2AUSB

Crystal structure of the archaeal box h/aca srnp nop10-cbf5 complex
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
53
structure length
53
Chain Sequence
RIRKCPKCGRYTLKETCPVCGEKTKVAHPPRFSPEDPYGEYRRRLKRELLGIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords pseudouridine synthase
publication title Crystal structure determination and site-directed mutagenesis of the Pyrococcus abyssi aCBF5-aNOP10 complex reveal crucial roles of the C-terminal domains of both proteins in H/ACA sRNP activity
pubmed doi rcsb
source organism Pyrococcus abyssi
molecule tags Isomerase/structural protein
total genus 7
structure length 53
sequence length 53
chains with identical sequence D
ec nomenclature
pdb deposition date 2005-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF04135 Nop10p Nucleolar RNA-binding protein, Nop10p family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.40 Mainly Beta Single Sheet Rubrerythrin, domain 2 H/ACA ribonucleoprotein complex, subunit Nop10 2ausB00
3LWVB 3LWOB 2AQCA 3LWPB 2EY4E 3HJYB 3HAXC 2APOB 2RFKB 3LWQB 2HVYC 3MQKB 3HJWB 2AUSB 3LWRB
chains in the Genus database with same CATH superfamily
2JI1A 2YU9L 3CQZL 3HKZP 3HJYB 1ODHA 3HOYL 1NXGA 2LCQA 5MF6A 2C6BA 4POFA 4LHNA 1SMMA 2AQCA 1TWAL 1PFYA 3ZG6A 4GS7D 1I6HL 3JR7A 4AR4A 3KYYA 3RZTA 4AR5A 3IU3I 1E8JA 3KYVA 1QYBA 4YWLA 1ZRPA 5MFPA 1VZIA 3HOXL 3GTQL 4YWMA 2ERSA 3GTML 2XJUA 1R0GA 1BFYA 2E2IL 4BY1L 1T9QA 2BE5D 5GAEc 4AR6A 2JI2A 4K9FA 5IP9L 1I3QL 2XJTA 1S24A 5MFZA 4ZN1B 5EINC 4A3GL 3S17L 1VZHA 4JAGA 4A3IL 4LHLA 1RYTA 4XXBB 3PKJA 3FKIL 4XGHA 3K35A 1YK5A 1T9OA 2E2JL 3S2HL 1IRNA 3GTOL 3S14L 1YK4A 4RXNA 4BXXL 2R92L 2DSXA 2XJSA 1SFOL 3WWLA 2HVYC 2PVEA 3PWFA 1R0JA 2Z3QB 4AHZA 3J7Y1 2AYJA 3HOZL 4A3CL 3GTLL 2A68D 1Z92B 3S1RL 4BBRL 3KYUA 2NVXL 1LKPA 3PL5A 2VUML 2J9UB 3SS2A 2XJVA 1DVBA 2NVTL 2XJRA 5AI3A 2ERJA 2V3BB 1R0FA 2GMGA 5IP7L 2E2HL 4WFN1 1NXEA 3S1NL 3LWVB 2A69D 1S30A 3QQCE 1WJVA 3PIO1 1C09A 1F4LA 2A6HD 3MQKB 4B8CD 3S16L 1YV1A 3LWPB 3GTPL 3H99A 3B0AB 5GAHc 1PFWA 3H9CA 3NFPI 5C3EL 3PIP1 4JADA 4AI2A 2MS3A 4AR3A 5M5XL 3J7Z1 5AI2A 1R0IA 2RFKB 4A93L 1IW7D 3HJWB 3KYWA 4AI3A 2ZIXA 4C3JL 1OWCA 3P2AA 4A3BL 5K2ME 5IYCL 3HOWL 2M4VA 3RZ6A 1T9PA 3PO2L 3S1ML 3PO3L 4C3IL 1Y1VL 3S1QL 4AHWA 5FJ8L 5DM61 1K83L 3B08B 1TWFL 2JA6L 1RDGA 1I50L 2XJQA 4BY7L 2V0FA 1FHHA 1BQ8A 4A3ML 5EIOC 5M5YL 5MGNA 3RYGA 3FDJA 1YUXA 4A3JL 4C2M1 1PFVA 1FHMA 1LTLA 4Y52L 4AI0A 2NVQL 3LWRB 2O5JD 5DM71 2L0ZA 2APOB 2QL0A 1LKOA 1BE7A 3GTGL 2NYDA 2JI3A 1SMUA 3H97A 2HR5A 1IU5A 2M6PA 5H1Sc 4ME3A 5JVG1 4G6BA 5IYBL 1TWGL 5M3ML 2XJPA 5M5WL 3RZDL 2RDVA 1S2ZA 5C4XL 1R9TL 1LKMA 4A3FL 1BRFA 1B71A 4ZN3B 5GAGc 3MPSA 3LWOB 3K7AL 3KYXA 2B63L 3LPEB 5C4JL 1RYQA 1VZGA 1OWBA 1JYBA 1IU6A 4TVMA 1B13A 2EY4E 1RDVA 3QVDA 3A44A 2AUSB 5C44L 5GADc 1B2JA 3M4OL 5JVH1 3M3YL 4X6AL 2M6OA 4QIWP 5AN9H 4U671 2H12A 3GTKL 5IY0A 3GTJL 1QCVA 2KKDA 4A3LL 2KN9A 3I4ML 1NNQA 1RWDA 2WB1P 1QQTA 3RZOL 3VPBE 2WAQP 4A3DL 2CKAA 2Y0SP 2B5ID 4C3HL 2JA7L 4POGA 1YUZA 2R7ZL 3PZAA 4AYBP 2C6AA 3HOVL 1H7VA 1PZXA 4Y7NL 2JA5L 8RXNA 2PMZP 2V0EA 2VL6A 1TWCL 1BQ9A 4JAFA 1Y1WL 5FLML 1B2OA 2M4YA 2PVXA 2R93L 2Z3RB 5MLC3 3LNLA 2NVYL 2PPTA 4UY81 2PYAA 4TPUA 1WCML 1CAAA 3LWQB 2PSMC 7RXNA 1SMWA 3HOUL 3H3VM 4JAEA 3HAXC 3P8BA 4AI1A 4A3EL 4BBSL 1R0HA 1TWHL 1RB9A 4AHXA 3H9BA 2K2DA 1CADA 3S2DL 3MSUA 4E6YA 4AHYA 3PKIA 1PFUA 2CKCA 5RXNA 4A3KL 3H0GL 1IROA 1VCXA 3S15L 5IYDL 4V196 3I4NL 1DX8A 1P7PA 2JA8L 3WWNB 6RXNA 2A6ED 5M3FL 2CR8A
chains in the Genus database with same CATH topology
3LWVB 3LWOB 2AQCA 3LWPB 2EY4E 3HJYB 3HAXC 2APOB 2RFKB 3LWQB 2HVYC 3MQKB 3HJWB 2AUSB 3LWRB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LWV B;  3LWO B;  2AQC A;  3LWP B;  2EY4 E;  3HJY B;  3HAX C;  2APO B;  2RFK B;  3LWQ B;  2HVY C;  3MQK B;  3HJW B;  2AUS B;  3LWR B; 
#chains in the Genus database with same CATH topology
 2JI1 A;  2YU9 L;  3CQZ L;  3HKZ P;  3HJY B;  1ODH A;  3HOY L;  1NXG A;  2LCQ A;  5MF6 A;  2C6B A;  4POF A;  4LHN A;  1SMM A;  2AQC A;  1TWA L;  1PFY A;  3ZG6 A;  4GS7 D;  1I6H L;  3JR7 A;  4AR4 A;  3KYY A;  3RZT A;  4AR5 A;  3IU3 I;  1E8J A;  3KYV A;  1QYB A;  4YWL A;  1ZRP A;  5MFP A;  1VZI A;  3HOX L;  3GTQ L;  4YWM A;  2ERS A;  3GTM L;  2XJU A;  1R0G A;  1BFY A;  2E2I L;  4BY1 L;  1T9Q A;  2BE5 D;  5GAE c;  4AR6 A;  2JI2 A;  4K9F A;  5IP9 L;  1I3Q L;  2XJT A;  1S24 A;  5MFZ A;  4ZN1 B;  5EIN C;  4A3G L;  3S17 L;  1VZH A;  4JAG A;  4A3I L;  4LHL A;  1RYT A;  4XXB B;  3PKJ A;  3FKI L;  4XGH A;  3K35 A;  1YK5 A;  1T9O A;  2E2J L;  3S2H L;  1IRN A;  3GTO L;  3S14 L;  1YK4 A;  4RXN A;  4BXX L;  2R92 L;  2DSX A;  2XJS A;  1SFO L;  3WWL A;  2HVY C;  2PVE A;  3PWF A;  1R0J A;  2Z3Q B;  4AHZ A;  3J7Y 1;  2AYJ A;  3HOZ L;  4A3C L;  3GTL L;  2A68 D;  1Z92 B;  3S1R L;  4BBR L;  3KYU A;  2NVX L;  1LKP A;  3PL5 A;  2VUM L;  2J9U B;  3SS2 A;  2XJV A;  1DVB A;  2NVT L;  2XJR A;  5AI3 A;  2ERJ A;  2V3B B;  1R0F A;  2GMG A;  5IP7 L;  2E2H L;  4WFN 1;  1NXE A;  3S1N L;  3LWV B;  2A69 D;  1S30 A;  3QQC E;  1WJV A;  3PIO 1;  1C09 A;  1F4L A;  2A6H D;  3MQK B;  4B8C D;  3S16 L;  1YV1 A;  3LWP B;  3GTP L;  3H99 A;  3B0A B;  5GAH c;  1PFW A;  3H9C A;  3NFP I;  5C3E L;  3PIP 1;  4JAD A;  4AI2 A;  2MS3 A;  4AR3 A;  5M5X L;  3J7Z 1;  5AI2 A;  1R0I A;  2RFK B;  4A93 L;  1IW7 D;  3HJW B;  3KYW A;  4AI3 A;  2ZIX A;  4C3J L;  1OWC A;  3P2A A;  4A3B L;  5K2M E;  5IYC L;  3HOW L;  2M4V A;  3RZ6 A;  1T9P A;  3PO2 L;  3S1M L;  3PO3 L;  4C3I L;  1Y1V L;  3S1Q L;  4AHW A;  5FJ8 L;  5DM6 1;  1K83 L;  3B08 B;  1TWF L;  2JA6 L;  1RDG A;  1I50 L;  2XJQ A;  4BY7 L;  2V0F A;  1FHH A;  1BQ8 A;  4A3M L;  5EIO C;  5M5Y L;  5MGN A;  3RYG A;  3FDJ A;  1YUX A;  4A3J L;  4C2M 1;  1PFV A;  1FHM A;  1LTL A;  4Y52 L;  4AI0 A;  2NVQ L;  3LWR B;  2O5J D;  5DM7 1;  2L0Z A;  2APO B;  2QL0 A;  1LKO A;  1BE7 A;  3GTG L;  2NYD A;  2JI3 A;  1SMU A;  3H97 A;  2HR5 A;  1IU5 A;  2M6P A;  5H1S c;  4ME3 A;  5JVG 1;  4G6B A;  5IYB L;  1TWG L;  5M3M L;  2XJP A;  5M5W L;  3RZD L;  2RDV A;  1S2Z A;  5C4X L;  1R9T L;  1LKM A;  4A3F L;  1BRF A;  1B71 A;  4ZN3 B;  5GAG c;  3MPS A;  3LWO B;  3K7A L;  3KYX A;  2B63 L;  3LPE B;  5C4J L;  1RYQ A;  1VZG A;  1OWB A;  1JYB A;  1IU6 A;  4TVM A;  1B13 A;  2EY4 E;  1RDV A;  3QVD A;  3A44 A;  2AUS B;  5C44 L;  5GAD c;  1B2J A;  3M4O L;  5JVH 1;  3M3Y L;  4X6A L;  2M6O A;  4QIW P;  5AN9 H;  4U67 1;  2H12 A;  3GTK L;  5IY0 A;  3GTJ L;  1QCV A;  2KKD A;  4A3L L;  2KN9 A;  3I4M L;  1NNQ A;  1RWD A;  2WB1 P;  1QQT A;  3RZO L;  3VPB E;  2WAQ P;  4A3D L;  2CKA A;  2Y0S P;  2B5I D;  4C3H L;  2JA7 L;  4POG A;  1YUZ A;  2R7Z L;  3PZA A;  4AYB P;  2C6A A;  3HOV L;  1H7V A;  1PZX A;  4Y7N L;  2JA5 L;  8RXN A;  2PMZ P;  2V0E A;  2VL6 A;  1TWC L;  1BQ9 A;  4JAF A;  1Y1W L;  5FLM L;  1B2O A;  2M4Y A;  2PVX A;  2R93 L;  2Z3R B;  5MLC 3;  3LNL A;  2NVY L;  2PPT A;  4UY8 1;  2PYA A;  4TPU A;  1WCM L;  1CAA A;  3LWQ B;  2PSM C;  7RXN A;  1SMW A;  3HOU L;  3H3V M;  4JAE A;  3HAX C;  3P8B A;  4AI1 A;  4A3E L;  4BBS L;  1R0H A;  1TWH L;  1RB9 A;  4AHX A;  3H9B A;  2K2D A;  1CAD A;  3S2D L;  3MSU A;  4E6Y A;  4AHY A;  3PKI A;  1PFU A;  2CKC A;  5RXN A;  4A3K L;  3H0G L;  1IRO A;  1VCX A;  3S15 L;  5IYD L;  4V19 6;  3I4N L;  1DX8 A;  1P7P A;  2JA8 L;  3WWN B;  6RXN A;  2A6E D;  5M3F L;  2CR8 A; 
#chains in the Genus database with same CATH homology
 3LWV B;  3LWO B;  2AQC A;  3LWP B;  2EY4 E;  3HJY B;  3HAX C;  2APO B;  2RFK B;  3LWQ B;  2HVY C;  3MQK B;  3HJW B;  2AUS B;  3LWR B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...