2AUWA

Crystal structure of putative dna binding protein ne0471 from nitrosomonas europaea atcc 19718
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
151
structure length
151
Chain Sequence
YFFPKLTAVEALAPYRLRTTWSTGEVLEVDVGDILRKIPDLAPILDPEAFARVHIAEWEGSVEWFDTEFGRDNVYAWAKEQAGEVSHEMFGDWMHRNNLSLTTAAEALGISRRMVSYYRTAHKIIPRTIWLACLGWEATRPETKTLPRTLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Hypothetical Protein NE0471 from Nitrosomonas europaea
rcsb
source organism Nitrosomonas europaea
molecule tags Unknown function
molecule keywords hypothetical protein NE0471
total genus 40
structure length 151
sequence length 151
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10387 DUF2442 Protein of unknown function (DUF2442)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 2auwA02
3.30.2020.10 Alpha Beta 2-Layer Sandwich NE0471 N-terminal domain-like NE0471-like N-terminal domain 2auwA01
1X57A 1VPWA 1ZPQA 2R63A 2GRMA 1LQCA 1R63A 2PUEA 4X4DA 1ZUGA 3UFDA 3F51A 4YBAA 1E3OC 4X4CA 1RZSA 4X4FA 2PUDA 4PU7A 2HSGA 4J1XA 1ZZ9A 3RZZA 1AU7A 3ZHMA 3JXCL 3D1NI 2AXZA 3EUSA 3VK0A 4MCXA 1B0NA 3H5TA 1WETA 2ICPA 2LYLA 1LLIA 1XWRA 1SQ8A 2WIUB 4GHJA 3HZIB 3QWGA 2H8RA 1UTXA 3O9XA 5K98B 1PERL 1DWKA 4X4GA 4OB4A 2CSFA 1JFTA 1DW9A 3MLFA 3LFPA 1WH6A 3PXPA 2KEIA 3U3WA 2PUCA 2XCJA 2BNMA 4FN3A 2LYSA 4I6TA 1WIZA 1ADRA 1PNRA 2AW6A 2GZUA 2OFYA 2PIJA 3CLCA 2LYJA 2AUWA 4IVZA 2PPXA 2LYPA 3LISA 4PU4C 3S8QA 2PE5A 1UXCA 1LMB3 2PUAA 3ZKCA 4I8TA 2LCVA 3QF3A 4YG1A 2A6CA 3BDNA 3OQOA 1O4XA 3FMYA 1WH8A 1OSLA 1QP7A 3F6WA 3G5GA 3IVPA 4X4HA 1ZZ8A 2BNNA 1YSEA 1RZRD 1POUA 2IVQA 1ZS4A 1CJGA 1BDIA 3QYXA 1PRUA 2IU7A 3BS3A 1QP0A 2O4AA 2R1JL 2MEZA 1ZAYA 3GBFA 1LCDA 1OCTC 1PRAA 4O8BA 1RIOA 3KJXA 1HF0A 1EFAA 4PU8A 3GN5A 1Y9QA 2BNOA 1JH9A 2XSDC 3SCFA 1RPEL 2CROA 2BJCA 4I6RA 1QPZA 1ZZCA 2D5VA 4X4BA 4Z5HA 3SCHA 3TRBA 3ZHIA 3JXDL 2IVBA 2EBYA 1L1MA 4Y42A 2HINA 4J1WA 1S7EA 4IWRA 1QP4A 1IC8A 1CQTA 2KPJA 1NERA 1ZZ6A 4FBIA 1X2LA 3KZ3A 2O38A 3OMTA 4I6UA 1JWLA 2ICTA 2XJ3A 4PU3C 3OP9A 2L8NA 3L1PA 3JXBC 2LYQA 4IA8A 4Z58A 2PUGA 4X4IA 2AWIA 2JVLA 4NDWA 4X4EA 1R69A 2MQKA 2XI8A 3OQMA 2O49A 2PUBA 1Y7YA 1PRVA 3R1FA 2PUFA 2B5AA 1UXDA 2EF8A 1GT0C 3DNVB 3G7DA 4YG4A 3GN5B 2KZ8A 2WUSR 2XIUA 4YARA 3B7HA 1BDHA 2FJRA 4F8DA 4Z59A 1RZRA 2L49A 2LYRA 5A7LA 3QQ6A 3BD1A 3CROL 4Z5DA 1QQBA 2AXUA 2KEJA 4MCTA 1LCCA 3FYAA 4JCYA 2GRLA 4JCXA 4GQMA 3OQNA 2JCGA 1ZVVA 2OR1L 1ZZ7A 4Z5CA 1QQAA 2EWTA 2IUOA 3SCGA 3KXAA 4JQDA 2IV1A 2AXVA 1ZZBA 4YG7B 2KEKA 3F52A 2IVGA 1JFSA 3CECA 1NEQA 3FYMA 2LYKA
chains in the Genus database with same CATH superfamily
1ZPQA 2R63A 1R63A 2PUEA 4YBAA 4X4CA 1RZSA 1AU7A 3RZZA 3JXCL 3D1NI 4GHJA 1UTXA 1PERL 5K98B 1DWKA 2CSFA 2LLVA 1WH6A 2BNMA 1PNRA 4ER6A 2LNMA 2X8NA 3CLCA 3S8QA 2PPXA 2JQEA 3ZKCA 4I8TA 3GUUA 3QF3A 5DTMA 1WH8A 4X4HA 2BNNA 1QP0A 1U2ZA 2R1JL 1OCTC 3KJXA 1HF0A 3KL4A 1JH9A 4DE9A 4I6RA 4EK9A 4BG1A 3MS5A 4J1WA 3K8RA 1ZZ6A 4I6UA 2ICTA 2L1PA 3GZCA 3L1PA 3LUUA 4X4IA 2JVLA 3TELA 4ER3A 2PUBA 1PRVA 3R1FA 2B5AA 3DM5A 1NW3A 4YG4A 2XIUA 4YARA 1BDHA 4Z59A 2L49A 4HRAA 1QQBA 2KEJA 3R09A 3FYAA 3OQNA 2PXKA 2EWTA 3KXAA 1ZZBA 4YG7B 2IVGA 3CECA 3GZDA 3G7DA 3NXHA 3FYMA 1ADRA 1LQCA 1ZUGA 3QFIA 1ZZ9A 4J1XA 2AXZA 3EUSA 4MCXA 1SQ8A 2WIUB 3HZIB 3LQXA 1JFTA 1DW9A 3LFPA 2PUCA 2KEIA 4I6TA 1WIZA 2AW6A 2PIJA 2OFYA 3PE5A 3UWPA 3LISA 4PU4C 2PXUA 2PE5A 2LCVA 3A9ZA 4YG1A 3BDNA 1OSLA 4EZIA 1RZRD 1ZS4A 1BDIA 2XXPA 1POUA 5DTRA 2MEZA 1RIOA 1EFAA 4PU8A 1Y9QA 4BGKA 4BHIA 2BJCA 2PXVA 1ZZCA 2D5VA 2J7WA 4X4BA 3SR4A 3ZHIA 2PXDA 2EBYA 4ER0A 1CQTA 1NERA 1X2LA 4PU3C 3OP9A 3OWQA 2HFZA 4Z58A 3OQMA 1R69A 2MQKA 2XI8A 1HQ1A 2PUFA 1Y7YA 1UXDA 1GT0C 2FJRA 5A7LA 4Z5DA 2AXUA 1ZVVA 3QOWA 1QQAA 4BHGA 3SCGA 2FFHA 2IV1A 3NDBB 4OBMA 2LYKA 2PXTA 1X57A 2GRMA 3TEPA 3O2GA 4EKIA 3UFDA 1E3OC 1QZXA 2PUDA 2PXFA 2VEOA 3H5TA 1XWRA 2H8RA 3QWGA 3O9XA 3G0TA 4X4GA 4OB4A 2ODRD 4FN3A 2LYSA 2GZUA 2AUWA 4IVZA 1UXCA 1LMB3 2PUAA 5DSXA 2A6CA 3OQOA 1O4XA 2O49A 3G5GA 3IVPA 2PXEA 1CJGA 1YSEA 2IU7A 3BS3A 2O4AA 3GBFA 2MXDA 1PRAA 4O8BA 2XXQA 3GN5A 4EQZA 3N6WA 4Z5HA 3SCHA 3TRBA 1MFQC 3JXDL 2IVBA 1L1MA 1IC8A 2KPJA 4FBIA 2O38A 1DULA 2L8NA 5JUWA 2LYQA 4NDWA 2EF8A 3GN5B 3ME5A 2KZ8A 3SX0A 4F8DA 1RZRA 1LCCA 5GAHi 2GRLA 4JCXA 2JCGA 2OR1L 1ZZ7A 4Z5CA 4Q2JA 2IUOA 3GZDC 3A9XA 4JQDA 2AXVA 2KEKA 1JFSA 2V3CC 1VPWA 2HCSA 1QB2A 4X4DA 3F51A 4BHFA 4X4FA 4CWDA 4PU7A 2HSGA 3ZHMA 3A9YA 3VK0A 4DE8A 1B0NA 1WETA 2ICPA 2LYLA 1LLIA 2LLWA 4ER5A 3MLFA 5DRTA 3PXPA 3U3WA 2XCJA 4EKGA 2LYJA 2LYPA 4WVLA 1QP7A 3FMYA 3F6WA 1ZZ8A 2IVQA 2M4HA 3QYXA 1PRUA 5DRYA 1ZAYA 3MEJA 1LCDA 2HCNA 3OKZA 2XSDC 3SCFA 1RPEL 2CROA 2PXQA 1QPZA 4BGMA 4C5WA 2YBDA 4Y42A 2HINA 1S7EA 4IWRA 1QP4A 3M9LA 5DT2A 3ZPXA 3KZ3A 3OMTA 1JWLA 2J7UA 2XJ3A 3VWSA 2PXLA 3NZLA 3JXBC 4IA8A 2PUGA 2AWIA 4X4EA 5GAGi 3TFLA 4C8RA 3DNVB 4ER7A 2WUSR 3B7HA 2PXPA 2LYRA 3QQ6A 3BD1A 3NROA 3CROL 4MCTA 2XXAA 4JCYA 4GQMA 3QOXA 2PXBA 5DTQA 3F52A 1NEQA 2BNOA
chains in the Genus database with same CATH topology
1X57A 1VPWA 1ZPQA 2R63A 2GRMA 1LQCA 1R63A 2PUEA 4X4DA 1ZUGA 3UFDA 3F51A 4YBAA 1E3OC 4X4CA 1RZSA 4X4FA 2PUDA 4PU7A 2HSGA 4J1XA 1ZZ9A 3RZZA 1AU7A 3ZHMA 3JXCL 3D1NI 2AXZA 3EUSA 3VK0A 4MCXA 1B0NA 3H5TA 1WETA 2ICPA 2LYLA 1LLIA 1XWRA 1SQ8A 2WIUB 4GHJA 3HZIB 3QWGA 2H8RA 1UTXA 3O9XA 5K98B 1PERL 1DWKA 4X4GA 4OB4A 2CSFA 1JFTA 1DW9A 3MLFA 3LFPA 1WH6A 3PXPA 2KEIA 3U3WA 2PUCA 2XCJA 2BNMA 4FN3A 2LYSA 4I6TA 1WIZA 1ADRA 1PNRA 2AW6A 2GZUA 2OFYA 2PIJA 3CLCA 2LYJA 2AUWA 4IVZA 2PPXA 2LYPA 3LISA 4PU4C 3S8QA 2PE5A 1UXCA 1LMB3 2PUAA 3ZKCA 4I8TA 2LCVA 3QF3A 4YG1A 2A6CA 3BDNA 3OQOA 1O4XA 3FMYA 1WH8A 1OSLA 1QP7A 3F6WA 3G5GA 3IVPA 4X4HA 1ZZ8A 2BNNA 1YSEA 1RZRD 1POUA 2IVQA 1ZS4A 1CJGA 1BDIA 3QYXA 1PRUA 2IU7A 3BS3A 1QP0A 2O4AA 2R1JL 2MEZA 1ZAYA 3GBFA 1LCDA 1OCTC 1PRAA 4O8BA 1RIOA 3KJXA 1HF0A 1EFAA 4PU8A 3GN5A 1Y9QA 2BNOA 1JH9A 2XSDC 3SCFA 1RPEL 2CROA 2BJCA 4I6RA 1QPZA 1ZZCA 2D5VA 4X4BA 4Z5HA 3SCHA 3TRBA 3ZHIA 3JXDL 2IVBA 2EBYA 1L1MA 4Y42A 2HINA 4J1WA 1S7EA 4IWRA 1QP4A 1IC8A 1CQTA 2KPJA 1NERA 1ZZ6A 4FBIA 1X2LA 3KZ3A 2O38A 3OMTA 4I6UA 1JWLA 2ICTA 2XJ3A 4PU3C 3OP9A 2L8NA 3L1PA 3JXBC 2LYQA 4IA8A 4Z58A 2PUGA 4X4IA 2AWIA 2JVLA 4NDWA 4X4EA 1R69A 2MQKA 2XI8A 3OQMA 2O49A 2PUBA 1Y7YA 1PRVA 3R1FA 2PUFA 2B5AA 1UXDA 2EF8A 1GT0C 3DNVB 3G7DA 4YG4A 3GN5B 2KZ8A 2WUSR 2XIUA 4YARA 3B7HA 1BDHA 2FJRA 4F8DA 4Z59A 1RZRA 2L49A 2LYRA 5A7LA 3QQ6A 3BD1A 3CROL 4Z5DA 1QQBA 2AXUA 2KEJA 4MCTA 1LCCA 3FYAA 4JCYA 2GRLA 4JCXA 4GQMA 3OQNA 2JCGA 1ZVVA 2OR1L 1ZZ7A 4Z5CA 1QQAA 2EWTA 2IUOA 3SCGA 3KXAA 4JQDA 2IV1A 2AXVA 1ZZBA 4YG7B 2KEKA 3F52A 2IVGA 1JFSA 3CECA 1NEQA 3FYMA 2LYKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X57 A;  1VPW A;  1ZPQ A;  2R63 A;  2GRM A;  1LQC A;  1R63 A;  2PUE A;  4X4D A;  1ZUG A;  3UFD A;  3F51 A;  4YBA A;  1E3O C;  4X4C A;  1RZS A;  4X4F A;  2PUD A;  4PU7 A;  2HSG A;  4J1X A;  1ZZ9 A;  3RZZ A;  1AU7 A;  3ZHM A;  3JXC L;  3D1N I;  2AXZ A;  3EUS A;  3VK0 A;  4MCX A;  1B0N A;  3H5T A;  1WET A;  2ICP A;  2LYL A;  1LLI A;  1XWR A;  1SQ8 A;  2WIU B;  4GHJ A;  3HZI B;  3QWG A;  2H8R A;  1UTX A;  3O9X A;  5K98 B;  1PER L;  1DWK A;  4X4G A;  4OB4 A;  2CSF A;  1JFT A;  1DW9 A;  3MLF A;  3LFP A;  1WH6 A;  3PXP A;  2KEI A;  3U3W A;  2PUC A;  2XCJ A;  2BNM A;  4FN3 A;  2LYS A;  4I6T A;  1WIZ A;  1ADR A;  1PNR A;  2AW6 A;  2GZU A;  2OFY A;  2PIJ A;  3CLC A;  2LYJ A;  2AUW A;  4IVZ A;  2PPX A;  2LYP A;  3LIS A;  4PU4 C;  3S8Q A;  2PE5 A;  1UXC A;  1LMB 3;  2PUA A;  3ZKC A;  4I8T A;  2LCV A;  3QF3 A;  4YG1 A;  2A6C A;  3BDN A;  3OQO A;  1O4X A;  3FMY A;  1WH8 A;  1OSL A;  1QP7 A;  3F6W A;  3G5G A;  3IVP A;  4X4H A;  1ZZ8 A;  2BNN A;  1YSE A;  1RZR D;  1POU A;  2IVQ A;  1ZS4 A;  1CJG A;  1BDI A;  3QYX A;  1PRU A;  2IU7 A;  3BS3 A;  1QP0 A;  2O4A A;  2R1J L;  2MEZ A;  1ZAY A;  3GBF A;  1LCD A;  1OCT C;  1PRA A;  4O8B A;  1RIO A;  3KJX A;  1HF0 A;  1EFA A;  4PU8 A;  3GN5 A;  1Y9Q A;  2BNO A;  1JH9 A;  2XSD C;  3SCF A;  1RPE L;  2CRO A;  2BJC A;  4I6R A;  1QPZ A;  1ZZC A;  2D5V A;  4X4B A;  4Z5H A;  3SCH A;  3TRB A;  3ZHI A;  3JXD L;  2IVB A;  2EBY A;  1L1M A;  4Y42 A;  2HIN A;  4J1W A;  1S7E A;  4IWR A;  1QP4 A;  1IC8 A;  1CQT A;  2KPJ A;  1NER A;  1ZZ6 A;  4FBI A;  1X2L A;  3KZ3 A;  2O38 A;  3OMT A;  4I6U A;  1JWL A;  2ICT A;  2XJ3 A;  4PU3 C;  3OP9 A;  2L8N A;  3L1P A;  3JXB C;  2LYQ A;  4IA8 A;  4Z58 A;  2PUG A;  4X4I A;  2AWI A;  2JVL A;  4NDW A;  4X4E A;  1R69 A;  2MQK A;  2XI8 A;  3OQM A;  2O49 A;  2PUB A;  1Y7Y A;  1PRV A;  3R1F A;  2PUF A;  2B5A A;  1UXD A;  2EF8 A;  1GT0 C;  3DNV B;  3G7D A;  4YG4 A;  3GN5 B;  2KZ8 A;  2WUS R;  2XIU A;  4YAR A;  3B7H A;  1BDH A;  2FJR A;  4F8D A;  4Z59 A;  1RZR A;  2L49 A;  2LYR A;  5A7L A;  3QQ6 A;  3BD1 A;  3CRO L;  4Z5D A;  1QQB A;  2AXU A;  2KEJ A;  4MCT A;  1LCC A;  3FYA A;  4JCY A;  2GRL A;  4JCX A;  4GQM A;  3OQN A;  2JCG A;  1ZVV A;  2OR1 L;  1ZZ7 A;  4Z5C A;  1QQA A;  2EWT A;  2IUO A;  3SCG A;  3KXA A;  4JQD A;  2IV1 A;  2AXV A;  1ZZB A;  4YG7 B;  2KEK A;  3F52 A;  2IVG A;  1JFS A;  3CEC A;  1NEQ A;  3FYM A;  2LYK A; 
#chains in the Genus database with same CATH topology
 1ZPQ A;  2R63 A;  1R63 A;  2PUE A;  4YBA A;  4X4C A;  1RZS A;  1AU7 A;  3RZZ A;  3JXC L;  3D1N I;  4GHJ A;  1UTX A;  1PER L;  5K98 B;  1DWK A;  2CSF A;  2LLV A;  1WH6 A;  2BNM A;  1PNR A;  4ER6 A;  2LNM A;  2X8N A;  3CLC A;  3S8Q A;  2PPX A;  2JQE A;  3ZKC A;  4I8T A;  3GUU A;  3QF3 A;  5DTM A;  1WH8 A;  4X4H A;  2BNN A;  1QP0 A;  1U2Z A;  2R1J L;  1OCT C;  3KJX A;  1HF0 A;  3KL4 A;  1JH9 A;  4DE9 A;  4I6R A;  4EK9 A;  4BG1 A;  3MS5 A;  4J1W A;  3K8R A;  1ZZ6 A;  4I6U A;  2ICT A;  2L1P A;  3GZC A;  3L1P A;  3LUU A;  4X4I A;  2JVL A;  3TEL A;  4ER3 A;  2PUB A;  1PRV A;  3R1F A;  2B5A A;  3DM5 A;  1NW3 A;  4YG4 A;  2XIU A;  4YAR A;  1BDH A;  4Z59 A;  2L49 A;  4HRA A;  1QQB A;  2KEJ A;  3R09 A;  3FYA A;  3OQN A;  2PXK A;  2EWT A;  3KXA A;  1ZZB A;  4YG7 B;  2IVG A;  3CEC A;  3GZD A;  3G7D A;  3NXH A;  3FYM A;  1ADR A;  1LQC A;  1ZUG A;  3QFI A;  1ZZ9 A;  4J1X A;  2AXZ A;  3EUS A;  4MCX A;  1SQ8 A;  2WIU B;  3HZI B;  3LQX A;  1JFT A;  1DW9 A;  3LFP A;  2PUC A;  2KEI A;  4I6T A;  1WIZ A;  2AW6 A;  2PIJ A;  2OFY A;  3PE5 A;  3UWP A;  3LIS A;  4PU4 C;  2PXU A;  2PE5 A;  2LCV A;  3A9Z A;  4YG1 A;  3BDN A;  1OSL A;  4EZI A;  1RZR D;  1ZS4 A;  1BDI A;  2XXP A;  1POU A;  5DTR A;  2MEZ A;  1RIO A;  1EFA A;  4PU8 A;  1Y9Q A;  4BGK A;  4BHI A;  2BJC A;  2PXV A;  1ZZC A;  2D5V A;  2J7W A;  4X4B A;  3SR4 A;  3ZHI A;  2PXD A;  2EBY A;  4ER0 A;  1CQT A;  1NER A;  1X2L A;  4PU3 C;  3OP9 A;  3OWQ A;  2HFZ A;  4Z58 A;  3OQM A;  1R69 A;  2MQK A;  2XI8 A;  1HQ1 A;  2PUF A;  1Y7Y A;  1UXD A;  1GT0 C;  2FJR A;  5A7L A;  4Z5D A;  2AXU A;  1ZVV A;  3QOW A;  1QQA A;  4BHG A;  3SCG A;  2FFH A;  2IV1 A;  3NDB B;  4OBM A;  2LYK A;  2PXT A;  1X57 A;  2GRM A;  3TEP A;  3O2G A;  4EKI A;  3UFD A;  1E3O C;  1QZX A;  2PUD A;  2PXF A;  2VEO A;  3H5T A;  1XWR A;  2H8R A;  3QWG A;  3O9X A;  3G0T A;  4X4G A;  4OB4 A;  2ODR D;  4FN3 A;  2LYS A;  2GZU A;  2AUW A;  4IVZ A;  1UXC A;  1LMB 3;  2PUA A;  5DSX A;  2A6C A;  3OQO A;  1O4X A;  2O49 A;  3G5G A;  3IVP A;  2PXE A;  1CJG A;  1YSE A;  2IU7 A;  3BS3 A;  2O4A A;  3GBF A;  2MXD A;  1PRA A;  4O8B A;  2XXQ A;  3GN5 A;  4EQZ A;  3N6W A;  4Z5H A;  3SCH A;  3TRB A;  1MFQ C;  3JXD L;  2IVB A;  1L1M A;  1IC8 A;  2KPJ A;  4FBI A;  2O38 A;  1DUL A;  2L8N A;  5JUW A;  2LYQ A;  4NDW A;  2EF8 A;  3GN5 B;  3ME5 A;  2KZ8 A;  3SX0 A;  4F8D A;  1RZR A;  1LCC A;  5GAH i;  2GRL A;  4JCX A;  2JCG A;  2OR1 L;  1ZZ7 A;  4Z5C A;  4Q2J A;  2IUO A;  3GZD C;  3A9X A;  4JQD A;  2AXV A;  2KEK A;  1JFS A;  2V3C C;  1VPW A;  2HCS A;  1QB2 A;  4X4D A;  3F51 A;  4BHF A;  4X4F A;  4CWD A;  4PU7 A;  2HSG A;  3ZHM A;  3A9Y A;  3VK0 A;  4DE8 A;  1B0N A;  1WET A;  2ICP A;  2LYL A;  1LLI A;  2LLW A;  4ER5 A;  3MLF A;  5DRT A;  3PXP A;  3U3W A;  2XCJ A;  4EKG A;  2LYJ A;  2LYP A;  4WVL A;  1QP7 A;  3FMY A;  3F6W A;  1ZZ8 A;  2IVQ A;  2M4H A;  3QYX A;  1PRU A;  5DRY A;  1ZAY A;  3MEJ A;  1LCD A;  2HCN A;  3OKZ A;  2XSD C;  3SCF A;  1RPE L;  2CRO A;  2PXQ A;  1QPZ A;  4BGM A;  4C5W A;  2YBD A;  4Y42 A;  2HIN A;  1S7E A;  4IWR A;  1QP4 A;  3M9L A;  5DT2 A;  3ZPX A;  3KZ3 A;  3OMT A;  1JWL A;  2J7U A;  2XJ3 A;  3VWS A;  2PXL A;  3NZL A;  3JXB C;  4IA8 A;  2PUG A;  2AWI A;  4X4E A;  5GAG i;  3TFL A;  4C8R A;  3DNV B;  4ER7 A;  2WUS R;  3B7H A;  2PXP A;  2LYR A;  3QQ6 A;  3BD1 A;  3NRO A;  3CRO L;  4MCT A;  2XXA A;  4JCY A;  4GQM A;  3QOX A;  2PXB A;  5DTQ A;  3F52 A;  1NEQ A;  2BNO A; 
#chains in the Genus database with same CATH homology
 1X57 A;  1VPW A;  1ZPQ A;  2R63 A;  2GRM A;  1LQC A;  1R63 A;  2PUE A;  4X4D A;  1ZUG A;  3UFD A;  3F51 A;  4YBA A;  1E3O C;  4X4C A;  1RZS A;  4X4F A;  2PUD A;  4PU7 A;  2HSG A;  4J1X A;  1ZZ9 A;  3RZZ A;  1AU7 A;  3ZHM A;  3JXC L;  3D1N I;  2AXZ A;  3EUS A;  3VK0 A;  4MCX A;  1B0N A;  3H5T A;  1WET A;  2ICP A;  2LYL A;  1LLI A;  1XWR A;  1SQ8 A;  2WIU B;  4GHJ A;  3HZI B;  3QWG A;  2H8R A;  1UTX A;  3O9X A;  5K98 B;  1PER L;  1DWK A;  4X4G A;  4OB4 A;  2CSF A;  1JFT A;  1DW9 A;  3MLF A;  3LFP A;  1WH6 A;  3PXP A;  2KEI A;  3U3W A;  2PUC A;  2XCJ A;  2BNM A;  4FN3 A;  2LYS A;  4I6T A;  1WIZ A;  1ADR A;  1PNR A;  2AW6 A;  2GZU A;  2OFY A;  2PIJ A;  3CLC A;  2LYJ A;  2AUW A;  4IVZ A;  2PPX A;  2LYP A;  3LIS A;  4PU4 C;  3S8Q A;  2PE5 A;  1UXC A;  1LMB 3;  2PUA A;  3ZKC A;  4I8T A;  2LCV A;  3QF3 A;  4YG1 A;  2A6C A;  3BDN A;  3OQO A;  1O4X A;  3FMY A;  1WH8 A;  1OSL A;  1QP7 A;  3F6W A;  3G5G A;  3IVP A;  4X4H A;  1ZZ8 A;  2BNN A;  1YSE A;  1RZR D;  1POU A;  2IVQ A;  1ZS4 A;  1CJG A;  1BDI A;  3QYX A;  1PRU A;  2IU7 A;  3BS3 A;  1QP0 A;  2O4A A;  2R1J L;  2MEZ A;  1ZAY A;  3GBF A;  1LCD A;  1OCT C;  1PRA A;  4O8B A;  1RIO A;  3KJX A;  1HF0 A;  1EFA A;  4PU8 A;  3GN5 A;  1Y9Q A;  2BNO A;  1JH9 A;  2XSD C;  3SCF A;  1RPE L;  2CRO A;  2BJC A;  4I6R A;  1QPZ A;  1ZZC A;  2D5V A;  4X4B A;  4Z5H A;  3SCH A;  3TRB A;  3ZHI A;  3JXD L;  2IVB A;  2EBY A;  1L1M A;  4Y42 A;  2HIN A;  4J1W A;  1S7E A;  4IWR A;  1QP4 A;  1IC8 A;  1CQT A;  2KPJ A;  1NER A;  1ZZ6 A;  4FBI A;  1X2L A;  3KZ3 A;  2O38 A;  3OMT A;  4I6U A;  1JWL A;  2ICT A;  2XJ3 A;  4PU3 C;  3OP9 A;  2L8N A;  3L1P A;  3JXB C;  2LYQ A;  4IA8 A;  4Z58 A;  2PUG A;  4X4I A;  2AWI A;  2JVL A;  4NDW A;  4X4E A;  1R69 A;  2MQK A;  2XI8 A;  3OQM A;  2O49 A;  2PUB A;  1Y7Y A;  1PRV A;  3R1F A;  2PUF A;  2B5A A;  1UXD A;  2EF8 A;  1GT0 C;  3DNV B;  3G7D A;  4YG4 A;  3GN5 B;  2KZ8 A;  2WUS R;  2XIU A;  4YAR A;  3B7H A;  1BDH A;  2FJR A;  4F8D A;  4Z59 A;  1RZR A;  2L49 A;  2LYR A;  5A7L A;  3QQ6 A;  3BD1 A;  3CRO L;  4Z5D A;  1QQB A;  2AXU A;  2KEJ A;  4MCT A;  1LCC A;  3FYA A;  4JCY A;  2GRL A;  4JCX A;  4GQM A;  3OQN A;  2JCG A;  1ZVV A;  2OR1 L;  1ZZ7 A;  4Z5C A;  1QQA A;  2EWT A;  2IUO A;  3SCG A;  3KXA A;  4JQD A;  2IV1 A;  2AXV A;  1ZZB A;  4YG7 B;  2KEK A;  3F52 A;  2IVG A;  1JFS A;  3CEC A;  1NEQ A;  3FYM A;  2LYK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...