA 1M57B 3CXCU 1NH2B 1SQVH 1BHAA 4DR2O 1JFFB 4YIPA 2ZE5A 4UB8Z 3TGUH 3A0BZ 5JCOA 4B3SB 1PM9A 4DV1B 1H8EG 1R6TA 3DTUB 4O4LB 4B3TB 5J2UB 2UUBO 1B3QA 1H2GA 4O4IA 3CX5F 1M57C 3CCMV 3Q4HA 3KCXA 1MA1A 2Q69A 3QVNA 1KKCA 1TA8A 4U3FH 2KQXA 4YJ2B 4PDMA 3G4SV 2QWOB 1PD3A 2UXNA 4LFAO 2RJZA 3ZRSA 1HDJA 4I5SA 4GUNA 3CMEV 4DV3B 1R3LC 1SA0B 5B1OA 3AG2C 5LBQA 1WLEA 4DV2B 1J5EB 3ZX6A 1XOUA 3ABKC 4H0LB 2DQ3A 3D8CA 1YIJV 5LOVA 1QVGU 3H1JH 1GAXA 1CEZA 4B3MB 4JZGA 3OFNG 1EZVH 4PDVA 3ETEA 4JTAB 4EB6A 3JAMN 2OIGA 3RYIB 4J41A 1HR0B 1BL8A 1N34O 4DUYO 5BY1A 1IBMO 3CJHA 5IYZB 1N4CA 4RQEA 3LSUA 5KMGB 2UUAO 1N32O 1CXZB 2ZM6O 2Q73A 4AHCA 3I55V 4RUFA 2DOSA 2FKXA 3BEHA 4X8AA 3ZHQA 4LH7A 3CCUV 4J7ZA 4MTFA 1K4DC 3L9DA 4IHJA 3WB2A 4GCZA 1BS3A 3FYEB 4TWKA 1Z2GA 2QR4A 4O4IB 4DR5O 2ZKOA 1CPYA 2HVKC 1U96A 2OCCB 1OCCB 3CD6V 4KFMA 5LMNO 4JI7O 2O57A 4PA6A 2F4VO 5A2QN 4UCRA 2QE7G 1SKVA 1GM7A 4Z1VA 2QKSA 4LF9B 1BZKA 3SPIA 4KUMA 3VQYA 1FXVA 5JCOC 1P7GA 1YVWA 3P3PA 5BMVA 3CRMA 2Q0OC 5KUKA 1NS1A 2EX3A 3SJQC 1TUBB 3CYOA 4TV9A 4JI2O 2FMLA 4ZOLB 4DR6B 1D2DA 3IFXA 4J7JA 1QQCA 4MVZA 3ICXA 3MHSC 5LOVB 1S72V 3LUTB 2QGNA 4DUZB 3OT7A 5JH7A 4DV4O 2GUZA 2ZXWC 2Y69C 2E75B 3K9SA 2BTQA 2IJKA 3CB2A 4F6RA 2DN9A 5KHHA 3OM3B 4P30A 3ZCCA 1XL6A 3CJHB 1QLNA 4YIOA 3FB8C 2RN9A 1AI4A 1K3EA 2QM4A 4X62B 4TOIA 2B1IA 4FIPC 4DXWA 3MHHC 2EILC 4AILC 4NTXA 1R1BA 2IJIA 2XAHA 3APQA 1GN4A 2ZCEA 1HW7A 1KC8W 2EIMB 2YSUB 4PV1B 4ABMA 1T5EA 2CDYA 4D7SA 2UXCO 2VWJA 4I9QA 1GN3A 4JYAO 4GX1A 1SESA 1NKDA 3OTFA 1VQ5V 4J42A 4FLUA 1M90W 5D5PA 3MAQA 1S5HC 2A06H 3WFVA 3SJAC 1NH2D 4LFBB 2EIMC 3AK2A 3ML0A 3A2FA 4DR1B 5CB4B 2UXBO 4PA7A 4J11A 2VQFO 3K5OA 2QM8A 4TV9B 4X20A 1YITV 1NVPB 1O9GA 2ZE6A 2EIJB 2QKCA 4JI8B 3BAAA 5C8YA 5JVDB 4MW3A 1N33B 5EC2C 1U97A 2LW1A 4X1YB 3ZRWA 1IBLB 4KXRA 5JH7B 2GUZB 1YF2A 1PL0A 1XMOO 1ZWIC 1WA8B 2BTQB 3JSLA 3X2QB 1HNWB 4U3JA 3CCLV 1XNQO 4F6RB 3UCSC 2QSAA 2UXDO 5E79Z 5LXTB 4JI6O 3U0ZA 4DR7O 4UXNA 1XILA 4DUZO 2E5LO 1WB7A 4FLXA 1P49A 4MTGA 2WLIB 3U11A 2IW5A 3ZMSA 2KSDA 1YI2V 2F1MA 1X59A 3X2QC 3T1HO 5HFLA 2V1DA 3FAVA 1SZXA 3ZMTA 4BIZA 3S3XA 1OCZC 1MZEA 3CC2V 3TK1A 2ITCC 1GH6A 2QM7A 1Z5VA 4LF6O 3UO3A 1E1QG 1V55B 2HJFC 2DYSC 5GONA 4CBCA 2UUCB 4DR4O 3W7XA 1RPOA 1AP5A 4UVBA 2ILMA 4P2ZA 2F93B 3FKSG 2QWNB 2R70A 2W0FC 1BHBA 3BFRA 4FM1A 4UCTA 4K0KB 1G1XB 4FZ0A 4FLWA 1LUWA 1SF9A 2BOBC 4RQFA 1PP9H 2MK3A 4X1IA 4UCUA 4DV7O 1OCOC 4ZKIA 1M56B 5FPOA 1K8AW 1XI1A 5LYJA 3ZRWB 1MNGA 3E83A 4L87A 4JI0B 3AG3B 1L0NH 3J81N 4I9WA 5GW7A 3OGCC 4PDRA 4WFHA 3WU2Z 2AZ2A 2HG5C 4YHHO 1Q82W 4QE7A 1N33O 3BA8A 3GVMA 2BE3A 5EZYA 3LSQA 2F66C 2W6IG 2CTQA 1R3IC 2KB1A 1AR4A 4DO2A 2LFSA 2YS8A 1XUQA 1KQSU 3ZMVA 4QPJA 5CBFA 1X4TA 4JI4B 3E8HA 1B04A 1NZ6A 3FAVB 1NR7A 4JAAA 2L6LA 3UM7A 3CEIA 2YDEA 5FLXN 1BCCH 2PGGA 4JI1B 1KU9A 4X1KB 1VQ9V 2P06A 1HNZB 3ABLC 1QR9A 4H13B 2DWDC 4RO2A 1FJGB 4XDLA 1MZFA 1B6QA 3OD4A 2ODMA 2EJRA 2P22C 4LF8O 3LNMB 2RDCA 3ZEDA 4DK0A 3OE7G 4GZRB 4FK5C 5IYDO 1FXKB 5L3FA 2D3OW 3CSXA 3HB3B 2JJ1G 4F4LA 4JYYA 4X1IB 4OX9O 1XL4A 3K03A 5ITZA 1PNMA 5CBHA 1AI5A 2VQEB 1MG1A 1A32A 5KHKA 1Q3EA 3JCZA 3K08A 3OUSA 2V7QG 3UQ8A 5EIBD 4X64B 4EKWA 2IU3A 4CS2A 1COWG 4JGSA 1ZAUA 4I7ZB 5IJ0B 5JJNB 1AI6A 3CE2A 2XAQA 2R9RB 2EIKC 2WLJA 4WFGA 3RW0A 1RSOA 4JI3B 5IWAO 1AB3A 5H9CA 3K5LA 3CCQV 2PYLA 4LBEC 1K92A 1QLEC 3OTOB 3C3SA 2X0LA 3ZHVA 4W4LA 4LNUA 2UU9B 3N2KB 1VF6C 4FMTA 5B5EZ 1WN7A 1QNMA 3T2MA 4C7UA 4GKJB 4YJ2A 3C90A 5B1NA 1HNXB 1KP3A 1V54B 1SC5B 3BPZA 3O9OA 2BOCC 1GKFA 3G6BA 3JALA 5DM6V 1YJNV 5CMUA 3SDLA 5H6QA 5TISZ 5B1BB 1SA0A 2X6AA 1I08A 5J9PC 1FXHA 2JDIG 4JI1O 4EFEA 4D6TH 3HKDA 4Z2WA 3BY6A 1R3KC 3K06A 2A9HA 3D36A 1IXBA 1NJIW 1ZL8A 2XHBA 4UCOA 2K9PA 4NXNB 1AJPA 3H1IH 2L35A 5ITZB 3G6EV 2M6YA 5B1BC 4LCUC 3RYIA 1MOFA 2KKWA 2QWRB 5IYZA 4FJCC 4CS3A 4X66B 1YCIA 3GWOA 1VEWA 2GTSA 2OWOA 1VQMV 4Q6GA 1KB9F 4CH4A 2FL4A 1OCRC 1YSCA 2F95B 4R6ZA 4UCVA 1VARA 2WSSG 3KCYA 1H2MA 2LJ2A 1RSOB 1VQOV 5B1AC 3B8MA 4PI0A 4NXMB 3JYCA 3F7VC 4YY3B 2CK3G 3T1YB 3RT3C 2HHHO 1G4YB 3W7TA 2C2AA 4LF5B 4LNUB 4DR3B 2ITDC 4TSFG 2P67A 3SYAA 1JPXA 3B40A 1GN2A 1K4CC 5BZBA 1D5AA 4LC1A 3JALB 1EN6A 3WG7B 2UU9O 4PDLA 2XAGA 1KUQA 3L74H 1TUBA 3LNNA 2YIBD 3CHXA 1YJ9V 3HKDB 4LF4B 4ZOLA 3E22B 1S5JA 3ASNB 4FPPA 1BMFG 3RYHB 2HR3A 3ABTA 1ZL8B 3ZHRA 3J80N 4K35A 4O4JB 4BW9A 1WPBA 1H2NA 2BSKA 1K5QA 1QBZA 1SS3A 5L3DA 3WG7C 1UFIA 2Q5ZA 2YEVB 1Y67A 2ADQB 1I7FA 3I5DA 3CRAA 4DV0O 4P9OA 1MMMA 3D36C 3ZRVA 2N05A 3S3WA 4J80A 2H94A 5EC1C 4QGPA 5JWPA 1P84F 1EFRG 3QNEA 2JGUA 4Z1MG 1K33A 3IC7A 5LMUB 3VBBA 1JJ2U 3TCUA 4U7NA 4LF7O 4I50A 3HKEB 4I4TA 2EZOA 3QO7A 3RYFA 3OW2U 1I5YA 2A3QA 3K59A 4JAUA 1BQ0A 4KHPB 4DV6B 4ZHQA 4DW1A 3STZC 1FD9A 4TQDA 4B3SO 1VIBA 3JASA 1N0JA 4DV1O 3O65A 3R66A 1IX9A 4B3TO 2ZR2A 4PD4F 2CAZC 3OEHG 4LF5O 3B77A 1NR1A 5CB4A 3OR6C 4JTCB 2FTKA 4E4EA 4RWUA 5LHHA 2CUGA 2OCCC 1OCCC 1K97A 2YI9A 1YHQV 4HZ3A 3N2GA 1M93A 2P4KA 2MW2B 2ZR3A 2YIAA 2P6JA 3ZN0A 4JI5B 5JVDA 3W7SA 1I94B 2PI4A 4CZZA 4J10A 2VS0A 1M9NA 2HP8A 4X1YA 4DV3O 1SQGA 2BSKB 1GO3F 1AJNA 2Y4TA 2X6CA 2ZD9A 3BVOA 4GKKB 1WA8A 4OGQB 4LF4O 2EINB 4B3RB 4DV2O 1J5EO 4QNHB 1RFYA 5LXTA 3AG4B 4G28B 4P9PA 2M7WA 1AVMA 4CC5A 4XDJA 4IGGA 4B3MO 2RMKB 2WLIA 2QDOA 2QA4V 1DF4A 3E2EA 3ETDA 1HR0O 1Q90D 1Q81W 2EINC 2VWKA 4G27B 3ZMUA 4NKGB 4MT8A 1F4NA 1N0NA 4I50B 1S5LZ 5L3EA 4I4TB 3LDCA 1SQFA 3RYFB 2IBZH 2XNDG 3ZIAG 2BTOA 4YJ3A 1S77D 5LMUO 4PJ0Z 3P3NA 3VQXA 2ARHA 4ZHQB 1J95A 1FKAO 5KHGA 3JASB 1BT8A 5CA1A 3B4SA 1EM1A 4LWSB 2A0LA 2XOKG 2QKAA 4AQYB 5H6RA 3B2EE 4JASA 1PPJH 3CWBH 3JD1A 5H5NA 4NTYA 4GX2A 3A0RA 5BR8B 4JF3A 2QTOA 1N8RW 1Q6HA 3N2GB 4YXWG 4EEQA 4LF9O 3BHPA 5GTHZ 1URFA 2JK5C 5D5QA 5EIBC 4IT5A 2R9IA 3TETA 3E89A 3E8GA 4PA3A 1S0VA 1QVFU 2R9AA 2DYRB 3SYOA 1IBKB 3AG1B 4DR6O 1PNLA 5JJEB 1EN5A 1KMIZ 2VRZA 2P5OA 1SETA 4GYCB 2EULA 2EIJC 4B7EA 3TXQA 3ABMB 4KP4A 1N36B 4JYCA 3ZN1A 3OMNB 4AI8A 1KBHA 4Q20A 2ZNJA 2YIBA 1XHZA 1TGOA 4CH5A 4BIOA 3AG1C 1IVSA 3L73H 1NI8A 3RYCA 2Z0AA 4X62O 4LH6A 3FX7A 4X1KA 4YJ3B 1YEWA 4ZBMA 4LFCB 2EBOA 5HFMA 4JYBA 3IJ4A 4IYIA 4MSWC 3TJTA 5CA1B 2DW4A 2HFEC 3NR7A 1PV0A 2N74A 1F51A 3SYQA 1VQ8V 1FXKA 1AP6A 1EN4A 5BXZA 1V55C 4MVMA 4FM0A 4LFBO 3ETGA 3M99B 5IYBO 4CH6A 3DC5A 4DR1O 1R6KA 5KAFZ 1Q8IA 1PKXA 3DC6A 3MDSA 3RVYA 4O2AA 3K5MA 2LO1A 4TV8A 4H33A 1F7YA 2OTJV 2CE4A 1K34A 5IE9A 5IJ0A 4JI8O 3L75H 1EZJA 4WFEA 1XBLA 1NTMH 1FPOA 1M56C 2AW9A 1B06A 1IBLO 5KLVH 3BRCA 3OMAB 4WFBV 3SPGA 4K8XA 4HYOA 1HNWO 1MSWD 4JV5B 3AG3C 2AGAA 1XEQA 4TQFA 2PUSA 3JATA 3JCUZ 1VP7A 1KKDA 3N2KA 2YUAA 4JZ2A 1Q43A 3JSNA 3RFRA 3RYCB 1Y4MA 2ETNA 4KL1A 2Q67A 3ETQA 3CPWU 1M1KW 3K04A 4IIJA 1Y76A 2Y0IA 1F4MA 1DTOA 2AHYA 2H3OA 1S76D 1H2KA 2NN4A 3SGIA 2QTSA 2IU0A 5LGNA 1XMQB 1AROP 1TVKB 5CN0A 1XDCA 2CGOA 3WB1A 1Y74A 4HBNA 3DGEA 4DV5B 1KD1W 1QR8A 1SERA 4K8ZA 4QJFB 4PELA 1SQQH 3THOA 1G8MA 1I0HA 3CRCA 2LGQA 3JAKA 2ZT9B 1R6NA 2UUCO 4MVOA 4DYLA 1IZ3A 3ASOB 2Q8VA 4F6EA 1UJWB 1AR1B 3G80A 2Y0PA 2KG7A 5KA6A 1BQZA 1YDXA 4K0KO 3ZBHA 2CTPA 3H1KH 4O2AB 4UVCA 4TV8B 3U10A 2RCVA 4FLTA 1FXKC 1JX9A 3HKCA 5LP6B 4DK1A 1OZ0A 2R72A 2P90A 4OPAA 4JI0O 4DR2B 3JD0A 5KHIA 4W4KA 5B66Z 2NR5A 1XREA 3J7AU 5L3GA 3NXSA 2NLJC 1GM9A 4UV9A 5IY5B 2WLMA 2AZ0A 1Q6UA 3H9VA 3JATB 4JPRA 2HKOA 4X88A 2UUBB 1JOYA 1SZTA 1Y66A 1CP9A 1RM1B 1JVMA 3E8BA 1LUVA 4LP8A 1GK9A 2IJHA 2IM9A 1K7DA 3DXRA 5GTIZ 4IIJB 1Y76B 4JI4O 2CGNA 1W59A 2F23A 4BAYA 1NTKH 3CS5A 4LFAB 1I5XA 1WPXA 2IH1C 2V4DA 1Y74B 3DSQA 3E22A 1VF5B 2ZE7A 2JIZG 1HNZO 5LHIA 3RYHA 1ORQC 4O4JA 2GBOA 2NNUA 3JAKB 1FJGO 1V54C 1JA8A 3E35A 3VOUA 4DRXB 4ZI7B 3SR2C 4MVUA 2YEVA 2XTAA 2KG7B 1Q5OA 3F5WC 1DLBA 2W6JG 1YJWV 2RNBA 3HKBA 2XAJA 1N34B 4DUYB 1IBMB 2OTLV 3WB0A 4WBNB 2FYUH 2EJ7A 1RP3B 3OUFA 2UUAB 4WFAV 3GB7C 2ZM6B 2AXTZ 3GWKC 4BW5A 3IGAC 4HNAB 3HKCB 2VQEO 4XDKA 4PA9A 1M4UA 4BIUA 1E79G 2DWEC 1NTZH 3BA9A 4X64O 2Y4UA 3L71H 1JQ0A 2WLLA 3RWRD 3IAYA 3UO2A 3HKEA 2AHZA 1WB8A 1THZA 5FNVA 1P7BA 2W0XA 2GSMB 1FFTB 3K58A 2WA4A 4J9YB 4DR5B 5K1PA 1Y6XA 4N21A 4JI3O 5F2VO 1H2LA 1IURA 5LMNB 4JI7B 2JGDA 3DXRB 4NYKA 4R7CA 4LR3A 2F4VB 3H1HH 3OTOO 2FB5A 4QPKA 1AI7A 1QCEA 3AG2B 2RQ6A 4U7OA 5EYPB 4PHZA 4JTDB 2QWQB 3K79A 3ABKB 4JI2B 2WLHA 4GKJO 1W0JG 1HNXO 4WFFA 2GV9A 3UT5A 1US6A 5CBGA 3IC9A 3HPLC 2CH7A 1O9HA 1ZSPA 4EFBA 3ZJZA 2JVDA 1PL4A 4A5UB 1JR9A 2Q6AA 4ASUG 1GTOA 2XUMA 2HVJC 4DV4B 3T1CA 2YICA 4PI2A 1R3JC 2PI5A 1AJQA 3HKBB 3ABUA 4IL6Z 3PJSK 5LGTA 3ASNC 1YZBA 5KAIZ 4NXNO 1P4RA 1BE3H 4MVSA 1VMGA 3I56V 3CMAV 2EZPA 3LDEA 5JQGA 5KUMA 4X66O 3K0DA 1K9MW 2IJJA 2WLLB 3JD3A 2ZNIA 5FNVB 1KYOF 4OXSA 4O2BA 4UVAA 1VQPV 3P32A 3OMIB 5DEDA 1DF5A 1HP8A 2UXCB 4X65B 2A79B 3EXAA 3M7MX 3FD9A 4JYAB 2YXHA 2JGDB 4J9ZB 4UUJC 4NXMO 5IJ9A 1XNRB 3ZS8C 5L3CA
chains in the Genus database with same CATH topology
3AG1B 1PNLA 1VQ9V 2UXXA 3B8NA 1KP2A 4RUEA 4GX0A 1SETA 3ABLC 1QR9A 2EIJC 5B1AB 3EHBB 2WAMA 2DWDC 3P30A 3ABMB 4KP4A 4RO2A 1VQKV 4JYCA 4XDLA 1MABG 3ZN1A 3OMNB 1B6QA 1FS0G 5IYCO 4Q20A 3FB7C 2EJRA 1HWYA 4GT1A 3K3WA 1M57B 3AEIA 3LNMB 2QEXV 3CXCU 3OE7G 1LNQA 4FK5C 1NH2B 5IYDO 2ZXWB 3AG1C 4XBFA 1BHAA 2Y69B 1FXKB 5L3FA 3SPHA 2D3OW 4PA4A 3HB3B 2JJ1G 4F4LA 3T4ZA 1XL4A 3K03A 5E1AC 1PNMA 1H8EG 3QO8A 2XAFA 3DTUB 5C93A 5CBHA 1AI5A 1MG1A 1NQTA 1H2GA 1YTFB 1JCHA 3K08A 3JCZA 4ZBMA 3OUSA 2V7QG 1M57C 2EBOA 5HFMA 3CCMV 4JYBA 4MSWC 4EKWA 2IU3A 1COWG 2Q69A 4H37A 2DW4A 2EILB 4JGSA 2HFEC 1AI6A 4PDMA 2XAQA 3G4SV 1F51A 2R9RB 1W0KG 2EIKC 2WLJA 3CCEV 1PD3A 2UXNA 3SYQA 3ZRSA 3LDDA 1VQ8V 4I5SA 1FXKA 4WFGA 3CMEV 3AG4C 3RW0A 1R3LC 3K9AA 3QO5A 2ATKC 3EFFK 5B1OA 5H9CA 1V55C 3AG2C 2WLKA 5LBQA 1WLEA 2B1GA 4MVMA 3CCQV 3ETGA 4LBEC 3W7WA 3M99B 1K92A 1QLEC 5IYBO 3ABKC 1R6KA 2X0LA 2DQ3A 1PKXA 3RVYA 1YIJV 3ZRXA 4FMTA 2JJ2G 1QVGU 4H33A 2OTJV 3K0GA 1K34A 3T2MA 3E86A 2F43G 1Q86W 1CEZA 3OFNG 4PDVA 4G2KA 1EZJA 4WFEA 1KP3A 3ETEA 2LFRA 1V54B 4JTAB 5B1NA 3CC4V 3FB5C 1BL8A 2BOCC 1GKFA 1M56C 1K73W 5DM6V 1YJNV 2ZQMA 4RQEA 5CMUA 5H6QA 4RAIA 3OMAB 4WFBV 3H01A 3SPGA 5B1BB 2X6AA 4HYOA 5J9PC 3I55V 4RUFA 1FXHA 2JDIG 1MSWD 3BY6A 3AG3C 2OT5A 3BEHA 5EBLC 1VQ7V 4X8AA 1R3KC 3K06A 3CC7V 2A9HA 3D36A 1VQNV 1NJIW 3CCUV 2Y48A 1KKDA 4QIWF 4MTFA 1K4DC 1Y4MA 2HLDG 2Q67A 3CPWU 1AJPA 3MD0A 3K04A 1M1KW 4GCZA 2WPDG 3FYEB 1F4MA 1ENVA 4TWKA 3KG2A 3G6EV 1DTOA 2AHYA 5B1BC 4LCUC 1CPYA 2HVKC 1S76D 1MOFA 2OCCB 1OCCB 4FJCC 3CD6V 4KFMA 2DQ0A 2IU0A 4PA6A 3GWOA 1TUEB 1VQMV 4R8CA 5LGNA 1AROP 2QE7G 5CN0A 1GM7A 2QKSA 3CCSV 1OCRC 3UKMA 1F23A 3SPIA 3DGEA 1YSCA 4KUMA 1FXVA 1KD1W 2DYRC 1QR8A 1OCZB 4R6ZA 1SERA 4QJFB 4PELA 4QE9A 1G8MA 5EBWC 2WSSG 2GHYA 5KUKA 3SJQC 1VQOV 1R6NA 4MS2A 4MVOA 2WWWA 3CYOA 3CCVV 5B1AC 3ASOB 3B8MA 2XASA 1UJWB 3ABMC 3JYCA 5B3SB 1AR1B 3F7VC 3STLC 2CK3G 1G4YB 5KA6A 3W7TA 2C2AA 2DYSB 4MVRA 3IFXA 4MTOA 2ITDC 4MVZA 3MHSC 4R50A 4TSFG 3R65A 1S72V 2P67A 4UVCA 3LUTB 1SRYA 3SYAA 1JPXA 1K5SA 2ZXWC 2Y69C 1FXKC 1JX9A 1PNKA 1K4CC 5BZBA 4MVQA 4LC1A 2IJKA 3ZCCA 3OM3B 4P30A 2JEXA 1OZ0A 1XL6A 5B3SC 4WF9V 3WG7B 1QLNA 4PDLA 2P90A 3FB8C 1OCOB 2XAGA 3JD0A 1AI4A 2ZDIA 1R73A 1K3EA 2P7TC 2H8PC 1YJ9V 5CA3A 2B1IA 4FIPC 4DXWA 3MHHC 3NXSA 5L3GA 2NLJC 1GM9A 2EILC 4UV9A 5IY5B 2WLMA 4MW8A 1RPRA 3ASNB 2K1EA 4JPRA 2HKOA 4FPPA 3CP1A 1BMFG 4X88A 2HR3A 3ABTA 4E2LA 1JOYA 2IJIA 2XAHA 1SZTA 3SYPA 1H8HG 1Y66A 1CP9A 1RM1B 1K5QA 1QBZA 1JVMA 3E8BA 4LP8A 1KC8W 1GK9A 2IJHA 5L3DA 2EIMB 3WG7C 2YSUB 1K7DA 2YEVB 3SPCA 2IH3C 3RBZA 4HAMA 1ROPA 1GMGA 4BAYA 4GX1A 4P9OA 1I5XA 1SESA 1NKDA 1WPXA 2IH1C 1VQ5V 3ZRVA 3ZMZA 3CCRV 1M90W 2X6BA 3LSSA 1S5HC 2H94A 5EC1C 1Q7YW 3WFVA 1NH2D 4WCEV 1EFRG 5FL7G 3QNEA 2Q68A 2JIZG 2EIMC 4Z1MG 3ML0A 1K33A 5LHIA 3IC7A 1ORQC 5LHGA 3VBBA 2NNUA 1JJ2U 4PA7A 1V54C 3E35A 3TCUA 3VOUA 4U7NA 2QM8A 5EK0A 1YITV 1NVPB 4MVUA 4JAVA 2YEVA 1YTFD 2EZOA 3ABLB 3F5WC 1DLBA 2EIJB 3QO7A 3OW2U 1I5YA 2W6JG 1YJWV 1OHHG 4JAUA 4MW3A 4MTXA 2XAJA 5EC2C 3ZRWA 2OTLV 3FYIB 3STZC 5L3BA 3OUFA 1PL0A 3RVZA 4WFAV 4X89A 1ZWIC 3GB7C 4BW5A 3X2QB 3IGAC 3CCLV 2ZR2A 4XDKA 4PA9A 3OEHG 4BIUA 1GM8A 3B77A 1E79G 2DWEC 1NR1A 3OR6C 4JTCB 2FTKA 4UXNA 1KECA 1JQ0A 5LHHA 2WLLA 4MTGA 2OCCC 1OCCC 2JEUA 2WLIB 5KA5A 1K97A 1YHQV 2AHZA 2IW5A 4HZ3A 3ZMSA 1THZA 2ZR3A 1P7BA 1YI2V 3E8FA 2GSMB 5EBMC 2P6JA 5DN6G 3ZN0A 1FFTB 3W7SA 4J9YB 3X2QC 4CZZA 2PI4A 5HFLA 1M9NA 2V1DA 3JD2A 4N21A 3ZMTA 4BIZA 1GO3F 1OCZC 1AJNA 2X6CA 2ZD9A 4R7CA 3CC2V 3TK1A 2EINB 2EIKB 2ITCC 2QM7A 4QNHB 2ZDIC 2Z3YA 3ASOC 3T4DA 3AG4B 3JD4A 4G28B 1VQLV 4P9PA 4QPKA 1E1QG 2M7WA 1V55B 1AI7A 2HJFC 1QCEA 3AG2B 2DYSC 4U7OA 3SYCA 4CBCA 1QLEB 4XDJA 3W7XA 1RPOA 4JTDB 4UVBA 2WLIA 4P2ZA 3K79A 2QA4V 3ABKB 3FKSG 1DF4A 2WLHA 1W0JG 4WFFA 1IXMA 3E2EA 2W0FC 3ETDA 1BHBA 1Q81W 5CBGA 2EINC 3HPLC 3OEEG 4G27B 3SPJA 3ZJZA 3ZMUA 4MT8A 2BOBC 3CCJV 1NVPD 1F4NA 2Q6AA 4ASUG 1GTOA 4RQFA 5L3EA 2MK3A 4GX5A 2HVJC 3T1CA 1OCOC 3LDCA 4ZKIA 1H38A 1R3JC 1M56B 2XNDG 2PI5A 4UV8A 1VQ4V 3ZIAG 3OR7C 1AJQA 1K8AW 1E1RG 1S77D 2B5UA 5IDJA 3ABUA 3ZRWB 3PJSK 5LGTA 5IY5C 3E83A 2X7RB 1J95A 3ASNC 1W2BU 4L87A 3AG3B 4I9WA 1EBOA 5GW7A 1P4RA 3W7UA 3D3IA 3OGCC 4MVSA 4PDRA 1RM1C 2A0LA 2XOKG 3FB6C 4WFHA 2WLNA 5H6RA 5LGUA 2HG5C 3I56V 1S3JA 3CMAV 1L1FA 4JASA 1Q82W 2EZPA 3LDEA 4QE7A 5KUMA 3JD1A 3K0DA 1K9MW 3LSQA 2W6IG 2IJJA 2WLLB 4GX2A 3A0RA 1R3IC 2KB1A 4JF3A 2QTOA 4DO2A 2Z5UA 2LFSA 1NBMG 1VQ6V 3JD3A 1N8RW 4YXWG 3OAAG 1KQSU 4OXSA 2LP7A 4UVAA 3SYOA 3ZMVA 1VQPV 3P32A 4QPJA 5CBFA 2JK5C 3OMIB 3E8HA 1DF5A 2R9IA 3TETA 1NR7A 3E89A 3E8GA 4PA3A 4TT3G 3G71V 2A79B 3UM7A 1S0VA 4N23A 1OCRB 4UUJC 4J9ZB 1QVFU 3F7YC 2DYRB 5L3CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DXW A;  4RAI A;  2NLJ C;  1OCZ C;  2EIL C;  4RUE A;  2WLM A;  4MW8 A;  4X88 A;  2K1E A;  4GX0 A;  2X6C A;  2ZD9 A;  4R7C A;  3SPG A;  2X6A A;  4HYO A;  3ABL C;  5J9P C;  4RUF A;  3SYP A;  2EIJ C;  2ITC C;  2DWD C;  3AG3 C;  4QNH B;  4RO2 A;  3BEH A;  5EBL C;  3X2Q C;  4X8A A;  4XDL A;  1JVM A;  1R3K C;  3ASO C;  3E8B A;  3K06 A;  3T4D A;  4LP8 A;  2A9H A;  3WG7 C;  4G28 B;  4P9P A;  1KKD A;  3FB7 C;  3SPC A;  2HJF C;  2IH3 C;  3RBZ A;  2DYS C;  4MTF A;  1K4D C;  3LNM B;  3SYC A;  4CBC A;  1LNQ A;  4XDJ A;  2Q67 A;  4JTD B;  2WLI A;  4P2Z A;  3AG1 C;  2WLH A;  3K04 A;  4GX1 A;  4P9O A;  4WFF A;  3SPH A;  4TWK A;  4PA4 A;  2W0F C;  2IH1 C;  3KG2 A;  2AHY A;  4F4L A;  5B1B C;  4LCU C;  2HVK C;  2X6B A;  5CBG A;  2EIN C;  3T4Z A;  1S5H C;  1XL4 A;  3HPL C;  3K03 A;  5E1A C;  5EC1 C;  4G27 B;  4KFM A;  3SPJ A;  3ZJZ A;  5CBH A;  2BOB C;  4PA6 A;  2Q68 A;  2Q6A A;  2EIM C;  4R8C A;  4GX5 A;  2HVJ C;  3K08 A;  4ZBM A;  3T1C A;  1OCO C;  3LDC A;  1ORQ C;  3OUS A;  2QKS A;  1R3J C;  1OCR C;  4PA7 A;  1M57 C;  1V54 C;  3TCU A;  3UKM A;  3VOU A;  3OR7 C;  4MSW C;  3SPI A;  4EKW A;  2Q69 A;  2DYR C;  4H37 A;  4R6Z A;  5EK0 A;  4MVU A;  2HFE C;  4QE9 A;  2YEV A;  5EBW C;  3PJS K;  3F7Y C;  5IY5 C;  3F5W C;  3E83 A;  1J95 A;  3ASN C;  4PDM A;  3SJQ C;  5KUK A;  4MS2 A;  4MVO A;  2R9R B;  4I9W A;  4MW3 A;  5B1A C;  2EIK C;  2WLJ A;  3OGC C;  4MVS A;  4PDR A;  3ABM C;  3JYC A;  2A0L A;  5EC2 C;  3LDD A;  3F7V C;  3FB6 C;  4WFH A;  3STL C;  3SYQ A;  3ZRS A;  4WFG A;  2WLN A;  3STZ C;  2HG5 C;  3AG4 C;  1G4Y B;  3RW0 A;  1R3L C;  3OUF A;  3RVZ A;  2ATK C;  4X89 A;  1ZWI C;  3EFF K;  3GB7 C;  3LDE A;  3IFX A;  4MVR A;  4QE7 A;  4MTO A;  4BW5 A;  2ITD C;  1V55 C;  4MVZ A;  3IGA C;  5KUM A;  3AG2 C;  2WLK A;  3K0D A;  4R50 A;  3R65 A;  4MVM A;  3LUT B;  2WLL B;  4LBE C;  4XDK A;  1QLE C;  4GX2 A;  4PA9 A;  3SYA A;  1R3I C;  2KB1 A;  2QTO A;  2ZXW C;  3ABK C;  2DWE C;  2Y69 C;  3OR6 C;  4JTC B;  3RVY A;  1K4C C;  5BZB A;  4OXS A;  4MVQ A;  4P30 A;  5CBF A;  2JK5 C;  2WLL A;  3E8H A;  1XL6 A;  4H33 A;  4MTG A;  2OCC C;  3K0G A;  1OCC C;  2WLI B;  3E86 A;  3T2M A;  5B3S C;  3TET A;  3E89 A;  3E8G A;  2AHZ A;  4HZ3 A;  3FB8 C;  4PA3 A;  2A79 B;  4PDL A;  3UM7 A;  1P7B A;  4PDV A;  4WFE A;  3E8F A;  4JTA B;  5EBM C;  4UUJ C;  4J9Z B;  3FB5 C;  1BL8 A;  4J9Y B;  2BOC C;  2P7T C;  2H8P C;  3SYO A;  1M56 C; 
#chains in the Genus database with same CATH topology
 4YY3 O;  2G38 A;  4LWS A;  3T1Y O;  3HR0 A;  1BGY H;  2UXX A;  3B8N A;  1KP2 A;  4RUE A;  4DR3 O;  4ZIB A;  3L70 H;  3EVK A;  2WAM A;  2UXB B;  2LGW A;  1SQP H;  3Q4H B;  4ICG A;  1MAB G;  2VQF B;  4CC6 A;  1FS0 G;  2PZS A;  3FB7 C;  1NU1 H;  3UT5 B;  2PY5 A;  2QEX V;  3AEI A;  1Z5W A;  1LNQ A;  2CH7 B;  2OIE A;  5AG2 A;  2ZXW B;  4XBF A;  2Y69 B;  3SPH A;  4PA4 A;  1JMK C;  2HJD A;  2DJV A;  1XMO B;  3T4Z A;  5E1A C;  3QO8 A;  2XAF A;  5C93 A;  1XNQ B;  1NQT A;  3K57 A;  1YTF B;  3SJB C;  1JCH A;  2UXD B;  4JI6 B;  4O4H A;  4DR7 B;  2E5L B;  2DE0 X;  4H37 A;  2EIL B;  4NTW A;  2LW7 A;  1SQX H;  4B7K A;  3QF7 A;  4EB6 B;  1W0K G;  5JQG B;  3CCE V;  5J2T A;  3T1H B;  3LDD A;  4TUY A;  2QJ1 A;  2OYQ A;  2BCC H;  3AG4 C;  4BR6 A;  3K9A A;  3QO5 A;  2ATK C;  3EFF K;  5DEC A;  4O2B B;  2WLK A;  2B1G A;  2YID A;  3W7W A;  2PYJ A;  1H2S B;  4J7K A;  3A8T A;  4LF6 B;  3ZRX A;  1AIL A;  2JJ2 G;  3G67 A;  5IJ9 B;  4IHJ B;  3K0G A;  3E86 A;  5A9G A;  2F43 G;  1Q86 W;  4DR4 B;  5CA0 A;  3A0H Z;  2JS3 A;  1DGS A;  4G2K A;  3K5N A;  2LFR A;  3CC4 V;  4KHP O;  4H44 B;  3FB5 C;  4X65 O;  4DV6 O;  1K73 W;  1XQ8 A;  2ZQM A;  4RAI A;  1XNR O;  3H01 A;  2GTA A;  4DV7 B;  2PF4 E;  2OT5 A;  5EBL C;  1VQ7 V;  1GRJ A;  5JJJ B;  3CC7 V;  1VQN V;  5BMV B;  2Y48 A;  4QIW F;  2HLD G;  3MD0 A;  1V9P A;  2WPD G;  1ENV A;  3KG2 A;  4JI5 O;  3BAB A;  1I94 O;  4YHH B;  4O4H B;  2ZIO A;  2DQ0 A;  5LA6 A;  1TUE B;  4GKK O;  4R8C A;  4B3R O;  3CCS V;  3UKM A;  1F23 A;  2DYR C;  1OCZ B;  4DW0 A;  5J2T B;  5K1X A;  4QE9 A;  4TUY B;  5EBW C;  1G6U A;  2GHY A;  4MS2 A;  2WWW A;  1UPG A;  1XHX A;  3CCV V;  1TAE A;  3APO A;  3AG7 A;  3KKY A;  2XAS A;  3ABM C;  5B3S B;  4X9Q A;  3STL C;  3ZHU A;  2DYS B;  4UCS A;  4MVR A;  4NR1 A;  2ZE8 A;  2YI8 A;  4MTO A;  3JAW A;  4R50 A;  3R65 A;  1SRY A;  4CS4 A;  2YXL A;  1K5S A;  5CA0 B;  4FFK A;  1PNK A;  1TVK A;  4MVQ A;  5IT9 N;  2XT9 A;  4LF8 B;  1FYJ A;  2JEX A;  5B3S C;  4WF9 V;  1OCO B;  4FLZ A;  2QWP B;  2E3C A;  2ZDI A;  1R73 A;  2P7T C;  2H8P C;  5CA3 A;  4AQY O;  4OX9 B;  4GLX A;  3VQW A;  1SQB H;  4B08 A;  1RPR A;  2K1E A;  3CP1 A;  5FPR A;  4E2L A;  1M5I A;  3SYP A;  3JAR A;  1FFX A;  2D2C B;  1H8H G;  4FLV A;  5BR8 O;  1NT2 B;  4X20 B;  5H2F Z;  1ZLZ A;  3SPC A;  3ZHT A;  1L8D A;  2IH3 C;  3RBZ A;  5C8Y B;  4HAM A;  1ROP A;  5LP6 A;  2P4V A;  3N27 A;  1GMG A;  1ZTE A;  2HEP A;  4FZ1 A;  5LA6 B;  2Q7G A;  3PN1 A;  2LQT A;  3ZMZ A;  5LL6 Y;  3CCR V;  2X6B A;  3LSS A;  5IWA B;  1D5N A;  1IBK O;  4U3J B;  1Q7Y W;  4OPH A;  3AK1 A;  5FL7 G;  4WCE V;  2Q68 A;  5KX5 A;  1VF6 A;  3CRR A;  3RGB A;  4UFZ A;  5LHG A;  1N36 O;  3SJC C;  3TXS A;  5KHJ A;  5EK0 A;  4JAV A;  1VF7 A;  1YTF D;  3ABL B;  4CH3 A;  1OHH G;  2ADP A;  3JAW B;  1MSD A;  4MTX A;  3D3Q A;  2B9Z A;  2E74 B;  3FYI B;  1WP8 A;  2E76 B;  5L3B A;  4FLY A;  3RVZ A;  4X89 A;  1OJH A;  4LFC O;  1GM8 A;  4IYH A;  3H1L H;  1WJZ A;  4NVP A;  1YXB A;  1IDS A;  1ZUQ A;  4DRX A;  1KEC A;  5GON B;  4ZI7 A;  2JEU A;  5KA5 A;  2JS5 A;  4FM2 A;  2Q4P A;  1OV9 A;  3E8F A;  5EBM C;  4I0X A;  5DN6 G;  3KZI Z;  3JAR B;  1FFX B;  3JD2 A;  1ZX3 A;  1Q6I A;  4WBN A;  2JRI A;  4BWA A;  4K3A A;  2EIK B;  4HNA A;  2N04 A;  3M8A A;  2ZDI C;  2Z3Y A;  3ASO C;  3T4D A;  2CTW A;  2DMX A;  5LYJ B;  3JD4 A;  3RN4 A;  1VQL V;  3VQV A;  3CRQ A;  4L8J A;  1AR5 A;  4FFB A;  3SYC A;  1WP7 A;  1WNS A;  1QLE B;  1LR1 A;  2YXY A;  1IXM A;  4I55 A;  1QHT A;  5KX5 B;  2HHH B;  3AK3 A;  5EZY B;  3OEE G;  5LP6 C;  3SPJ A;  1NVP D;  1JFF A;  2ZIN A;  3CCJ V;  1BSM A;  2A7W A;  4GX5 A;  4JV5 O;  1H38 A;  4UV8 A;  1VQ4 V;  3OR7 C;  4O4L A;  5J2U A;  1JJO A;  1E1R G;  4UB6 Z;  2B5U A;  5IDJ A;  3ZHS A;  4FVM A;  5IY5 C;  2X7R B;  2GDS A;  1W2B U;  5EYP A;  1EBO A;  3W7U A;  3D3I A;  1RM1 C;  3QG5 A;  3FB6 C;  3BCC H;  2Q7H A;  2WLN A;  5LGU A;  1S3J A;  2CTR A;  1L1F A;  3FFQ A;  2WA3 A;  3QTC A;  1DK1 A;  2Q7E A;  1GN6 A;  1L0L H;  1XMQ O;  2Z5U A;  1NBM G;  1VQ6 V;  3C3T A;  1FAF A;  3OAA G;  2ZIM A;  3CXH F;  2LP7 A;  2Q0A A;  4DV5 O;  3B09 A;  4I0X B;  4NB5 A;  1WAZ A;  4TT3 G;  3G71 V;  4DV0 B;  4N23 A;  1OCR B;  1N32 B;  3F7Y C;  4MW8 A;  2YC0 A;  3L72 H;  4GX0 A;  3OGI B;  5B1A B;  3EHB B;  4D7T A;  4FFB B;  3P30 A;  1VQK V;  2OCH A;  3F5T A;  5KMG A;  2Q9L A;  2PTM A;  4LF7 B;  1QU7 A;  5IYC O;  4I55 B;  1HWY A;  4GT1 A;  3K3W A;  1M57 B;  3CXC U;  1NH2 B;  1SQV H;  1BHA A;  4DR2 O;  1JFF B;  4YIP A;  2ZE5 A;  4UB8 Z;  3TGU H;  3A0B Z;  5JCO A;  4B3S B;  1PM9 A;  4DV1 B;  1H8E G;  1R6T A;  3DTU B;  4O4L B;  4B3T B;  5J2U B;  2UUB O;  1B3Q A;  1H2G A;  4O4I A;  3CX5 F;  1M57 C;  3CCM V;  3Q4H A;  3KCX A;  1MA1 A;  2Q69 A;  3QVN A;  1KKC A;  1TA8 A;  4U3F H;  2KQX A;  4YJ2 B;  4PDM A;  3G4S V;  2QWO B;  1PD3 A;  2UXN A;  4LFA O;  2RJZ A;  3ZRS A;  1HDJ A;  4I5S A;  4GUN A;  3CME V;  4DV3 B;  1R3L C;  1SA0 B;  5B1O A;  3AG2 C;  5LBQ A;  1WLE A;  4DV2 B;  1J5E B;  3ZX6 A;  1XOU A;  3ABK C;  4H0L B;  2DQ3 A;  3D8C A;  1YIJ V;  5LOV A;  1QVG U;  3H1J H;  1GAX A;  1CEZ A;  4B3M B;  4JZG A;  3OFN G;  1EZV H;  4PDV A;  3ETE A;  4JTA B;  4EB6 A;  3JAM N;  2OIG A;  3RYI B;  4J41 A;  1HR0 B;  1BL8 A;  1N34 O;  4DUY O;  5BY1 A;  1IBM O;  3CJH A;  5IYZ B;  1N4C A;  4RQE A;  3LSU A;  5KMG B;  2UUA O;  1N32 O;  1CXZ B;  2ZM6 O;  2Q73 A;  4AHC A;  3I55 V;  4RUF A;  2DOS A;  2FKX A;  3BEH A;  4X8A A;  3ZHQ A;  4LH7 A;  3CCU V;  4J7Z A;  4MTF A;  1K4D C;  3L9D A;  4IHJ A;  3WB2 A;  4GCZ A;  1BS3 A;  3FYE B;  4TWK A;  1Z2G A;  2QR4 A;  4O4I B;  4DR5 O;  2ZKO A;  1CPY A;  2HVK C;  1U96 A;  2OCC B;  1OCC B;  3CD6 V;  4KFM A;  5LMN O;  4JI7 O;  2O57 A;  4PA6 A;  2F4V O;  5A2Q N;  4UCR A;  2QE7 G;  1SKV A;  1GM7 A;  4Z1V A;  2QKS A;  4LF9 B;  1BZK A;  3SPI A;  4KUM A;  3VQY A;  1FXV A;  5JCO C;  1P7G A;  1YVW A;  3P3P A;  5BMV A;  3CRM A;  2Q0O C;  5KUK A;  1NS1 A;  2EX3 A;  3SJQ C;  1TUB B;  3CYO A;  4TV9 A;  4JI2 O;  2FML A;  4ZOL B;  4DR6 B;  1D2D A;  3IFX A;  4J7J A;  1QQC A;  4MVZ A;  3ICX A;  3MHS C;  5LOV B;  1S72 V;  3LUT B;  2QGN A;  4DUZ B;  3OT7 A;  5JH7 A;  4DV4 O;  2GUZ A;  2ZXW C;  2Y69 C;  2E75 B;  3K9S A;  2BTQ A;  2IJK A;  3CB2 A;  4F6R A;  2DN9 A;  5KHH A;  3OM3 B;  4P30 A;  3ZCC A;  1XL6 A;  3CJH B;  1QLN A;  4YIO A;  3FB8 C;  2RN9 A;  1AI4 A;  1K3E A;  2QM4 A;  4X62 B;  4TOI A;  2B1I A;  4FIP C;  4DXW A;  3MHH C;  2EIL C;  4AIL C;  4NTX A;  1R1B A;  2IJI A;  2XAH A;  3APQ A;  1GN4 A;  2ZCE A;  1HW7 A;  1KC8 W;  2EIM B;  2YSU B;  4PV1 B;  4ABM A;  1T5E A;  2CDY A;  4D7S A;  2UXC O;  2VWJ A;  4I9Q A;  1GN3 A;  4JYA O;  4GX1 A;  1SES A;  1NKD A;  3OTF A;  1VQ5 V;  4J42 A;  4FLU A;  1M90 W;  5D5P A;  3MAQ A;  1S5H C;  2A06 H;  3WFV A;  3SJA C;  1NH2 D;  4LFB B;  2EIM C;  3AK2 A;  3ML0 A;  3A2F A;  4DR1 B;  5CB4 B;  2UXB O;  4PA7 A;  4J11 A;  2VQF O;  3K5O A;  2QM8 A;  4TV9 B;  4X20 A;  1YIT V;  1NVP B;  1O9G A;  2ZE6 A;  2EIJ B;  2QKC A;  4JI8 B;  3BAA A;  5C8Y A;  5JVD B;  4MW3 A;  1N33 B;  5EC2 C;  1U97 A;  2LW1 A;  4X1Y B;  3ZRW A;  1IBL B;  4KXR A;  5JH7 B;  2GUZ B;  1YF2 A;  1PL0 A;  1XMO O;  1ZWI C;  1WA8 B;  2BTQ B;  3JSL A;  3X2Q B;  1HNW B;  4U3J A;  3CCL V;  1XNQ O;  4F6R B;  3UCS C;  2QSA A;  2UXD O;  5E79 Z;  5LXT B;  4JI6 O;  3U0Z A;  4DR7 O;  4UXN A;  1XIL A;  4DUZ O;  2E5L O;  1WB7 A;  4FLX A;  1P49 A;  4MTG A;  2WLI B;  3U11 A;  2IW5 A;  3ZMS A;  2KSD A;  1YI2 V;  2F1M A;  1X59 A;  3X2Q C;  3T1H O;  5HFL A;  2V1D A;  3FAV A;  1SZX A;  3ZMT A;  4BIZ A;  3S3X A;  1OCZ C;  1MZE A;  3CC2 V;  3TK1 A;  2ITC C;  1GH6 A;  2QM7 A;  1Z5V A;  4LF6 O;  3UO3 A;  1E1Q G;  1V55 B;  2HJF C;  2DYS C;  5GON A;  4CBC A;  2UUC B;  4DR4 O;  3W7X A;  1RPO A;  1AP5 A;  4UVB A;  2ILM A;  4P2Z A;  2F93 B;  3FKS G;  2QWN B;  2R70 A;  2W0F C;  1BHB A;  3BFR A;  4FM1 A;  4UCT A;  4K0K B;  1G1X B;  4FZ0 A;  4FLW A;  1LUW A;  1SF9 A;  2BOB C;  4RQF A;  1PP9 H;  2MK3 A;  4X1I A;  4UCU A;  4DV7 O;  1OCO C;  4ZKI A;  1M56 B;  5FPO A;  1K8A W;  1XI1 A;  5LYJ A;  3ZRW B;  1MNG A;  3E83 A;  4L87 A;  4JI0 B;  3AG3 B;  1L0N H;  3J81 N;  4I9W A;  5GW7 A;  3OGC C;  4PDR A;  4WFH A;  3WU2 Z;  2AZ2 A;  2HG5 C;  4YHH O;  1Q82 W;  4QE7 A;  1N33 O;  3BA8 A;  3GVM A;  2BE3 A;  5EZY A;  3LSQ A;  2F66 C;  2W6I G;  2CTQ A;  1R3I C;  2KB1 A;  1AR4 A;  4DO2 A;  2LFS A;  2YS8 A;  1XUQ A;  1KQS U;  3ZMV A;  4QPJ A;  5CBF A;  1X4T A;  4JI4 B;  3E8H A;  1B04 A;  1NZ6 A;  3FAV B;  1NR7 A;  4JAA A;  2L6L A;  3UM7 A;  3CEI A;  2YDE A;  5FLX N;  1BCC H;  2PGG A;  4JI1 B;  1KU9 A;  4X1K B;  1VQ9 V;  2P06 A;  1HNZ B;  3ABL C;  1QR9 A;  4H13 B;  2DWD C;  4RO2 A;  1FJG B;  4XDL A;  1MZF A;  1B6Q A;  3OD4 A;  2ODM A;  2EJR A;  2P22 C;  4LF8 O;  3LNM B;  2RDC A;  3ZED A;  4DK0 A;  3OE7 G;  4GZR B;  4FK5 C;  5IYD O;  1FXK B;  5L3F A;  2D3O W;  3CSX A;  3HB3 B;  2JJ1 G;  4F4L A;  4JYY A;  4X1I B;  4OX9 O;  1XL4 A;  3K03 A;  5ITZ A;  1PNM A;  5CBH A;  1AI5 A;  2VQE B;  1MG1 A;  1A32 A;  5KHK A;  1Q3E A;  3JCZ A;  3K08 A;  3OUS A;  2V7Q G;  3UQ8 A;  5EIB D;  4X64 B;  4EKW A;  2IU3 A;  4CS2 A;  1COW G;  4JGS A;  1ZAU A;  4I7Z B;  5IJ0 B;  5JJN B;  1AI6 A;  3CE2 A;  2XAQ A;  2R9R B;  2EIK C;  2WLJ A;  4WFG A;  3RW0 A;  1RSO A;  4JI3 B;  5IWA O;  1AB3 A;  5H9C A;  3K5L A;  3CCQ V;  2PYL A;  4LBE C;  1K92 A;  1QLE C;  3OTO B;  3C3S A;  2X0L A;  3ZHV A;  4W4L A;  4LNU A;  2UU9 B;  3N2K B;  1VF6 C;  4FMT A;  5B5E Z;  1WN7 A;  1QNM A;  3T2M A;  4C7U A;  4GKJ B;  4YJ2 A;  3C90 A;  5B1N A;  1HNX B;  1KP3 A;  1V54 B;  1SC5 B;  3BPZ A;  3O9O A;  2BOC C;  1GKF A;  3G6B A;  3JAL A;  5DM6 V;  1YJN V;  5CMU A;  3SDL A;  5H6Q A;  5TIS Z;  5B1B B;  1SA0 A;  2X6A A;  1I08 A;  5J9P C;  1FXH A;  2JDI G;  4JI1 O;  4EFE A;  4D6T H;  3HKD A;  4Z2W A;  3BY6 A;  1R3K C;  3K06 A;  2A9H A;  3D36 A;  1IXB A;  1NJI W;  1ZL8 A;  2XHB A;  4UCO A;  2K9P A;  4NXN B;  1AJP A;  3H1I H;  2L35 A;  5ITZ B;  3G6E V;  2M6Y A;  5B1B C;  4LCU C;  3RYI A;  1MOF A;  2KKW A;  2QWR B;  5IYZ A;  4FJC C;  4CS3 A;  4X66 B;  1YCI A;  3GWO A;  1VEW A;  2GTS A;  2OWO A;  1VQM V;  4Q6G A;  1KB9 F;  4CH4 A;  2FL4 A;  1OCR C;  1YSC A;  2F95 B;  4R6Z A;  4UCV A;  1VAR A;  2WSS G;  3KCY A;  1H2M A;  2LJ2 A;  1RSO B;  1VQO V;  5B1A C;  3B8M A;  4PI0 A;  4NXM B;  3JYC A;  3F7V C;  4YY3 B;  2CK3 G;  3T1Y B;  3RT3 C;  2HHH O;  1G4Y B;  3W7T A;  2C2A A;  4LF5 B;  4LNU B;  4DR3 B;  2ITD C;  4TSF G;  2P67 A;  3SYA A;  1JPX A;  3B40 A;  1GN2 A;  1K4C C;  5BZB A;  1D5A A;  4LC1 A;  3JAL B;  1EN6 A;  3WG7 B;  2UU9 O;  4PDL A;  2XAG A;  1KUQ A;  3L74 H;  1TUB A;  3LNN A;  2YIB D;  3CHX A;  1YJ9 V;  3HKD B;  4LF4 B;  4ZOL A;  3E22 B;  1S5J A;  3ASN B;  4FPP A;  1BMF G;  3RYH B;  2HR3 A;  3ABT A;  1ZL8 B;  3ZHR A;  3J80 N;  4K35 A;  4O4J B;  4BW9 A;  1WPB A;  1H2N A;  2BSK A;  1K5Q A;  1QBZ A;  1SS3 A;  5L3D A;  3WG7 C;  1UFI A;  2Q5Z A;  2YEV B;  1Y67 A;  2ADQ B;  1I7F A;  3I5D A;  3CRA A;  4DV0 O;  4P9O A;  1MMM A;  3D36 C;  3ZRV A;  2N05 A;  3S3W A;  4J80 A;  2H94 A;  5EC1 C;  4QGP A;  5JWP A;  1P84 F;  1EFR G;  3QNE A;  2JGU A;  4Z1M G;  1K33 A;  3IC7 A;  5LMU B;  3VBB A;  1JJ2 U;  3TCU A;  4U7N A;  4LF7 O;  4I50 A;  3HKE B;  4I4T A;  2EZO A;  3QO7 A;  3RYF A;  3OW2 U;  1I5Y A;  2A3Q A;  3K59 A;  4JAU A;  1BQ0 A;  4KHP B;  4DV6 B;  4ZHQ A;  4DW1 A;  3STZ C;  1FD9 A;  4TQD A;  4B3S O;  1VIB A;  3JAS A;  1N0J A;  4DV1 O;  3O65 A;  3R66 A;  1IX9 A;  4B3T O;  2ZR2 A;  4PD4 F;  2CAZ C;  3OEH G;  4LF5 O;  3B77 A;  1NR1 A;  5CB4 A;  3OR6 C;  4JTC B;  2FTK A;  4E4E A;  4RWU A;  5LHH A;  2CUG A;  2OCC C;  1OCC C;  1K97 A;  2YI9 A;  1YHQ V;  4HZ3 A;  3N2G A;  1M93 A;  2P4K A;  2MW2 B;  2ZR3 A;  2YIA A;  2P6J A;  3ZN0 A;  4JI5 B;  5JVD A;  3W7S A;  1I94 B;  2PI4 A;  4CZZ A;  4J10 A;  2VS0 A;  1M9N A;  2HP8 A;  4X1Y A;  4DV3 O;  1SQG A;  2BSK B;  1GO3 F;  1AJN A;  2Y4T A;  2X6C A;  2ZD9 A;  3BVO A;  4GKK B;  1WA8 A;  4OGQ B;  4LF4 O;  2EIN B;  4B3R B;  4DV2 O;  1J5E O;  4QNH B;  1RFY A;  5LXT A;  3AG4 B;  4G28 B;  4P9P A;  2M7W A;  1AVM A;  4CC5 A;  4XDJ A;  4IGG A;  4B3M O;  2RMK B;  2WLI A;  2QDO A;  2QA4 V;  1DF4 A;  3E2E A;  3ETD A;  1HR0 O;  1Q90 D;  1Q81 W;  2EIN C;  2VWK A;  4G27 B;  3ZMU A;  4NKG B;  4MT8 A;  1F4N A;  1N0N A;  4I50 B;  1S5L Z;  5L3E A;  4I4T B;  3LDC A;  1SQF A;  3RYF B;  2IBZ H;  2XND G;  3ZIA G;  2BTO A;  4YJ3 A;  1S77 D;  5LMU O;  4PJ0 Z;  3P3N A;  3VQX A;  2ARH A;  4ZHQ B;  1J95 A;  1FKA O;  5KHG A;  3JAS B;  1BT8 A;  5CA1 A;  3B4S A;  1EM1 A;  4LWS B;  2A0L A;  2XOK G;  2QKA A;  4AQY B;  5H6R A;  3B2E E;  4JAS A;  1PPJ H;  3CWB H;  3JD1 A;  5H5N A;  4NTY A;  4GX2 A;  3A0R A;  5BR8 B;  4JF3 A;  2QTO A;  1N8R W;  1Q6H A;  3N2G B;  4YXW G;  4EEQ A;  4LF9 O;  3BHP A;  5GTH Z;  1URF A;  2JK5 C;  5D5Q A;  5EIB C;  4IT5 A;  2R9I A;  3TET A;  3E89 A;  3E8G A;  4PA3 A;  1S0V A;  1QVF U;  2R9A A;  2DYR B;  3SYO A;  1IBK B;  3AG1 B;  4DR6 O;  1PNL A;  5JJE B;  1EN5 A;  1KMI Z;  2VRZ A;  2P5O A;  1SET A;  4GYC B;  2EUL A;  2EIJ C;  4B7E A;  3TXQ A;  3ABM B;  4KP4 A;  1N36 B;  4JYC A;  3ZN1 A;  3OMN B;  4AI8 A;  1KBH A;  4Q20 A;  2ZNJ A;  2YIB A;  1XHZ A;  1TGO A;  4CH5 A;  4BIO A;  3AG1 C;  1IVS A;  3L73 H;  1NI8 A;  3RYC A;  2Z0A A;  4X62 O;  4LH6 A;  3FX7 A;  4X1K A;  4YJ3 B;  1YEW A;  4ZBM A;  4LFC B;  2EBO A;  5HFM A;  4JYB A;  3IJ4 A;  4IYI A;  4MSW C;  3TJT A;  5CA1 B;  2DW4 A;  2HFE C;  3NR7 A;  1PV0 A;  2N74 A;  1F51 A;  3SYQ A;  1VQ8 V;  1FXK A;  1AP6 A;  1EN4 A;  5BXZ A;  1V55 C;  4MVM A;  4FM0 A;  4LFB O;  3ETG A;  3M99 B;  5IYB O;  4CH6 A;  3DC5 A;  4DR1 O;  1R6K A;  5KAF Z;  1Q8I A;  1PKX A;  3DC6 A;  3MDS A;  3RVY A;  4O2A A;  3K5M A;  2LO1 A;  4TV8 A;  4H33 A;  1F7Y A;  2OTJ V;  2CE4 A;  1K34 A;  5IE9 A;  5IJ0 A;  4JI8 O;  3L75 H;  1EZJ A;  4WFE A;  1XBL A;  1NTM H;  1FPO A;  1M56 C;  2AW9 A;  1B06 A;  1IBL O;  5KLV H;  3BRC A;  3OMA B;  4WFB V;  3SPG A;  4K8X A;  4HYO A;  1HNW O;  1MSW D;  4JV5 B;  3AG3 C;  2AGA A;  1XEQ A;  4TQF A;  2PUS A;  3JAT A;  3JCU Z;  1VP7 A;  1KKD A;  3N2K A;  2YUA A;  4JZ2 A;  1Q43 A;  3JSN A;  3RFR A;  3RYC B;  1Y4M A;  2ETN A;  4KL1 A;  2Q67 A;  3ETQ A;  3CPW U;  1M1K W;  3K04 A;  4IIJ A;  1Y76 A;  2Y0I A;  1F4M A;  1DTO A;  2AHY A;  2H3O A;  1S76 D;  1H2K A;  2NN4 A;  3SGI A;  2QTS A;  2IU0 A;  5LGN A;  1XMQ B;  1ARO P;  1TVK B;  5CN0 A;  1XDC A;  2CGO A;  3WB1 A;  1Y74 A;  4HBN A;  3DGE A;  4DV5 B;  1KD1 W;  1QR8 A;  1SER A;  4K8Z A;  4QJF B;  4PEL A;  1SQQ H;  3THO A;  1G8M A;  1I0H A;  3CRC A;  2LGQ A;  3JAK A;  2ZT9 B;  1R6N A;  2UUC O;  4MVO A;  4DYL A;  1IZ3 A;  3ASO B;  2Q8V A;  4F6E A;  1UJW B;  1AR1 B;  3G80 A;  2Y0P A;  2KG7 A;  5KA6 A;  1BQZ A;  1YDX A;  4K0K O;  3ZBH A;  2CTP A;  3H1K H;  4O2A B;  4UVC A;  4TV8 B;  3U10 A;  2RCV A;  4FLT A;  1FXK C;  1JX9 A;  3HKC A;  5LP6 B;  4DK1 A;  1OZ0 A;  2R72 A;  2P90 A;  4OPA A;  4JI0 O;  4DR2 B;  3JD0 A;  5KHI A;  4W4K A;  5B66 Z;  2NR5 A;  1XRE A;  3J7A U;  5L3G A;  3NXS A;  2NLJ C;  1GM9 A;  4UV9 A;  5IY5 B;  2WLM A;  2AZ0 A;  1Q6U A;  3H9V A;  3JAT B;  4JPR A;  2HKO A;  4X88 A;  2UUB B;  1JOY A;  1SZT A;  1Y66 A;  1CP9 A;  1RM1 B;  1JVM A;  3E8B A;  1LUV A;  4LP8 A;  1GK9 A;  2IJH A;  2IM9 A;  1K7D A;  3DXR A;  5GTI Z;  4IIJ B;  1Y76 B;  4JI4 O;  2CGN A;  1W59 A;  2F23 A;  4BAY A;  1NTK H;  3CS5 A;  4LFA B;  1I5X A;  1WPX A;  2IH1 C;  2V4D A;  1Y74 B;  3DSQ A;  3E22 A;  1VF5 B;  2ZE7 A;  2JIZ G;  1HNZ O;  5LHI A;  3RYH A;  1ORQ C;  4O4J A;  2GBO A;  2NNU A;  3JAK B;  1FJG O;  1V54 C;  1JA8 A;  3E35 A;  3VOU A;  4DRX B;  4ZI7 B;  3SR2 C;  4MVU A;  2YEV A;  2XTA A;  2KG7 B;  1Q5O A;  3F5W C;  1DLB A;  2W6J G;  1YJW V;  2RNB A;  3HKB A;  2XAJ A;  1N34 B;  4DUY B;  1IBM B;  2OTL V;  3WB0 A;  4WBN B;  2FYU H;  2EJ7 A;  1RP3 B;  3OUF A;  2UUA B;  4WFA V;  3GB7 C;  2ZM6 B;  2AXT Z;  3GWK C;  4BW5 A;  3IGA C;  4HNA B;  3HKC B;  2VQE O;  4XDK A;  4PA9 A;  1M4U A;  4BIU A;  1E79 G;  2DWE C;  1NTZ H;  3BA9 A;  4X64 O;  2Y4U A;  3L71 H;  1JQ0 A;  2WLL A;  3RWR D;  3IAY A;  3UO2 A;  3HKE A;  2AHZ A;  1WB8 A;  1THZ A;  5FNV A;  1P7B A;  2W0X A;  2GSM B;  1FFT B;  3K58 A;  2WA4 A;  4J9Y B;  4DR5 B;  5K1P A;  1Y6X A;  4N21 A;  4JI3 O;  5F2V O;  1H2L A;  1IUR A;  5LMN B;  4JI7 B;  2JGD A;  3DXR B;  4NYK A;  4R7C A;  4LR3 A;  2F4V B;  3H1H H;  3OTO O;  2FB5 A;  4QPK A;  1AI7 A;  1QCE A;  3AG2 B;  2RQ6 A;  4U7O A;  5EYP B;  4PHZ A;  4JTD B;  2QWQ B;  3K79 A;  3ABK B;  4JI2 B;  2WLH A;  4GKJ O;  1W0J G;  1HNX O;  4WFF A;  2GV9 A;  3UT5 A;  1US6 A;  5CBG A;  3IC9 A;  3HPL C;  2CH7 A;  1O9H A;  1ZSP A;  4EFB A;  3ZJZ A;  2JVD A;  1PL4 A;  4A5U B;  1JR9 A;  2Q6A A;  4ASU G;  1GTO A;  2XUM A;  2HVJ C;  4DV4 B;  3T1C A;  2YIC A;  4PI2 A;  1R3J C;  2PI5 A;  1AJQ A;  3HKB B;  3ABU A;  4IL6 Z;  3PJS K;  5LGT A;  3ASN C;  1YZB A;  5KAI Z;  4NXN O;  1P4R A;  1BE3 H;  4MVS A;  1VMG A;  3I56 V;  3CMA V;  2EZP A;  3LDE A;  5JQG A;  5KUM A;  4X66 O;  3K0D A;  1K9M W;  2IJJ A;  2WLL B;  3JD3 A;  2ZNI A;  5FNV B;  1KYO F;  4OXS A;  4O2B A;  4UVA A;  1VQP V;  3P32 A;  3OMI B;  5DED A;  1DF5 A;  1HP8 A;  2UXC B;  4X65 B;  2A79 B;  3EXA A;  3M7M X;  3FD9 A;  4JYA B;  2YXH A;  2JGD B;  4J9Z B;  4UUJ C;  4NXM O;  5IJ9 A;  1XNR B;  3ZS8 C;  5L3C A; 
#chains in the Genus database with same CATH homology
 3AG1 B;  1PNL A;  1VQ9 V;  2UXX A;  3B8N A;  1KP2 A;  4RUE A;  4GX0 A;  1SET A;  3ABL C;  1QR9 A;  2EIJ C;  5B1A B;  3EHB B;  2WAM A;  2DWD C;  3P30 A;  3ABM B;  4KP4 A;  4RO2 A;  1VQK V;  4JYC A;  4XDL A;  1MAB G;  3ZN1 A;  3OMN B;  1B6Q A;  1FS0 G;  5IYC O;  4Q20 A;  3FB7 C;  2EJR A;  1HWY A;  4GT1 A;  3K3W A;  1M57 B;  3AEI A;  3LNM B;  2QEX V;  3CXC U;  3OE7 G;  1LNQ A;  4FK5 C;  1NH2 B;  5IYD O;  2ZXW B;  3AG1 C;  4XBF A;  1BHA A;  2Y69 B;  1FXK B;  5L3F A;  3SPH A;  2D3O W;  4PA4 A;  3HB3 B;  2JJ1 G;  4F4L A;  3T4Z A;  1XL4 A;  3K03 A;  5E1A C;  1PNM A;  1H8E G;  3QO8 A;  2XAF A;  3DTU B;  5C93 A;  5CBH A;  1AI5 A;  1MG1 A;  1NQT A;  1H2G A;  1YTF B;  1JCH A;  3K08 A;  3JCZ A;  4ZBM A;  3OUS A;  2V7Q G;  1M57 C;  2EBO A;  5HFM A;  3CCM V;  4JYB A;  4MSW C;  4EKW A;  2IU3 A;  1COW G;  2Q69 A;  4H37 A;  2DW4 A;  2EIL B;  4JGS A;  2HFE C;  1AI6 A;  4PDM A;  2XAQ A;  3G4S V;  1F51 A;  2R9R B;  1W0K G;  2EIK C;  2WLJ A;  3CCE V;  1PD3 A;  2UXN A;  3SYQ A;  3ZRS A;  3LDD A;  1VQ8 V;  4I5S A;  1FXK A;  4WFG A;  3CME V;  3AG4 C;  3RW0 A;  1R3L C;  3K9A A;  3QO5 A;  2ATK C;  3EFF K;  5B1O A;  5H9C A;  1V55 C;  3AG2 C;  2WLK A;  5LBQ A;  1WLE A;  2B1G A;  4MVM A;  3CCQ V;  3ETG A;  4LBE C;  3W7W A;  3M99 B;  1K92 A;  1QLE C;  5IYB O;  3ABK C;  1R6K A;  2X0L A;  2DQ3 A;  1PKX A;  3RVY A;  1YIJ V;  3ZRX A;  4FMT A;  2JJ2 G;  1QVG U;  4H33 A;  2OTJ V;  3K0G A;  1K34 A;  3T2M A;  3E86 A;  2F43 G;  1Q86 W;  1CEZ A;  3OFN G;  4PDV A;  4G2K A;  1EZJ A;  4WFE A;  1KP3 A;  3ETE A;  2LFR A;  1V54 B;  4JTA B;  5B1N A;  3CC4 V;  3FB5 C;  1BL8 A;  2BOC C;  1GKF A;  1M56 C;  1K73 W;  5DM6 V;  1YJN V;  2ZQM A;  4RQE A;  5CMU A;  5H6Q A;  4RAI A;  3OMA B;  4WFB V;  3H01 A;  3SPG A;  5B1B B;  2X6A A;  4HYO A;  5J9P C;  3I55 V;  4RUF A;  1FXH A;  2JDI G;  1MSW D;  3BY6 A;  3AG3 C;  2OT5 A;  3BEH A;  5EBL C;  1VQ7 V;  4X8A A;  1R3K C;  3K06 A;  3CC7 V;  2A9H A;  3D36 A;  1VQN V;  1NJI W;  3CCU V;  2Y48 A;  1KKD A;  4QIW F;  4MTF A;  1K4D C;  1Y4M A;  2HLD G;  2Q67 A;  3CPW U;  1AJP A;  3MD0 A;  3K04 A;  1M1K W;  4GCZ A;  2WPD G;  3FYE B;  1F4M A;  1ENV A;  4TWK A;  3KG2 A;  3G6E V;  1DTO A;  2AHY A;  5B1B C;  4LCU C;  1CPY A;  2HVK C;  1S76 D;  1MOF A;  2OCC B;  1OCC B;  4FJC C;  3CD6 V;  4KFM A;  2DQ0 A;  2IU0 A;  4PA6 A;  3GWO A;  1TUE B;  1VQM V;  4R8C A;  5LGN A;  1ARO P;  2QE7 G;  5CN0 A;  1GM7 A;  2QKS A;  3CCS V;  1OCR C;  3UKM A;  1F23 A;  3SPI A;  3DGE A;  1YSC A;  4KUM A;  1FXV A;  1KD1 W;  2DYR C;  1QR8 A;  1OCZ B;  4R6Z A;  1SER A;  4QJF B;  4PEL A;  4QE9 A;  1G8M A;  5EBW C;  2WSS G;  2GHY A;  5KUK A;  3SJQ C;  1VQO V;  1R6N A;  4MS2 A;  4MVO A;  2WWW A;  3CYO A;  3CCV V;  5B1A C;  3ASO B;  3B8M A;  2XAS A;  1UJW B;  3ABM C;  3JYC A;  5B3S B;  1AR1 B;  3F7V C;  3STL C;  2CK3 G;  1G4Y B;  5KA6 A;  3W7T A;  2C2A A;  2DYS B;  4MVR A;  3IFX A;  4MTO A;  2ITD C;  4MVZ A;  3MHS C;  4R50 A;  4TSF G;  3R65 A;  1S72 V;  2P67 A;  4UVC A;  3LUT B;  1SRY A;  3SYA A;  1JPX A;  1K5S A;  2ZXW C;  2Y69 C;  1FXK C;  1JX9 A;  1PNK A;  1K4C C;  5BZB A;  4MVQ A;  4LC1 A;  2IJK A;  3ZCC A;  3OM3 B;  4P30 A;  2JEX A;  1OZ0 A;  1XL6 A;  5B3S C;  4WF9 V;  3WG7 B;  1QLN A;  4PDL A;  2P90 A;  3FB8 C;  1OCO B;  2XAG A;  3JD0 A;  1AI4 A;  2ZDI A;  1R73 A;  1K3E A;  2P7T C;  2H8P C;  1YJ9 V;  5CA3 A;  2B1I A;  4FIP C;  4DXW A;  3MHH C;  3NXS A;  5L3G A;  2NLJ C;  1GM9 A;  2EIL C;  4UV9 A;  5IY5 B;  2WLM A;  4MW8 A;  1RPR A;  3ASN B;  2K1E A;  4JPR A;  2HKO A;  4FPP A;  3CP1 A;  1BMF G;  4X88 A;  2HR3 A;  3ABT A;  4E2L A;  1JOY A;  2IJI A;  2XAH A;  1SZT A;  3SYP A;  1H8H G;  1Y66 A;  1CP9 A;  1RM1 B;  1K5Q A;  1QBZ A;  1JVM A;  3E8B A;  4LP8 A;  1KC8 W;  1GK9 A;  2IJH A;  5L3D A;  2EIM B;  3WG7 C;  2YSU B;  1K7D A;  2YEV B;  3SPC A;  2IH3 C;  3RBZ A;  4HAM A;  1ROP A;  1GMG A;  4BAY A;  4GX1 A;  4P9O A;  1I5X A;  1SES A;  1NKD A;  1WPX A;  2IH1 C;  1VQ5 V;  3ZRV A;  3ZMZ A;  3CCR V;  1M90 W;  2X6B A;  3LSS A;  1S5H C;  2H94 A;  5EC1 C;  1Q7Y W;  3WFV A;  1NH2 D;  4WCE V;  1EFR G;  5FL7 G;  3QNE A;  2Q68 A;  2JIZ G;  2EIM C;  4Z1M G;  3ML0 A;  1K33 A;  5LHI A;  3IC7 A;  1ORQ C;  5LHG A;  3VBB A;  2NNU A;  1JJ2 U;  4PA7 A;  1V54 C;  3E35 A;  3TCU A;  3VOU A;  4U7N A;  2QM8 A;  5EK0 A;  1YIT V;  1NVP B;  4MVU A;  4JAV A;  2YEV A;  1YTF D;  2EZO A;  3ABL B;  3F5W C;  1DLB A;  2EIJ B;  3QO7 A;  3OW2 U;  1I5Y A;  2W6J G;  1YJW V;  1OHH G;  4JAU A;  4MW3 A;  4MTX A;  2XAJ A;  5EC2 C;  3ZRW A;  2OTL V;  3FYI B;  3STZ C;  5L3B A;  3OUF A;  1PL0 A;  3RVZ A;  4WFA V;  4X89 A;  1ZWI C;  3GB7 C;  4BW5 A;  3X2Q B;  3IGA C;  3CCL V;  2ZR2 A;  4XDK A;  4PA9 A;  3OEH G;  4BIU A;  1GM8 A;  3B77 A;  1E79 G;  2DWE C;  1NR1 A;  3OR6 C;  4JTC B;  2FTK A;  4UXN A;  1KEC A;  1JQ0 A;  5LHH A;  2WLL A;  4MTG A;  2OCC C;  1OCC C;  2JEU A;  2WLI B;  5KA5 A;  1K97 A;  1YHQ V;  2AHZ A;  2IW5 A;  4HZ3 A;  3ZMS A;  1THZ A;  2ZR3 A;  1P7B A;  1YI2 V;  3E8F A;  2GSM B;  5EBM C;  2P6J A;  5DN6 G;  3ZN0 A;  1FFT B;  3W7S A;  4J9Y B;  3X2Q C;  4CZZ A;  2PI4 A;  5HFL A;  1M9N A;  2V1D A;  3JD2 A;  4N21 A;  3ZMT A;  4BIZ A;  1GO3 F;  1OCZ C;  1AJN A;  2X6C A;  2ZD9 A;  4R7C A;  3CC2 V;  3TK1 A;  2EIN B;  2EIK B;  2ITC C;  2QM7 A;  4QNH B;  2ZDI C;  2Z3Y A;  3ASO C;  3T4D A;  3AG4 B;  3JD4 A;  4G28 B;  1VQL V;  4P9P A;  4QPK A;  1E1Q G;  2M7W A;  1V55 B;  1AI7 A;  2HJF C;  1QCE A;  3AG2 B;  2DYS C;  4U7O A;  3SYC A;  4CBC A;  1QLE B;  4XDJ A;  3W7X A;  1RPO A;  4JTD B;  4UVB A;  2WLI A;  4P2Z A;  3K79 A;  2QA4 V;  3ABK B;  3FKS G;  1DF4 A;  2WLH A;  1W0J G;  4WFF A;  1IXM A;  3E2E A;  2W0F C;  3ETD A;  1BHB A;  1Q81 W;  5CBG A;  2EIN C;  3HPL C;  3OEE G;  4G27 B;  3SPJ A;  3ZJZ A;  3ZMU A;  4MT8 A;  2BOB C;  3CCJ V;  1NVP D;  1F4N A;  2Q6A A;  4ASU G;  1GTO A;  4RQF A;  5L3E A;  2MK3 A;  4GX5 A;  2HVJ C;  3T1C A;  1OCO C;  3LDC A;  4ZKI A;  1H38 A;  1R3J C;  1M56 B;  2XND G;  2PI5 A;  4UV8 A;  1VQ4 V;  3ZIA G;  3OR7 C;  1AJQ A;  1K8A W;  1E1R G;  1S77 D;  2B5U A;  5IDJ A;  3ABU A;  3ZRW B;  3PJS K;  5LGT A;  5IY5 C;  3E83 A;  2X7R B;  1J95 A;  3ASN C;  1W2B U;  4L87 A;  3AG3 B;  4I9W A;  1EBO A;  5GW7 A;  1P4R A;  3W7U A;  3D3I A;  3OGC C;  4MVS A;  4PDR A;  1RM1 C;  2A0L A;  2XOK G;  3FB6 C;  4WFH A;  2WLN A;  5H6R A;  5LGU A;  2HG5 C;  3I56 V;  1S3J A;  3CMA V;  1L1F A;  4JAS A;  1Q82 W;  2EZP A;  3LDE A;  4QE7 A;  5KUM A;  3JD1 A;  3K0D A;  1K9M W;  3LSQ A;  2W6I G;  2IJJ A;  2WLL B;  4GX2 A;  3A0R A;  1R3I C;  2KB1 A;  4JF3 A;  2QTO A;  4DO2 A;  2Z5U A;  2LFS A;  1NBM G;  1VQ6 V;  3JD3 A;  1N8R W;  4YXW G;  3OAA G;  1KQS U;  4OXS A;  2LP7 A;  4UVA A;  3SYO A;  3ZMV A;  1VQP V;  3P32 A;  4QPJ A;  5CBF A;  2JK5 C;  3OMI B;  3E8H A;  1DF5 A;  2R9I A;  3TET A;  1NR7 A;  3E89 A;  3E8G A;  4PA3 A;  4TT3 G;  3G71 V;  2A79 B;  3UM7 A;  1S0V A;  4N23 A;  1OCR B;  4UUJ C;  4J9Z B;  1QVF U;  3F7Y C;  2DYR B;  5L3C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...