2AUYA

Pterocarpus angolensis lectin in complex with the trisaccharide glcnac(b1-2)man(a1-3)man
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
240
structure length
240
Chain Sequence
EDSLSFGFPTFPSDQKNLIFQGDAQIKNNAVQLTKTDSNGNPVASTVGRILFSAQVHLWEKSSSRVANFQSQFSFSLKSPLSNGADGIAFFIAPPDTTIPSGSGGGLLGLFAPGTAQNTSANQVIAVEFDTFYAQDSNTWDPNYPHIGIDVNSIRSVKTVKWDRRDGQSLNVLVTFNPSTRNLDVVATYSDGTRYEVSYEVDVRSVLPEWVRVGFSAASGEQYQTHTLESWSFTSTLLYT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the recognition of complex-type biantennary oligosaccharides by Pterocarpus angolensis lectin.
pubmed doi rcsb
molecule tags Sugar binding protein
molecule keywords lectin
total genus 52
structure length 240
sequence length 240
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00139 Lectin_legB Legume lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2auyA00
2EXJA 2YXSA 3FUQA 1W6PA 1QF3A 2GMPA 2W39A 4K1YA 5T55A 1G86A 3UK9A 4GA9A 1S0EA 2JE7A 3WUDA 4W65A 2YROA 1S0FA 4M01A 4XOGA 1LHVA 1IKQA 2ZGQA 3AJYA 2GN3A 1XQNA 1JOJA 2DUQA 4FOVA 4LBQB 5JOYA 4XBQA 2A7AA 3M3QA 4GALA 4U2AA 1V6IA 2PHXA 2ZA9A 3V0BA 4XYXA 3ZSLA 1GZCA 1LHWA 1W6OA 2ZGSA 4JRAA 1PZ7A 2E7TA 2D43A 4KBBA 4K1ZA 4IQPA 5GLVA 2DU1A 3ZXEA 1JXNA 3RRDA 2ZGRA 3OBTA 2GALA 5T54A 3JU9A 2CNAA 1V6LA 2BQPA 4WZFA 3CNAA 1A8DA 2EF6A 4BLJA 4Y1XA 1N47A 4FOWA 4PQ9A 2SBAA 4XBNA 4AVSA 1YYNA 1N3PA 1QKQA 2P37A 3AFKA 1BQPA 2B7YA 3GALA 3R05A 5DUWA 4UW6A 4NO4A 2AREA 1AXKA 3RQ0A 1QOTA 2RHPA 4Y1UA 1LHUA 2JD4A 4LBJA 1TEIA 4BPZA 2R1BA 3I8TA 5DUVA 2A6WA 3VKOA 2EXKA 2WT2A 4YFZA 1JHNA 1QGLA 1WLCA 3WG4A 2LALA 3N7MA 5JDBA 3ZPYA 1BJQA 4CRQA 3KQRA 4BM8A 2A75A 3N36A 2A6YA 4XBLA 3AP4A 2D6LX 3ZSJA 1S0DA 1ULDA 2ZMLA 1LTEA 1QU0A 3AK0A 1ULEA 2D6PA 1QNYA 2G4IA 1HQLA 1YIFA 2FMDA 3IN9A 3N7LA 4Y1VA 1YRZA 1ZM1A 3B01A 1LENA 2OW4A 1BYHA 1DQ0A 1CPMA 3IKWA 2A3XA 1BZWA 1S0GA 1UZYA 4UW5A 3USUB 4DPNA 4K20A 3WHUA 1LOCA 2ZBJA 2P3IA 2YZ4A 4L8QA 4YG3A 1LU1A 1W6OB 2D6OX 2UU8A 5GZFA 3FLPA 1EPWA 2GN7A 3AZWA 4YG0A 3FFZA 4Y26A 1G9BA 4AVVA 2EIGA 5E88A 1WBLA 4DS0A 1GLHA 1SACA 5JOWA 4AWDA 1URXA 1QDCA 3O5SA 1W6QB 4PBOA 4PBPA 5KXBA 5IK5A 1APNA 1W6MA 4P9YA 2UWBA 2AR6A 4GWMA 5H9SA 1KQRA 4BMBA 1OFSA 4GKYA 3IM0A 2NMNA 4YZ3A 3WG1A 1MACA 2R1DA 3B69A 1LOFA 2CWMA 1LOEA 3NV4A 1RINA 3VKMA 1WCSA 2NM1A 2VW0A 4ISQA 4FPGA 3FBYA 3IPVA 2R16A 1DBNA 3BIWE 1WW5A 2D44A 5DZFA 1CR7A 3N35A 4FPLA 4M3CE 4M3CB 4PF5A 1DYPA 1GICA 3LCPA 1WD4A 4U36A 1O4ZA 1QDOA 5IK4A 1H30A 1LOFC 1S0BA 4YM3A 2P34A 4YZ5A 4YLZA 2E6VA 4P9WA 4FPJA 3AXEA 4YW4A 5GLTA 1AXYA 4WVVA 3WDXA 4RA0A 1SLLA 2A3WA 3OYWB 1LOAA 2E53A 3RS6A 1HLCA 1W6MB 3N3HA 1CQ9A 2ZHMA 3INAA 5GZCA 4FP2A 5DZGA 1UL9A 2OVUA 1S0CA 3T1MA 4M3CF 2DU0A 2JE9A 3WOGA 4XMIA 1VIWB 1F9KA 3A0KA 3AYDA 1D0HA 3IPVB 4Y1ZA 2E51A 3H0OA 1GZWB 3RMYA 1MS0A 3MEPA 1AVBA 3OBRA 2ZGPA 1G9AA 2P3JA 1MS9A 5KXCA 4AGGA 2GMEA 2I2SA 3L2YA 5CB7A 3A4UA 3GNEA 3WDUA 1G7YA 1FV2A 1LOBA 3MW2A 3UJQA 3ZXLA 1AJOA 2DTYA 1C57A 1CVNA 1DGLA 1H9WA 3BOPA 3W59A 3TB0A 2WLQA 3AP9A 3WLUA 1OKQA 1LJ7A 4NOTA 2H0BA 2A3YA 3JUUA 4BMEA 5GLZA 2DURA 2TEPA 1CJPA 5FREA 1SCRA 1SBFA 1BXHA 1ZA4A 2WKKA 3BTAA 1AJKA 4Q1PA 1KJRA 3R4UA 1SCSA 4XZPA 3PJQA 1GSLA 1SBEA 1C1FA 2C5DA 3N7KA 3WG3A 1FYUA 1UZZA 1Q8PA 1SLAA 2AENA 1W0PA 2SLIA 4XIKA 1IS6A 5H9PA 3PVEA 3WDTA 4Q26A 3ZSKA 2UWCA 5GZDA 1IS4A 2VUAA 1CPNA 4I30A 1PZ8A 3WNXA 4FPOB 4R9DA 1A78A 2HYKA 1R1ZA 2OUJA 1N3OA 2YMZA 1Q8VA 1Z0HA 1Z78A 3SITA 5JLVA 4CTEA 3ZXKA 3POWA 5T5PA 2WQZC 3BODA 1MS3A 4XE9A 4AVTA 1WLWA 4XXAA 1N1VA 2PHTA 3SH5A 4ZXKA 5GM0A 3POSA 4Y20A 2V5YA 1Q56A 1C1LA 1YXWA 3PVNA 2R49A 4YGCA 1AX2A 5DXDA 5LK5A 2R0HA 4XJAA 4DRVA 2ZKNA 1S0JA 5IK7A 3FUOA 1LOGA 2PHRA 2VH9A 2EXIA 1QMJA 4C1XA 2ARXA 2E7QA 1W6PB 3ASIA 4FPHA 4LBMA 2CY6A 3ZYRA 5IT6A 3WG2A 1UKGA 2W08A 1PZ9A 3A0NA 3ATGA 3B9CA 5F5QA 1UX6A 1IS5A 4JC1A 4GXLA 3W58A 3OJBA 3VKLA 1W6NB 2ZGMA 1GZWA 4XHXA 2FHRA 3HN1A 3VV1A 3B00A 1HKDA 1KRIA 1HDKA 4PCRA 4Y20B 4ISRA 4WVWA 3DGTA 2DWRA 3WCSA 4LBKA 3WDYA 1AZDA 4FVVA 1UMZA 3VKFC 1LODA 2V73A 4SLIA 2WJSA 2ERFA 4R9CA 4YM2A 3APBA 2AGSA 3M3OA 4XMAA 5T5OA 1FAYA 3OYWA 2ZGLA 3B3QE 1AXZA 1CN1A 3AXDA 1FNYA 4XILA 5T5JA 4FPCA 1N1TA 1MS4A 3WDWA 3V0AB 1QOOA 1Q8OA 4XTMA 3QCWA 2NMOA 4XJUA 2Q5TA 2VW2A 2GMMA 5GLUA 1VLNA 2PHUA 2UWAA 2CTVA 3SH4A 5CBLA 1IKPA 1DQ4A 1YO8A 2DVGA 1NXD1 2PHWA 2OUHA 3NWKA 1KJLA 3SISA 1LGNA 5CA6A 1S1AA 4ATEA 2DUPA 2ZHLA 3AZZA 5DUXA 5GLWA 1GBGA 5FRAA 1N1YA 3WHTA 3UJOA 3QLQA 4Q2FA 2D3SA 4Q8KA 2ZHKA 2D7FA 4YZ4A 4AYUA 1JBCA 3VKNA 2LTNA 1MVEA 2DVBA 3WDVA 2P2KA 2JJ6A 1W6QA 2R0FA 4FPKA 4H55A 3D4KA 3ZVXA 4YZ2A 2DVFA 2NYYA 3AP7A 4UW3A 2ZHNA 5JMCA 4YW5A 1DIWA 3KM5A 3O0XA 2EAKA 4P9XA 4YGDA 1FV3A 4LBOA 1G9CA 3Q9OA 2ZACA 3AZYA 2D3RA 3N7JA 1SBDA 1JYCA 2AUYA 1F31A 2ZGOA 4WV8A 1S0IA 5GZGA 1IS3A 1Q8QA 5T5LA 2D3PA 2A6ZA 2CYFA 2WT1A 5JVVA 5HCFA 5T50A 1DFQA 2A71A 2JDZA 1HQWA 4FPEA 2ZZJA 3WZ1A 2D6KA 3AYCA 1N1SA 4XJZA 5L73A 4FP3A 1GZ9A 1V00A 1G9FA 1GANA 3AP5A 4YW2A 2NP0A 2ZMKA 4BLIA 4YW3A 2P3KA 5CNAA 4LBQD 1DQ5A 2DYCA 4YM1A 1V6MA 3RSJA 2DTWA 2XB6C 4FPYA 5DG1A 5DUUA 1SLTA 2GNTA 2CL2A 4XDQA 3C2UA 3AJZA 5EYYA 1DQ2A 2DVAA 3ZXJA 3AZXA 2GNBA 4YFWA 3AP6A 1LEMA 5IUQA 1FNZA 3M1HA 3USUA 4FQ4A 1WW6A 3MPPG 2KM2A 5T52A 3FLRA 5KXEA 1WD3A 5KXDA 1UAIA 1MZ5A 2YY1A 5CAZA 1MR5A 4ZKTB 5F9TA 3M3CA 4YGEA 4YZ1A 2ENRA 1YI7A 4BQ1A 3OY8A 1WW4A 4Y22B 4GWNA 1RIRA 3MW3A 2D6MA 4GKXA 4FOQA 1J1TA 1WBFA 2D6NA 3O0VA 2EALA 1DZQA 5GJ6A 4XIOA 2VW1A 4TZDA 4RL7A 1B09A 2GDFA 3OY8B 2ARBA 5IK8A 4FQZA 5DG2A 5H9QA 4Q27A 2W52A 3LSEA 1WUVA 1FX5A 2Z42A 3DUIA 2WSUA 1CIWA 1MS1A 4Y24A 3ZSMA 4F83A 2ES3A 3SLIA 3U4XA 4ASMB 1AX0A 1JW6A 3WV6A 5BYNA 3PVOA 1N3QA 3VUOA 1ONAA 1WW7A 4XXPA 1DQ6A 3WVJA 1AX1A 1C4RA 1Y7BA 2PELA 1LHOA 2ZMNA 1LHNA 4YG6A 1VALA 1ENQA 1GYKA 4TYSA 2VXRA 4BOWA 5HCAA 4YW1A 2XG3A 4YGBA 2DV9A 1LGBA 3AYAA 3SH3A 1DYKA 1KITA 5E8AA 3MW4A 3AYEA 2W68A 5HCBA 3D6EA 1JYIA 2GNMA 1V6JA 2WNEA 1V6NA 5JOXA 4XTPA 4LBQA 4ATFA 2C9AA 1GNZA 1G8WA 3I4IA 4AGVA 1KDKA 1Q8SA 4Q1RA 4XJWA 5SV8A 1O4YA 1KDMA 1IOAA 1U0AA 5AVAA 1GKBA 3M2MA 4DQAA 4DRRA 1UN1A 4OZXA 2ZGKA 1GV9A 3WUCA 5EWSA 4Y1YA 3O0WA 4FOYA 1OQ1A 3AX4A 4R9AA 4Z8BA 1QOSA 5E89A 2CWSA 3T2TA 1SLCA 4YM0A 1VAVA 3OPZA 1SFYA 2WSVA 3ZXFA 2JKBA 1I1EA 3V0BB 1QNWA 1ULFA 2AYHA 4C1WA 4HL0A 4CZSA 2VU9A 2JECA 1SLIA 1LECA 4Y22A 4K21A 1CONA 2ZGTA 1JUIA 3OGGA 3SNMA 2ZABA 4R9BA 3UL2A 5H9RA 4JCKA 4MYEA 4D69A 1ULGA 1LEDA 5EXOA 3ILRA 3NV2A 2GNDA 1VAMA 2ZGNA 3ILFA 3TAYA 1MVQA 4XJ9A 2EXHA 1X50A 1I3HA 1W0OA 3POYA 1MS5A 1BKZA 1RITA 1DHKB 1LCLA 4FPFA 2NN8A 3WCRA 3ENRA 2VY0A 3V65A 1ENSA 3LSDA 4LBLA 2DVDA 1D2SA 1UPSA 3HMYA 3RMXA 3FLTA 3V64A 1DLLA 3HR9A 4XHBA 1ENRA 3IMNA 1LGCA 2NZ9A 4XJ8A 3ZYPA 1A3KA 1LU2A 4Q8LA 1AF9A 1DQ1A 4ITCA 3M3EA 4AGRA 1JN2P 2A6XA 2A6VA 4HANA 1FATA 1F5FA 1MS8A 1LESA 3R4SA 4P14A 1SLBA 3D5OA 4UW4A 2ZAAA 3AZVA 2A5ZA 5JOZA 1WLDA 1V6OA 3ILNA 3NV1A 4M3CA 4M00A 4LBNA 3NV3A 4DFSA 1GNHA 1LULA 2AH2A 2PHFA 1G9DA 3O12A 1NLSA 5DZEA 1CESA 3RG0A 1W6NA 1V6KA 5EYXA 2YV8A 3PMEA 2WT0A 5GALA 3T1LA 2ZGUA 1MZ6A 2A70A 3V0AA 2UURA 2DUOA 1H9PA 1ULCA 5GZEA
chains in the Genus database with same CATH superfamily
2YXSA 1OOPC 2E32A 3FUQA 1QF3A 2GMPA 2QQWA 4QXHA 2YROA 3GHNA 4XFAA 4XF4A 2YGLA 3USSA 2WNVC 3C7GA 1GWKA 2P6CA 3K3OA 4JV4A 3ACLA 2DFBA 2BNOA 5JOYA 3B5LB 5F3GA 2A7AA 4JX0A 3LOIA 1WLTA 4HG6B 3V0BA 2X5IC 4H14A 5C70A 5FUPA 1XYOA 5KC6A 1OI6A 1GZCA 1LHWA 1ND2B 3LFIA 4JRAA 1PZ7A 5CU1A 1W04A 3MLJA 3OGVA 4KBBA 4LULA 3NQHA 4IQPA 5A1AA 2DU1A 3ZXEA 3RRDA 1UOGA 4AFDA 2YG0A 2JG8B 4Y5Z0 4DUWA 4HPKA 4HKOA 4NAMA 3OD0A 4QPIA 1HRV2 2CNAA 2JDMA 1V6LA 2XJTA 4WZFA 4YYOA 3ZXAC 1UY0A 2HWC3 1JYVA 1A8DA 3GXUA 3EHKA 1W39A 3WQBA 4XZUG 4OHYA 3NJZA 2AEZA 5FZ4A 3SEEA 2HWB2 5LK7B 3LD8A 4QX3A 4UFKA 3M70A 2W87A 3O1UA 3LPFA 2LW8A 5JPMB 4ZU5A 2BOJA 4LO8A 3TN92 1MEC3 4DY5A 2Y60A 4BPZA 5DUVA 4JGZC 4CDXA 2EXKA 2XHKA 2WT2A 3LEMA 3I2HA 4RSUA 3WG4A 1JI6A 4AFAA 4O9EA 2WN3A 3N7MA 2Q1FA 3JD71 4XFCA 4DXZA 5J1XA 5A7QA 5JDBA 3VD4A 5FZ8A 2A75A 4A7KA 3N36A 4XBLA 4CP0A 3PUHA 1R093 3VD5A 1ULDA 1LTEA 4F7ZA 5F1RA 1ULEA 3ON7A 5IAXA 3N7LA 5CVRA 2FMDA 1X8MA 2W9XA 5APAA 5I91A 1ZM1A 2OW4A 4IEQA 1DQ0A 5EJZB 2OIIA 4QGNA 2TNFA 2Q8OA 3IWZA 1VBC3 2Y6KA 2ZBJA 2P3IA 2HKXA 4R4XA 4YG3A 4BB3A 4UBHA 2EVXA 4FI9A 3RZKA 5GZFA 2ZJCA 3FLPA 2CU5A 4GWIA 2GN7A 1UD1A 3WNKA 1UIKA 5E88A 3D0JA 1GLHA 2K9ZA 5DN2A 2VOWA 1QDCA 2JDNA 2QBXA 5C9AB 2BWCA 3O5SA 5J7MA 1W6QB 4PBOA 1NKGA 4NAOA 3UV9A 4P9YA 1ASJ1 3THTA 4BMBA 5JXGA 1KQRA 1QIQA 4FBFA 2RMU3 5AFBA 1DGWX 3WQ1A 3LPGA 1ZNPA 3DKQA 2R1DA 3B69A 1XYPA 2CWMA 3WR0A 4QPGA 2PMWB 2RV9A 1D4M2 5IYYA 3K2OA 2MEV3 2C9KA 2YBPA 1DBNA 2XL7A 3BIWE 1WW5A 2D44A 4FT8A 4M3CB 5FBZA 3I3EA 4QU1A 1WD4A 2C4XA 2W91A 4U36A 1H30A 1ZRIA 4QB2A 2BGOA 4YLZA 4P9WA 1CX4A 5A7OA 4FPJA 2XJPA 3HBKA 1HXS2 1VBE1 2HYXA 2NQYA 3WDXA 4CPBA 2Y34A 1LOAA 2E53A 3HEIA 3ZFEA 1HLCA 1W6MB 1UMHA 3N3HA 4JTNA 4QPYA 1RUJ2 1UY4A 1HRI1 4FP2A 1FOD2 4QQLA 5A33B 3B7MA 4C0HA 3H1MA 2FDHA 4M3CF 3WF3A 2JE9A 1PO13 3JD73 1NLQA 4XMIA 3WOGA 1POV0 1VIWB 2XUEA 4L99A 3EYPA 1D0HA 2FQPA 1BK1A 3AKSA 3IPVB 4MX3A 4IERA 1AR93 4R52A 4Y1ZA 2RJKA 2ZX0A 3I97A 5FZBA 3RNSA 3MDPA 3KGZA 4NJ4A 1QJEA 5KXCA 5T3NA 1G9AA 2ORXA 2GMEA 2OXBA 3TBDA 3L2YA 2PHDA 4LK7A 1HRI3 1IPJA 1NLRA 4CCEA 1Q5OA 5D1IA 4CP2A 4IETA 1O3QA 1XPWA 3N9LA 3UJQA 1H0BA 2WAOA 2RDQA 2JDPA 1VBB2 1H4HA 1X36A 2JD9A 1DGLA 3BOPA 3ZFEB 2PLV1 2Y6JA 2WLQA 3ZYJB 1F4AA 4AHXA 2QQPA 1AL0G 2TEPA 4QX5A 4COYA 2IXJA 5FREA 4BH9A 4QDQA 5LCWL 1SBFA 2K2SA 1ZA4A 1W9WA 1DLCA 3VZNA 4Q1PA 1OLQA 3OUJA 2LRPA 2WR9A 3NKGA 4LA2A 3E5XA 1COV1 3N7KA 1H1IA 1OH4A 1Q8PA 4XIKA 2AENA 1ACCA 5B2GB 4Y33A 1IS6A 4EZ4A 5KWRA 1W0NA 2HWF3 4QPGB 1F4HA 4Q26A 3I54A 3AKTA 2UWCA 3ZSKA 5LZ6A 1IHMA 4IV1B 4QDRA 1CPNA 4A4AA 3R6SA 2GC2A 1I5PA 4FPOB 4R9DA 3U14A 3VD7A 2E9QA 1LKNA 3GHMA 3OGJA 4LT5A 1R1ZA 1N3OA 2HWF1 4Q5OA 1Z0HA 1VBB3 3SITA 4COUA 5JLVA 1YWKA 1PVXA 4RQPA 3ZXKA 1XNCA 2WQZC 4AVTA 3THDA 3HAGA 4G3YC 2XPJA 2DCTA 4XXAA 5ISLA 4RS5B 4FFFA 1VRH3 5GM0A 3POSA 4ZXKA 2V5YA 1ZRDA 4Z2AA 1C1LA 1PIV2 2RS31 2R49A 1JHJA 2LUWA 2VC9A 3PVNA 3RGBA 5KC5A 2WNOA 4O7XA 1QQP3 2QQKA 5DXDA 5LK5A 1K5JA 3WP6A 1S0JA 2RM21 3FUOA 2DCJA 3Q8EA 2VH9A 4AI0A 2TUNA 2QUOA 3UNPA 2ARXA 4NIDA 3N9OA 3C7OA 2VTXA 3JD72 4LORA 3J7MA 4S2HA 5DAQA 1NT0A 3ZYRA 4B1LA 2AC1A 1UKGA 2BVBA 5IT6A 5F5QA 1UX6A 4JC1A 4LPLA 3W58A 3S5AA 3LA2A 2YC4A 1R1A1 3WSOA 5C71A 1DDLA 1KRIA 5BNOC 4N53B 1QEXA 4WVWA 1AR83 4N7UA 4MG2A 4KMQA 4DZGA 5FKBA 5FZ1A 1TG7A 4FVVA 1JZ2A 1UMZA 3KB5A 5LA2A 4UT5A 2WJSA 2HWE1 2V4VA 4R9CA 2RS51 3APBA 3SC7X 3WF2A 2ID4A 2WS91 4IE7A 4V2VA 5EIYB 1AXZA 2BVVA 2RR11 4IXLA 4MUVA 5ABJB 3PLQA 3AMNA 4KG8A 2QQVA 1HB4A 2F6BA 1Q8OA 4QU2A 4UFIA 4AVBA 5A6QA 2NMOA 2Q5TA 1UKRA 1FPN1 2W2IA 2FCUA 2HWC2 4HN1A 5CBLA 4BIFA 2DVGA 3A21A 2VPVA 4JKMA 5DAWA 3SISA 3CZJA 1LGNA 4UAPA 4OHVA 4DXSA 3GGLA 3AZZA 1ZZ8A 1GBGA 3KF5A 4HSLA 1JZ4A 1N1YA 2WFF3 3E6BA 2D3SA 3VLBB 4N90A 4URAA 4B4RA 3VBSC 1JBCA 3WDVA 2B42B 2DVBA 5L7OC 2NLRA 4AQ6A 2P2KA 2JJ6A 4H55A 1AHSA 4IESA 3D4KA 5EHDA 3WP3A 3QH7A 1DZRA 1ULPA 5A3PA 2ZHNA 5JMCA 1JS9A 1REDA 4JGYC 1F5JA 1R092 5IVFA 3KM5A 3O0XA 1KD7A 3SMHA 3WD5A 4BCUA 1C28A 4AI2A 4HXCA 4M0HA 5F3EA 2ZACA 3CLPA 1NA1A 1VRBA 2Z4FA 3ACHA 1AYN3 1SBDA 3N7JA 1F31A 2XGXA 2JB8A 1O5LA 1Y9QA 3VDDB 3UGGA 2FCVA 3NJYA 2VJXA 4PLOA 1R081 5A3OA 2A6ZA 4IEZA 3C7HA 2WT1A 5FPZA 1CD3G 1NY72 4FFIA 2PQQA 5FYSA 4AE2A 4UBGA 2Y0OA 1US3A 2VQUA 3I3QA 3WZ1A 2ZZJA 1E5HA 1RUD3 2OYZA 2RVAA 3WY6A 5HXMA 3H8XA 1XC6A 3JB4C 4KGGA 3VN4A 2RDRA 1WMEA 4GD4A 4UI9L 3PDQA 5G05L 1W8HA 4IE0A 3AP5A 4YW2A 1JZ5A 3HQUA 4CU9A 2NP0A 2P3KA 3LB9A 4OZOA 4YM1A 2ARCA 2B5HA 1OBNA 2G9ZA 3LQCA 3Q8FA 4FPYA 1RUC1 2MPFA 2YC2A 5KR7A 4AEDB 4GH4C 4AG4A 5LY2A 3AP6A 2WO7A 4ZXEA 4BK4A 2R7EB 1WW6A 4FQ4A 4YWAA 3PMSA 2BTVC 5G04L 5A3NA 2WZ8A 2WZR1 4Y5SA 4X6RB 3J7NA 5KXDA 3ACIA 1PK6C 5K0UC 1GQPA 2VMGA 1TNRA 4HBNA 2WWUA 5F9TA 5FUNA 4QQPA 1NE4A 2W1SA 2ENRA 3S57A 3OY8A 2IWGB 3LEIA 3CJXA 1H8TB 1WW4A 1NG0A 3LE0A 1OVSA 5ANNA 3VBSA 5L7OA 3J8F3 1JZ3A 1FMD2 4FXKB 2B8MA 4IE5A 2D6NA 5ERLA 2R041 1PNGA 3MV11 1DZQA 1R083 5GJ6A 4RL7A 5A3MA 1B09A 2W1WA 1NCQB 2GDFA 4QB6A 2ARBA 4UYBA 5FP3A 5DG2A 2VNRA 3SCGA 5IK8A 3KWVA 3LSEA 4Q27A 1WUVA 5FMOS 4BDVB 3DUIA 2WSUA 4Y24A 1MS1A 3ZSMA 1E5IA 3KF3A 1TME3 2O8OA 2ET7A 3VBHA 2DCZA 3WV6A 3PVOA 1N3QA 1W9YA 3WNLA 1NOVA 1PGW1 1WW7A 4YNIA 2VTFA 1JOPA 5FY1A 3HD8B 4JHZA 4IV1C 5JSOA 3BIEA 1W03A 4QKBA 2WRAA 3U07A 1VALA 1ZZBA 1DF0A 2VCCA 4CUAA 2Y6LA 4QAWA 1AR73 4WM8A 3T0DA 5FY5A 4YW1A 1RUD1 1AR91 5EFUA 2YDEA 4GWJA 5LATA 1RGSA 3AYAA 3WP5A 4EROA 1KITA 4JRLA 2YPJA 3J8F2 1ZBA1 2WA3A 4RQPB 3AYEA 5E8AA 5HCBA 3TEZA 5A3LA 4XF3A 5FPXA 1WCUA 2G19A 2WNEA 4XTPA 4ATFA 4CVUA 3CQOA 4XFHA 5FAXA 1GNZA 1G8WA 4QDSA 5K0UB 3LAGA 1X9PA 4EJRA 2VVDA 1JU3A 2FDJA 1RUNA 3FHQA 3R0RA 1UN1A 3CZUA 4IE6A 1YQ8A 4GB33 3RI8A 4FO9A 1K5MB 1PO23 2XJSA 2B46X 4FOYA 1TVGA 4R9AA 1SZBA 4Z8BA 1HX6A 4JQRA 4RHV1 5C3RA 2BGCA 2BRTA 3OPZA 1HW5A 2WSVA 3ZXFA 3V0BB 4ZU7A 3Q8AA 1U12A 4JHTA 1SFNA 1TME1 5F2SA 4C1WA 2FDFA 4NWVA 5I93A 2JECA 2OS2A 4Y22A 3AMPA 3SNMA 1BEV1 1OH3A 4R9BA 2XL9A 5H9RA 1PVC1 4JCKA 4MYEA 5JPNB 1BLZA 1WKYA 2ILMA 1QWRA 5FY0A 1VE0A 4C8DA 5FZMA 3ZN4A 5C5TA 1F8VA 1VAMA 3MF6A 1X50A 5LW9A 1XOYA 4UWDA 4CDQC 1IQDC 2BPA2 4FPFA 3PL0A 1UCXA 1VBA3 2NN8A 4NIGA 5DABA 3WCRA 2RR13 2VY0A 1SHWB 1ENSA 3ZIWA 2HLEA 4LITA 2DVDA 2VMFA 3PVBB 3BN6A 3WT3A 1ENRA 3IMNA 1LGCA 1TE1B 3UKVA 3HOBA 1EPZA 2OA2A 5FMBA 4INDA 4Q4V2 1KS5A 5FZAA 1RXFA 5DPNA 4ITCA 2ZX1A 4L0PA 5F3CA 1HJGA 1JN2P 3DV8A 4AGRA 3I2OA 4IEUA 3DPRC 3WF4A 2EA7A 2ET1A 4NVPA 1MS8A 3R4SA 5J48A 4PJYA 5FP8A 2DFCA 4AEKA 1YQ2A 4QQOA 1W8UA 1V6OA 4ZY9A 4LHLA 2VVEA 3GZUC 1X82A 4M3CA 3CL1A 4XQDA 3S7IA 5K7PA 2D5HA 3THCA 4IEVA 4DFSA 1JZ7A 2BFUS 1Y9GA 1G9DA 1RUI2 4L9BA 1GQHA 1NLSA 1QY4A 5F3IA 3M3IA 1F2NA 2VZQA 1V6KA 3B94A 3T1LA 3GCXA 4L97A 3V0AA 5FP9A 3J7LA 1XB9A 2DUOA 5ABJA 3SQOA 5GZEA 1SG3A 5FBJA 5FWEA 2W39A 3DCQA 3OSDA 3WUDA 4GA9A 4W65A 1ZZ7A 5C5UA 1AUYA 1BEV3 2VE1A 4M01A 1VBA1 1IKQA 2ZGQA 3DEMA 2BBAA 3MHZA 3AJYA 2GN3A 1JOJA 2DUQA 4LBQB 4WM7B 3VBFA 4KU7A 1Z7S1 1FT9A 3M3QA 4GALA 4U2AA 1V6IA 2VZOA 5CZKA 2LS6A 4A3ZA 2BZDA 3R4DB 4UF0B 4F3JA 1QHDA 2W5FA 3WW3A 2C0ZA 4LA3A 2Q30A 4XYXA 3ZSLA 3ZYBA 5CKQA 4BQ2A 3BTXA 2VTXJ 5CFDC 2W46A 2DF7A 1R64A 3K46A 5LEKA 2N7GA 2OZ6A 3OBTA 3CBNA 5FPLA 2GALA 3JU9A 2QTWB 2BQPA 2JDKA 3AL6A 3CNAA 4MO3M 4HVQA 4AVCA 1RUE1 4BLJA 5JSPA 4NR1A 3VBOB 1HXS1 1VBE2 4FOWA 5JZGC 2SBAA 4XBNA 2XBO1 4J6GA 4M4PA 1WMFA 1BQPA 1RJ8A 4CEYB 1ZBE1 1V9U3 2H0VA 2Y26A 3FFQA 2ZX3A 4UW6A 1W3XA 4ES8A 3RQ0A 1QOTA 4PI0A 5CFCA 4J25A 5FPVA 3H8RA 3RZGA 4XQ4A 4HKLA 1TEIA 5LRSA 3I8TA 4FFHA 1P8JA 4AEJA 1V9U1 4OUSA 1OA3A 2K46A 4IEWA 1CX1A 2BJSA 2P5BA 3LA7A 4TLFA 2RS13 3BI3A 3VZJA 3ORJA 1H8VA 4Y3OA 2VZTA 4H7MA 5FMCA 3CF6E 3J8F1 2R071 1S0DA 3ZSJA 2X8KA 5LA0A 1NE6A 2D6PA 1QNYA 1JYWA 1HQLA 3P5BA 1J3RA 5C8CC 1YRZA 3T4VA 3THPA 1BZWA 2VNGA 3DYPA 1S0GA 1VBB1 3MFAA 2W3JA 2BNNA 4G9SB 4QKNA 3WHUA 4KWKA 4ZS2A 1ND2A 1UZ0A 1YI9A 2F4PA 2D6OX 1OFNA 3KV5A 3NO8A 1GMMA 2CV6A 1TNFA 4YG0A 4A6OA 2A73B 2R062 5IFPA 1PM7A 4P00B 3LEKA 3WNMA 2EIGA 1AYM2 4D6SA 4CXYA 5I0SA 3CJIC 2PAKA 2VL4A 1L3JA 4B29A 3FWEA 4PIXA 2XH6A 4XETA 2J1AA 4EN0A 3O1RA 2RM23 2DDUA 3IAPA 3U11A 1EAH2 1U5YA 2E31A 4Q4W2 1ST8A 2WYFA 4ZU4A 5KXBA 3I2GA 4LO7A 5H9SA 2VCBA 2WZR3 3POGA 4XACA 4Q0VA 4GKYA 5E6HA 3VD9A 3IM0A 1OF4A 3GF6A 3WG1A 1JYTA 1FOD1 3NV4A 4DEQA 1RINA 2D93A 1H2LA 4CU7A 5FPAA 2XBO3 4ISQA 4AAPA 2Z5WA 2VBDA 5JAXA 1CAVB 1MQTB 3VDDA 5BNPA 3DN7A 4BA6A 5L19A 1VBA2 3ZDSA 2VZVA 5DZFA 3KT7A 4HOOA 4MHUA 3N35A 4Y5TA 4M3CE 4CEWB 1REEA 1GICA 5A1FA 4E4DX 4XF1A 5D21A 1O4ZA 1POV3 1LOFC 2J1RA 2R063 3P3NA 4V1PA 3W9AA 2E6VA 3C7FA 1O3RA 3NAPA 4P9IA 5GLTA 5JXIA 5CKMA 2WQ8A 1HIXA 1GP4A 1YIPA 3RS6A 5GZCA 5A3WA 1J3QA 2ADDA 5DZGA 3EO6A 2OVUA 3T1MA 2P6HA 4WVMA 3N9MA 5I8TA 3AKQA 1FXZA 4EN9B 1F9KA 1RUE2 5A3TA 1QJX3 3ZR5A 3H0OA 3I2IA 2XBO2 2RS12 1MS0A 3MEPA 1YJLA 2WS93 4QHBA 2P3JA 1MS9A 2UYBA 2YHJA 4AGGA 3IIIA 2X05A 4Q4Y2 1OHFA 3FX3A 3JXSA 4K8RB 4BE3A 2B4KA 3KLSA 4N43C 3JB8A 4CDWB 1QXPA 4LHNA 1V9U2 3MW2A 1OPOA 3O1OA 3ZXLA 5K0UA 2DTYA 2VZRA 5C9AA 1KFUL 1BBT3 4S2FA 5C3SA 3RZMA 1R1A3 3CJIA 3AP9A 2VQAA 1DCSA 4NOTA 3B93A 1PGL1 2A3YA 4BMEA 2V4AA 2DURA 2XVLA 3G6JB 3Q8BA 3MIGA 3S5QA 3PHMA 4BIOA 5LBCA 2RDNA 2EAAA 4FTBA 1K12A 1RJ7A 2OPWA 3R4UA 2HWE3 2R32A 1OURA 1SCSA 1C1FA 1UZZA 2PA7A 1SLAA 1OUSA 2W95A 5FCCA 2VQ0A 1CAXB 2XOMA 5J98B 3PVEA 4BQ5A 4HZFA 2QQNA 2XQXA 3VGIA 1HQNA 1PZ8A 2Y8KA 3I2DA 3BU0A 2JB4A 1PHMA 3GZEA 2HYKA 2OUJA 2YMZA 1T6BX 3NNFA 1RVF3 2VOKA 3OOXA 3POWA 4AI8A 5FK8A 4NIAA 5HI0A 1TZOA 1RXGA 1GOGA 4D6RA 5IVEA 3TNQA 4DOUA 5C33A 1OSGA 4CP9A 2WUHA 1CAUA 2G9FA 4CA9A 1AX2A 1RHI3 4XJAA 3SCHA 4DRVA 1W2NA 5IK7A 5CFDB 3ABZA 5DDJ2 4CDUC 2EXIA 4CCMA 1QMJA 4LTAA 5C4WC 2VZUA 5BV6A 4LBMA 3UGHA 4QKDA 1T6GC 1XSRA 5I8SA 2J1UA 4ARXA 4ONUA 2VUDA 2Y64A 3A0NA 3B9CA 4IV1A 1RUI3 2QZ3A 5AFEA 1J59A 2HH9A 2WABA 2IXHA 3NNJA 4GXLA 4DB5A 3IZOA 3VD3A 1RB8G 3TN91 1RMU3 1Y43B 3HN1A 2BGPA 3B00A 3NL1A 5L9BA 4QX1A 4D3WA 4PCRA 4CCLA 3K4ZA 5BY5A 4Y20B 1XBFA 5KHHA 2WINB 4Q4Y3 1UXZA 4DUXA 4LKSA 3DGTA 2DWRA 1W8ZA 4PT6A 1QJY1 4PIYA 5E16A 3D3AA 1LODA 4SLIA 1NY71 1XNAA 2R043 4XMAA 1JOBA 2VUJA 2ZGLA 3B3QE 5B4NA 1GU3A 3CKHA 1N1TA 1MS4A 1W06A 2VXJA 4OMDA 4AI1A 4BQXA 1QOOA 1IQAA 2GZWA 4GH4B 4MGQA 1YFYA 5CADA 4XJUA 4I0AA 3MO4A 5A32A 1OXCA 1CAXA 1DG6A 2GMMA 2VW2A 1VLNA 4XUQA 5FZOA 4D7YA 4L11A 1GWLA 3MGUA 1I6XA 4YRDA 3VB9A 2CTVA 1IKPA 1DQ4A 3KD4A 1YO8A 4QX2A 1UY2A 4E2GA 5FYCA 1QJU3 2HWD1 2OUHA 2PHWA 3NWKA 4GZ9A 5FZFA 2VGDA 1O8PA 4ATEA 5CA6A 1VBE3 5LA1A 2Q4SA 3EQEA 5DUXA 5F2WA 3FC0A 4TWTA 4XUOA 3ZXGA 3UJOA 2ADEA 3AKRA 1ZYBA 3EB7A 4UXAA 2D7FA 5BNOA 4AYUA 2LTNA 1MVEA 5FZKA 4RS5C 3OB8A 3BOWA 4ZPIA 4E4ZA 2DVFA 3POEA 4FCAA 4QGMA 3UT0A 1LAJA 2ZX4A 1DIWA 4P9XA 1FV3A 2YPDA 4LBOA 2RG4A 1G9CA 4EWAA 2D3RA 2J1VA 3HNYM 5D8AA 5JI7A 1NUKA 2AUYA 2ZGOA 2WNUC 3BB6A 3ES1A 2JKXA 5ACA2 1ZZ6A 2RE9A 5T5LA 4CEWC 1XNDA 1C8M1 4OHWA 5FK7A 4UFMA 1W3VA 1UY1A 2WNVB 1ALYA 3LEGA 4ARYA 3FL7A 4FAGA 4N53C 2FMYA 2WWSA 2TBVA 2XWJB 3OGSA 4W6XA 5DMYA 1UWWA 4GMP0 1V00A 1RVF1 4KWJA 2X5IB 3JQXA 1GANA 4AI3A 4ASKA 4MZUA 1AR72 4E4HA 2ZMKA 3HT1A 3K51A 4GJZA 4BLIA 3WP4A 2FDGA 4CU8A 1V6MA 2XB6C 5DUUA 3T0BA 3L9JT 4B1MA 4E27A 2GNTA 1PK6A 2CL2A 1MQTA 2VZSA 3GJBA 4GB32 3OCPA 3C2UA 4LMFA 3AJZA 4QX0A 3ZXJA 1IZ3A 4I09A 4YFWA 1FNZA 2B45X 3M1HA 5T52A 3K75B 4LNVA 4DY3A 5KXEA 1ND3B 3QD6A 2EIDA 1PGSA 4DO0A 1YLLA 1WD3A 4N43B 1MZ5A 1HV1A 2Y6GA 2YY1A 5EJ3A 4HVRA 3ZN6B 4ZKTB 4YVWA 5DAXA 4NHKA 3D0SA 4YZ1A 4BQ1A 2D97A 2Y6HA 4BXFA 2JIJA 1DZTA 5A1LA 1YQCA 4GWNA 3MW3A 1B35B 2Z69A 1EV12 4WM8C 2GAUA 2EIEA 3FJSA 3MV01 3VBSB 2EALA 4TN7A 4MXVA 3I59A 4K3UA 5L7OB 4TZDA 2VW1A 5BNNB 2PTMA 1PO12 1UIJA 3OY8B 2WYSA 2VBBA 3ZYFA 2FDIA 5H9QA 5FJKA 3LZZA 2IFWA 1L7RA 4F83A 3U4XA 3MUY1 3ZYHA 3H8UA 1JW6A 2HWF2 5BYNA 4RFRB 2WN2A 3KGLA 1AX1A 1PVC3 3KVAA 5FDBA 2PELA 1W90A 3ES4A 1LHOA 2ZMNA 4DXRA 2IZWA 5K9YA 1X33A 3D82A 3WW2A 4AEMA 5FOBB 1ENQA 4JKKA 4TYSA 4BOWA 4XF0A 3TEWA 1BCXA 2GSYA 3T09A 1QJX1 1W2UA 2XG3A 5FYTA 4YGBA 2XKOA 3WEZA 2RMU1 4C91A 5C9AC 2E33A 3SH3A 1JH5A 2C6SA 1QXJA 5BUVA 2CGPA 1EV13 1PIV3 3MW4A 4OUEA 4QX7A 4P5HA 4Q4V3 3PURA 3I49A 5JOXA 2PLV2 4MXWA 4TLGA 3I4IA 4A6SA 4RR3A 4PLNA 3RYKA 4ZZ8A 3VZOA 1KDMA 2VBPA 1UOFA 1IOAA 3VBHB 1F15A 5FZCA 1W8FA 1J84A 2AACA 2QE3A 4E8DA 1VBC1 2ZGKA 1GV9A 4LHSA 4Y1YA 3O0WA 1OQ1A 4K9SA 2WBKA 4GAZA 2VZ3A 1VRH1 1O91A 1SLCA 2FCTA 1VAVA 3CDZB 1SFYA 5KHJA 1O59A 3FN9A 4UF0A 3VZKA 3QACA 1Q43A 5IAVA 3ZLIA 3IBMA 1I1EA 1S55A 1QNWA 1ULFA 2WL1A 4WM7C 3LF7A 2ORZA 4WM7A 2VU9A 3TEXA 3RI9A 2HEVF 4IEXA 1LECA 4S2DA 3VBFB 1SPPB 3NJXA 3K4AA 3PJYA 1H8TC 2D40A 2ZGTA 3H50A 5FLHA 4OI1A 3UL2A 4A42A 1GP6A 2YYOA 3ZFGA 1C3HA 5FZDA 1LEDA 4AR2A 4D6QA 3OEBA 5JMOA 2Q0AA 1O3TA 1EY2A 1HN0A 4YVWC 2ZGNA 1CZSA 4H3WA 3W21A 2PLV3 3AB0A 4XJ9A 1NCQC 3VHOA 1Z7S2 3GZAA 3VDAA 4YSFA 4FTEA 3POYA 2MHFA 4XFBA 4HONA 1MS5A 3MIBA 3BTYA 1LRHA 2XVGA 3KCYA 3VDCA 1UW8A 4XC9A 1UF2C 1K5MA 4LBLA 2NPIA 4NHLA 3FHAA 3ZMOA 3AMMA 1RUF1 1D2SA 3DYMA 3HMYA 3RMXA 3FLTA 3GM8A 4K7JA 3H3LA 3N9QA 2NZ9A 4HK8A 3KQ4B 3URFA 1LU2A 1ZA7A 1QJZA 5L9RA 2D98A 3LDBA 4LQRA 5FPBA 1PX4A 2A6VA 3NAPB 1SLBA 3RZZA 3AZVA 4KWLA 5J09A 3GJAA 4H7LA 2ZKLA 4IL7A 3T2QA 4RQPC 5JOZA 5DQ0A 4CEWA 2I45A 1TMF1 3AKPA 4LBNA 2B9VA 1YNAA 4COWA 3BCWA 5FZ7A 5C8CB 1GNHA 2JDYA 1HB2A 2VO5A 2HWE2 4IEOA 4OLLA 2PHFA 5D8AC 5JI9A 2XXZA 3O12A 1K45A 3I7DA 4R4ZA 1IG3A 4P9LA 1CESA 5DZEA 5FZOB 2ARAA 1W6NA 1AYN2 4L2NA 2R073 2YV8A 4NUBA 5GALA 3WF0A 2A70A 1AYM1 2WNUB 1ULCA 1NCRA 3A22A 1MZEA 1W6PA 4K1YA 2O8QA 5T55A 1G86A 2Y38A 3UK9A 1S0EA 2QQMA 1A34A 1EAH1 4Q4W1 5A7PA 1S0FA 4RR3B 4QQ2A 3GZTB 1LHVA 3H1YA 3VL9A 1D7PM 1NQJA 4QQHA 1QJFA 1XQNA 3LFMA 3PIJA 4QWNA 4QXKA 3J9SA 1EP0A 3IDCB 3IDEA 4P5YA 2PHXA 5FJHA 1XNKA 2G1MA 2ZA9A 1HJFA 2HBTA 4IEPA 1JUHA 1OOPA 3MLKA 1KEXA 1W6OA 4P08A 2JG9B 2E7TA 2GH2A 4DXTA 4K1ZA 5GLVA 1W2TA 2XUMA 2FBEA 1D2QA 1UU6A 3A23A 5T54A 1NCRC 1NX9A 4OFGA 2J1SA 4I3PA 1E5RA 3RDIA 4L92A 1CIYA 2O0OA 2R072 4Y1XA 1RUF3 4PQ9A 4W6YA 4AVSA 2CSGA 1YYNA 5AC92 1QKQA 4KI5M 3T2OA 4CP9B 4GMP1 3GALA 3R05A 5ACA3 4NO4A 3SEPA 2AREA 1AR62 1AXKA 1BBT1 3F2ZA 1K3IA 1LHUA 1RUC3 3U78A 2JD4A 1R082 3MBWA 4LBJA 4NMIA 2RJ2A 1JTZX 2BERA 3N4MA 4CCCA 3ZKYA 4WM8B 2QZ2A 5A7SA 4YFZA 1BHGA 1WLCA 3HJRA 3G7DA 4AAXA 4LIUA 5A6XA 3ZPYA 5BNNC 5LWBA 5FR3A 5ABJC 2A6YA 2D6LX 2XQRA 1E57A 3AK0A 3GBWA 4MLOA 5FIXA 2WAAA 4KWUA 1ZREA 1BYHA 4FXGB 1YC61 4Y4YA 3OUIA 1U5XA 4UW5A 1LR5A 2EIBA 4URTA 4K40A 1RMU1 2Y33A 4K20A 4NHMA 4B4PA 5C3QA 4PLMA 3HQXA 1D4VB 1PGL2 4MOAA 4QM9A 5A80A 1OMIA 3AZWA 4OMCA 1W9FA 2FDKA 4XCAA 5C8CA 1G9BA 5JSRA 1WBLA 3J7HA 3NJVA 5JOWA 2X29A 3JCIA 5F6KA 1DGWA 4HETA 2X5IA 1APNA 5IFTA 1W6MA 2UWBA 1D4M3 4AXOA 3KV4A 4CDWA 2AR6A 4JKLA 2XKPA 1OFSA 1NQDA 3ZXDA 2GU9A 4JGYB 2NMNA 4V2WA 1OC1A 2VECA 3TYJA 5A6YA 1ZVFA 1LOFA 3RWKX 1PMJX 2OZJA 4NIHA 2R042 5C7GA 2NM1A 1OLMA 2QNKA 2WFF1 4CPBD 4IV3A 2VOTA 4W4ZA 5JXHA 1BK0A 4FPGA 4M4RA 3VDDC 4XUTA 2B39A 2ZZQA 1NA1C 3UYJA 4LUKA 4GIQA 3VBOC 5HV4A 3WX5A 1DYPA 3LCPA 3BALA 2WZPP 1QDOA 1S0BA 5FLIA 1PVC2 4YM3A 5HXVA 2VZPA 4Q4X2 4Q4Y1 1RUF2 2VAUA 1KS4A 1AXYA 1JZ6A 1ZZ9A 4RA0A 1SLLA 2A3WA 3EXUA 3OYWB 5CEHA 5I8YA 3H42B 1EAH3 4Q4W3 2ZHMA 4A7YA 3SCFA 2PAEA 1POQA 4AFCA 3O1PA 1UL9A 3H3UA 4BXSV 4D0QA 1S0CA 2KA3A 3AFGA 1GNYA 1ODMA 3K77A 5IVYA 2JXAA 3NMBA 2XDVA 3AYDA 4QPWA 4CUCA 5FXVA 4AW7A 4LO5B 3O1SA 4AEDC 5FKCA 1HRI2 3QH6A 3ZSEA 4EE2A 3P1IA 1GZWB 3RMYA 2BBVA 4D8MA 1AVBA 4D7TA 2ZGPA 1VAKA 5I0DA 2I2SA 5CB7A 1BBT2 3A4UA 3GNEA 1UOBA 4AHZA 4AZZA 3ZFGC 4A41A 2YFZA 3C3VA 1C57A 1CVNA 4HT1T 4MXWB 3TB0A 1OKQA 2XVKA 3WNPA 3NAPC 4CDXB 1S2BA 1RUI1 1SCRA 2H6BA 2GP5A 2WKKA 4TXWA 1WA4A 3BTAA 5EP9A 4NWWA 1AR82 4BQYA 1AJKA 4FSJA 1KJRA 4EQVA 5FTTC 3PJQA 3ZDVA 3T0AA 4ET7A 2O14A 1XE0A 3WG3A 1FYUA 4I01A 4Z2WA 1W0PA 3M4FA 4IV3B 3GCWA 3POBA 5HPOA 3PU3A 5FY8A 4OYUA 4XW3A 5GZDA 1PM4A 5SV5A 1DGRN 1COV2 3OBAA 2W1UA 3JBG2 3WNXA 4EZHA 2WA4A 3NW4A 4HPKB 4QPIB 2DCKA 1E5SA 3T08A 2R6QA 1KXGA 1PIV1 5FYYA 3NNLA 3BODA 1MS3A 4BWOA 4DUVA 1NAEA 3ZOIA 1BVP1 1N1VA 2WIIB 4IGOA 2PAMA 4N53A 1Q56A 4Q0QA 3MICA 4CU6A 3PIGA 4X8NA 1AR61 4Q0PA 4LO6B 2R0HA 1QJY2 5FWJA 2ZKNA 2JG9C 1REFA 1JZ8A 2IXIA 1LOGA 2PHRA 3GYDA 3VZLA 2R30A 3BGAA 3TEYA 4C1XA 2X53S 3LDKA 3ZYGA 2VCAA 1W6PB 3H7JA 1XNBA 1NCRB 2CY6A 2W08A 1ZBE2 1PZ9A 2WNUA 1I5ZA 3ATGA 3MLLA 2XLAA 4XF9A 4XQWA 5CIRA 3NKTA 5FZHA 1W6NB 2ZGMA 4ZHNA 5EPAA 1GZWA 1VBD2 2FHRA 4XHXA 1QJU2 3FBMA 4LLOA 3VV1A 3OUHA 4CCDA 3ZR6A 4CDWC 4Q4X3 1DGRA 1HDKA 2BUKA 5A6ZA 4RS5A 2Q1ZB 3WCSA 3WDYA 1AZDA 1Y4WA 3ZM8A 3KHCA 3VKFC 1U5IA 3VBUB 3OGRA 3U4SA 5JIUA 2ERFA 1XYNA 2ZEZA 2IVIB 1BMV2 4YM2A 3EJKA 2AGSA 3M3OA 5T5OA 4KBZA 4BK5A 3OYWA 1QJY3 1CN1A 2K0GA 1FNYA 3AXDA 2WLPA 3MIDA 4FPCA 3VHPA 3RZLA 5JZGA 3V0AB 3BKZA 3GBFA 3WQ7A 4XABA 2I07B 1GFF2 5FZ3A 3ZYIB 2YUEA 2WS92 2XWBB 5GLUA 3TOJA 2QQUA 1S2EA 2FD8A 5LBFA 2PHUA 2OPKA 3H9AA 4XFFA 3WINE 2UWAA 3Q8CA 1GOHA 5EJ1B 1ND3C 3J4UH 2J7MA 1C8NA 2IXLA 3ZPOA 4EN7B 1NXD1 4ORFA 4ZZ5A 4OI2A 2D5FA 4B4QA 1S1AA 1FPN2 4CP1A 2BDRA 4ES9A 4CDQA 3DECA 1BVVA 1CAWA 2V5DA 4IW3A 3WHTA 4NRPA 3QLQA 3A7QA 1RC6A 2ZHKA 3DPRB 4KG0A 5K8SA 1H6YA 4YZ4A 3U1XA 4CXWA 1W6QA 2Y6FA 1RYYA 1ULOA 4EWDA 3SKVA 1SPPA 5IHRA 2VD7A 1PNFA 2UY9A 2ETEA 2NYYA 4XCBA 3ACFA 1JODA 1EV11 1GOFA 1HB3A 2G9GA 1QQP2 4MVTA 1IPKA 4B7EA 2CGOA 4X8PA 3Q9OA 4NIIA 4NN0A 1YJKA 4WV8A 5FYMA 4IE4A 2QKDA 1S0IA 2IXCA 4RFT0 1O8SA 2P3YA 1Q8QA 4OI4A 2VMDA 2OQ6A 2HBUA 3S0MA 4JZRA 2UYAA 3AMHA 1RUH1 5C4WA 1DFQA 2JDZA 4AOCA 5IVCA 1HQWA 1UY3A 2D6KA 2IVJA 5FYBA 3DPRA 3CHXA 4XJZA 4CCJA 1FOD3 1GZ9A 1OA2A 4RGKA 4UOJA 1G9FA 2R061 5CNAA 3P6BA 1DQ5A 4P9JA 2QCSB 5CISA 3U0ZA 3ETPA 3W5NA 2DTWA 2V72A 4G4FA 3SXWA 4XDQA 2ZX2A 2BWAA 4WBBA 3RFRA 2ZXQA 1WWYA 3HPNA 1PO11 1UXXX 4GMP3 4BQWA 3VDBA 5JZGB 1H1AA 3USUA 4BZ4A 4D94A 4XFGA 5BNPC 3FLRA 1FI2A 2VMIA 2J42A 1VJ2A 3SKJE 4BQ4A 5CAZA 1FMD1 2JG8A 5AC93 1H2MA 3ZFGB 1Q3EA 3M3CA 3JBG3 4YGEA 2V09A 2JG9A 4KU8A 4HMZA 3E6CC 1UOJA 2Y0IA 1XJAA 2D6MA 4GKXA 2Q1MA 1WBFA 1B35A 2LM3A 4TSVA 4YVSB 3RJRA 3AVRA 2RMU2 3MYXA 4M0NA 1W2AX 4QD2A 2B9UA 4JDOA 1A6CA 2W52A 3ZN6A 1FX5A 4XAEA 2Z42A 5JUVA 1CIWA 4N43A 3ELNA 1ND3A 3L2HA 1AX0A 1W8TA 2CDPA 1ZRFA 4UFJA 3PU8A 2WO3A 1RUD2 3POJA 3VBOA 3WVJA 3ZX7A 4AFBA 2WZEA 2I74A 1NCQA 1NZIA 1X9TA 1ZRRA 1LB2A 2RS11 3CIHA 4YG6A 2PN5A 4QPIC 5I0UA 1RUJ1 1H2KA 1SMVA 2VXRA 1VBC2 1J3PA 3O14A 5FP4A 5HCAA 2E63A 3U10A 5F37A 3W5MA 2VCMA 2YC0A 2DV9A 5FYVA 4AQ2A 1LGBA 1VRH2 4AQSA 3HN3A 5J37A 4JTOA 1DYKA 1UYYA 4IDZA 4OQ9A 2XJRA 4EN8B 2JEMA 5FYIA 2EICA 2GNMA 4Z92B 3KV9A 1V6JA 1AR92 1V6NA 3KT1A 4J1XA 1AYN1 4LBQA 3RJ2X 4TTGA 2C9AA 1XRUA 3M7AA 5IWFA 4PI2A 4XVHA 1GP5A 5IJRA 1CGPA 1Q8SA 1ZBA2 1Z7S3 4Q1RA 4XJWA 1BMV1 3X29B 1EUTA 2BEOA 4NPRA 2OQ7A 3U75A 4CSWA 1U0AA 5AVAA 3M2MA 4DQAA 4MGTA 5LRRA 4LJHA 4OZXA 1UQXA 2JIGA 4PDWB 5FZ9A 5EWSA 3AX4A 5FZIA 1QOSA 3UGFA 2Z79A 1D4M1 4XUPA 5E89A 5F32A 3E6DA 3BPZA 4YM0A 4RR3C 2P17A 3VZMA 5F7UA 2QDNA 4QKFA 5JWPA 4XPVA 3RZHA 5C3OA 3AMQA 2VR4A 2OKXA 3MPBA 4HKWA 1JU4A 4HL0A 1L7QA 4MGZE 4B3NA 1SLIA 1GR3A 4RHV2 4IEYA 1CONA 1STMA 1AL22 1JUIA 3OGGA 4K21A 2XHNA 2WO2A 1UMIA 4MGSA 5EQUA 2DBNA 4I02A 5IW0A 1ULGA 1B35C 1GZTA 3HBZA 2W47A 4EWEA 5EXOA 5FZ0A 4NROA 4HLTA 3TAYA 1XNTA 2ZEWA 2EXHA 4C0BA 5CG9A 1I3HA 4Q0SA 1W0OA 1OUXA 3DKWA 1DHKB 1LCLA 2HWD2 1X7NA 4OHXA 3V64A 5JCTA 5LY1A 1QQP1 4AI9A 1AR63 3FZ3A 4META 1UYXA 4MSVA 1S4CA 1VBD3 4H2AA 3H8OA 1K42A 4XJ8A 4AFMA 4OI0A 1ZZCA 1A3KA 1VMHA 2JWPA 5JR7B 4Q8LA 5A33A 5LB6A 1DQ1A 3ROUA 5C6CA 2IXKA 3M3EA 3T2PA 1AL23 3MIHA 1FATA 5LBBA 1QH6A 2OX0A 2WNVA 3OD4A 4AQTA 4JVAA 2YBSA 3ST7A 4AK3A 1WLDA 4Q4V1 4BQ3A 1UYPA 4W8JA 1RUG1 5FZGA 3ZFFB 1YHFA 1LULA 1UNBA 3P3PA 4MADA 5F5IA 3CMGA 5ACA1 5M0TA 3KHBA 4IGQA 4DEVA 5K4LA 1TMF3 2IFRA 3CEWA 5FXWA 5F6LB 1UU5A 1OVPA 3E5QA 2F4LA 3WXPA 4JGYA 1H9PA 3OJBA 2EXJA 3O1TA 2JE7A 4BU2A 1SFPA 3O1MA 4XOGA 1HN1A 1AR71 2ATFA 1RUG3 1A8MA 1MEC2 2ZTNA 4QHZA 2XJQA 4FOVA 4KGQA 4XBQA 3VBFC 4JDNA 3WQ0A 1EYBA 5FYHA 3B9IA 5AVPA 1O3SA 2XLGA 5IVJA 1MPXA 4COVA 2VULA 3VBRB 2ZGSA 1W9SA 4OULA 3I3DA 2D43A 4EYUA 1PO21 1UX7A 4CDUB 4YVWB 5F8PA 1JXNA 4LUMA 3VHNA 1WZXA 2PQSA 2ZGRA 4CEYA 5FLJA 1VB2A 5FY4A 1WMDA 1COV3 1OLRA 2P1BA 3HNMA 5KHIA 2EF6A 4Q4X1 1WMXA 1N47A 1ZRCA 4QHOA 1NZCA 2P4EA 2O1QA 3HIFA 3ZIXA 3QOPA 4EN6B 1N3PA 1C5IA 1TQ5A 1WCQA 2P37A 3AFKA 4MGIE 4AVAA 1F35A 2JE8A 2B7YA 1PK6B 5DUWA 5FFOC 4DNYA 1QXRA 3IDBB 4XEZA 4BYYA 1RMU2 2QDRA 3MIEA 5LEJA 2RHPA 4Y1UA 5CFCC 2YB7A 3PUIA 1M4WA 1R1A2 2R1BA 2A6WA 1GQGA 4CXXA 4NE9A 3JQWA 3VKOA 1YFXA 1JHNA 1QGLA 2VMHA 2LALA 3UKNA 1DU3D 1U5ZA 5DAPA 2BOIA 1BJQA 2WDBA 4QT6A 4CRQA 1X8EA 3KQRA 4BM8A 2JDUA 2UY8A 2VNOA 3AP4A 4C90A 2C1FA 2ZMLA 1QU0A 2RDSA 4IUGA 5J3UA 2C26A 1YIFA 2G4IA 3IN9A 4Y1VA 3B01A 4COZA 1LENA 3IKWA 1CPMA 5FQ0A 5A7NA 2A3XA 5FZ6A 2DBIA 1UZYA 2W1QA 3USUB 4DPNA 1AYM3 3ME2A 2ZEXA 5BPXA 4YARA 3T4HB 4GB31 1LOCA 3LDRA 2YZ4A 3K3NA 4L8QA 4LKDA 1LU1A 1GWMA 1H2NA 1W05A 1W6OB 2JDHA 2UU8A 3MIFA 5FO9B 3ECQA 3LOBA 1OOPB 1EPWA 3JZVA 3FFZA 2ZS6B 1XU2A 4LO4B 4Y26A 4FTSA 4AVVA 4DS0A 1SACA 2KD7A 4A44A 2E7AA 4AWDA 1URXA 3ZKUA 3DYOA 1YFWA 4YW6A 1RUC2 3ACGA 4PBPA 3KCXA 3AC0A 5IK5A 2YU1A 2RJLA 1XU1A 1W2OA 4GWMA 4YZ3A 1CWPA 1UPIA 3OPTA 3NRUA 3PUAA 1MACA 3LKJA 1LOEA 4RGGA 3JBG1 4I2OA 1OD5A 2HWB1 3VKMA 1WCSA 1UU4A 5KHGA 1VPHA 2VW0A 4K6BA 3FBYA 3IPVA 2R16A 4CYDA 3HWJA 4A2UA 1CZTA 1CAVA 2HWD3 1K5MC 5TSWA 5HV0A 1CR7A 3AL5A 2OT7A 4FPLA 4PF5A 3TN93 5A32B 5A70A 1T2XA 3K4DA 4GH4A 2PHLA 3MI8A 5IK4A 2GC1A 2BP6A 2BFUL 1JMUB 2P34A 4RGAA 3GBGA 3RWNA 4YZ5A 4Q29A 3TRSB 3AXEA 1ASJ2 1D0GA 4YW4A 2VM9A 4WVVA 4CCOA 1ZX5A 4RYDA 4CE8A 4QXBA 4OQ8A 4NRQA 2GH8A 1CQ9A 2JENA 3INAA 4E4SA 5BNQA 3BTZA 2Q8EA 4NPMA 5FYUA 3RZJA 2DU0A 2MEV1 1W8NA 3A0KA 4XUNA 4GJYA 5A7WA 1PGW2 4I0WB 4CDQB 2E51A 4JAAA 1RUOA 1OQEA 5CYYA 4K8FA 3OBRA 1IGOA 2QQOA 1ENXA 5F39A 1US2A 4RD7A 1RUG2 2VMEA 4NHYA 1O6UA 2HEYF 4PDWA 1M06G 3DXUA 5FQ0B 5FUIA 3WDUA 1G7YA 1FV2A 3C7EA 2HEWF 3LA3A 1LOBA 2W94A 4Z07A 1W99A 4IGPA 1AJOA 4P02B 1OLME 1H9WA 3W59A 3WW4A 3WLUA 2VOXA 2VUCA 1LJ7A 1VBD1 3NNMA 2H0BA 3JUUA 1J58A 4HN0A 5GLZA 1CJPA 2Q8CA 4Z82A 1VP6A 1BXHA 4RHV3 2ZOEB 1MEC1 4UFLA 2CHHA 4PIZA 5FO7B 4A45A 2VVFA 4XZPA 1GSLA 1O4TA 1SBEA 2JDAA 1W8OA 2C5DA 1OKOA 3OG2A 4CUBA 2HWB3 2JICA 1J1LA 2SLIA 4MHRA 4A3XA 4BJ0A 2BYVE 5H9PA 1OD3A 3WDTA 1PO22 3IB3A 1IS4A 1TME2 4DIQA 2VUAA 1PMIA 3POFA 4I30A 1ODNA 4LLFA 4E2QA 4Y4RA 1A78A 1BEV2 2YFUA 5FXXA 1Q8VA 1Z78A 3IT8A 4HK9A 5FYZA 5LASA 4CTEA 5T5PA 4D7SA 4XE9A 3RYRA 4FFGA 1WLWA 2WFPA 3UKTA 2VG9A 4SBVA 1S2KA 1LNSA 4ASLA 1WGPA 5DDJ1 2VMCA 2PHTA 4YVSA 3SH5A 1SQ4A 1VMFA 3NNGA 4Y20A 4W50A 2ZAHA 1YXWA 2YU2A 3IIAA 4YGCA 2YBKA 2XMLA 3I3BA 4DINB 3S30A 3BPSA 3ZO0B 4A7ZA 2PYTA 3E1F1 1YQ6A 3NVCA 3PUSA 2XJUA 3T3YA 3VBHC 1JYNA 1PX3A 2E7QA 3ASIA 1SDDB 4FPHA 4O61A 1DYOA 1OT5A 1TMF2 1J83A 3WG2A 3ITQA 1IS5A 3VKLA 2X09A 3MF9A 3FMGA 1OQDA 3OPWA 1VMJA 4JQTA 4X6QB 3VL8A 2RS33 3I59B 1HKDA 2PFWA 4AEDA 5FOJB 2W92A 5FPUA 1YFUA 4ZS3A 2KR2A 5KBFA 1CJDA 2BV4A 4ISRA 2PXJA 5FMOL 1QH7A 4JGZA 3S7EA 1HB1A 5E1RA 4AHYA 4I0BA 3MUZ1 4LBKA 3EBRA 5CFCB 2V73A 2XR4A 1FMD3 2ZEYA 4P9GA 3U37A 4N9HA 3OF1A 1ZBA3 1FAYA 5I0RA 5JR2A 1RUE3 4N7IA 4XILA 5T5JA 3ZN5A 3HQRA 1RTVA 5F5CA 3WDWA 1OA4A 4HFSA 1G6NA 4DMIA 1UZVA 3OBZA 4XTMA 3QCWA 5F5AA 3VHRA 4WVZA 5FY7A 4LEJA 1W28A 4LK6A 3DL3A 4IV3C 5BNPB 1ASJ3 1NXMA 1WCDJ 3SH4A 2JX9A 3WW1A 1KFXL 3ZMNA 3I2KA 5A3UA 3N9PA 3KSCA 4MGYE 4OUMA 3BUCA 1KJLA 5D2AA 2XLFA 3AVSA 3KZ4C 1H6XA 5IVBA 2DUPA 2ZHLA 2BU9A 3IMMA 2RS32 5GLWA 2FZ2A 2RS52 5FRAA 4BISA 4XURA 3TWIA 4Q2FA 4Q8KA 5C8WA 3CJIB 2RM22 5AC91 3BVCA 4LR4A 1RUH2 4RN5A 3VKNA 3ALQA 1YUDA 4QGLA 4YVSC 4MH0E 2R0FA 1HXS3 1WCKA 5IATA 1CZVA 4FPKA 3D8CA 4OVEA 4YW7A 2WFF2 3ZVXA 3IDAA 3QBQA 4YZ2A 2F17A 4F8AA 1YCIA 3AP7A 4UW3A 1XE7A 5EV7A 3OTFA 4YW5A 5D8AB 1RHI2 5CKNA 2EAKA 4KH9A 4LKEA 4CUGA 4YGDA 1C8M2 2MEV2 2YGMA 5LA9A 4UFHA 3AZYA 3H3ZA 2BW8A 1JYCA 5JIAA 1XE8A 1MQTC 1SDWA 4KQ7A 4OHZA 1XSQA 3HT2A 5GZGA 3GDBA 1IS3A 4W6WA 5A7WB 4AL9A 2D3PA 1KGYA 2CYFA 1RVF2 4LOSA 5JVVA 5HCFA 5T50A 2A71A 3LGRA 4S2GA 4GQ7A 3I2JA 4FPEA 3M8LA 2Q8DA 4QMAA 5BNOB 3AYCA 3H7YA 4E2SA 2BNMA 4MV2A 1N1SA 4Z1VA 1W8WA 3IAQA 5L73A 1RUH3 5J36A 4FP3A 4LE3A 5FZEA 1WA6X 5FZLA 5I0TA 3UETA 2KXLA 3J26N 3VBUC 3VBUA 1OF3A 1IG0A 4YW3A 1MZFA 1ND2C 4LBQD 2DYCA 3MZHA 5DDJ3 2HWC1 2CDOA 3RSJA 5DG1A 1I9RA 1HV0A 2AZ5A 1SLTA 3WF1A 4B7KA 2JG8C 2XONA 3C8XA 2QJVA 4MGKE 3ETQA 2VOVA 5EYYA 1DQ2A 2DVAA 3KCCA 4KNCA 4PDWC 2AEYA 3PUQA 1ZBE3 3AZXA 2GNBA 2RR12 4QB1A 1LEMA 5IUQA 3PNAA 3AM2A 2LROA 3K48A 4PHZA 3MPPG 2J1EA 2KM2A 5IVVA 3LIGA 3FHIB 1L7LA 4CCKA 3T30A 5FMDA 1AL21 3H1WA 1UAIA 2Z2SB 1JYXA 4PQQA 1MR5A 3V56A 3CO2A 1YI7A 5CG8A 2L9LA 3MFCA 1AR81 4Y22B 4JGZB 4XAAA 3RYPA 1RIRA 1H4GA 1R091 3HNBM 1J1TA 2CGNA 3O0VA 1OPMA 4FOQA 5J96B 2RS53 5JXJA 1HRV1 4XIOA 1IPSA 3LIHA 2E26A 4XDPA 3KS7A 4FQZA 5BXXA 3WNOA 1V70A 1UZWA 5FXZA 1UYZA 2ES3A 3KV6A 3SLIA 3SHRA 4LXLA 4ASMB 2ZPXA 3DXTA 3VUOA 1ONAA 4XXPA 1DQ6A 3KVBA 1C4RA 5CFDA 4LIVA 5GKAC 1Y7BA 4I3GA 1FPN3 1LHNA 1YEWA 5BNNA 1CAUB 2J22A 1GYKA 3ZFFA 3BU7A 4HVOA 5B4XA 2GP3A 2WO1A 2IUWA 3W20A 2CAVA 1RUJ3 2CAUA 2MNGA 3KMHA 2W0XA 4WZCA 1JYIA 2W68A 2IC1A 3D6EA 1NYWA 3E97A 1YQ5A 3I2FA 3S6PA 1QJX2 4BHPA 1H1MA 4YPJA 2QQLA 5FY9A 3ZFFC 5HBAA 4AGVA 3EMRA 1KDKA 3RVHA 5SV8A 1EUUA 2QQJA 1O4YA 2WZR2 3E5UA 2ZCWA 4J1WA 4XFIA 5C4WB 2WQ4A 1Y3TA 4FAHA 4NRMA 4QX8A 1GKBA 1POV1 1VB4A 4LE4A 4DRRA 2QVSB 5FV3A 3WUCA 4ZONA 4CDUA 4N9IA 1NA1B 4PF1A 1V0AA 3VBRA 2CWSA 3KT4A 3T2TA 3O7OA 1GUIA 4O9GA 3TNPB 2JKBA 4E9KA 2AYHA 2QFEA 4CZSA 1W9TA 1SEFA 2DCYA 3HVDA 4O65A 1H8TA 2GC3A 3BYWA 2GC0A 2ZABA 4B8EA 4D69A 5L9VA 4CCNA 1Y9MA 3VBRC 3DF0A 1HRV3 1XXNA 2C24A 2WC2A 2X10A 3ILRA 3NV2A 5ANQA 1PMHX 2GNDA 3ILFA 1CAWB 1MVQA 2VQTA 5FP7A 2H6CA 4N8MA 4KL1A 3O1VA 5KHKA 1RITA 1BKZA 3I3MA 3ENRA 4JDMA 3V65A 5L36A 3LSDA 4XDOA 5FO8B 1UO9A 2HJIA 3NSTA 4NPLA 1UPSA 1C8M3 4LOTA 4Q0UA 1DLLA 1RHI1 3HR9A 3B02A 3PTRB 4NHXA 1RL3A 4OCTA 4XHBA 4AF9A 4CEYC 4E8CA 4WVMB 1DP0A 4LHKA 3ZYPA 1AF9A 3ZFEC 5EZWA 2A6XA 4HANA 1QJU1 3POIA 3F95A 1F5FA 4P14A 1LESA 4UW4A 4CDXC 3D5OA 2ZAAA 2A5ZA 5HCHA 2VZ1A 2J1TA 1O7FA 2XJVA 4QM8A 3ILNA 3NV1A 4M00A 5LBEA 3PTYA 3NV3A 4AHWA 2QQIA 5DAVA 2WWJA 3RPQA 3FE5A 2AH2A 4QXCA 4R8HA 1C5HA 3N9NA 3RG0A 2FZ1A 4HSJA 5EYXA 3PMEA 2WT0A 4QPGC 4EV0A 1VR3A 1MZ6A 2ZGUA 3UESA 3OEAA 3WNNA 1O5UA 2UURA 2VNVA 3CU7A 3LWCA 4GULA 4LKFA 5C3PA 2A1XA
chains in the Genus database with same CATH topology
2YXSA 1OOPC 3FUQA 1QF3A 2GMPA 2YROA 3GHNA 4XFAA 4XF4A 2YGLA 3USSA 2WNVC 4JV4A 3ACLA 2DFBA 2BNOA 5JOYA 3B5LB 2A7AA 3LOIA 1WLTA 3V0BA 2X5IC 4H14A 1XYOA 5KC6A 1OI6A 1GZCA 1LHWA 1ND2B 4JRAA 1PZ7A 5CU1A 3MLJA 4KBBA 4LULA 4IQPA 2DU1A 3ZXEA 3RRDA 4AFDA 2JG8B 4Y5Z0 4HPKA 4HKOA 4QPIA 3OD0A 1HRV2 2CNAA 4YYOA 1V6LA 2XJTA 4WZFA 5LEKA 3ZXAC 2HWC3 1A8DA 3EHKA 1W39A 4OHYA 3NJZA 2HWB2 5LK7B 3M70A 5JPMB 4ZU5A 4LO8A 3TN92 1MEC3 4DY5A 4BPZA 5DUVA 4JGZC 4CDXA 2EXKA 2XHKA 2WT2A 4RSUA 3WG4A 4AFAA 4O9EA 4DXZA 3N7MA 4XFCA 3JD71 5JDBA 2A75A 4A7KA 3N36A 4XBLA 4CP0A 1R093 1ULDA 1LTEA 4F7ZA 5F1RA 1ULEA 3N7LA 5CVRA 2FMDA 1X8MA 5I91A 1ZM1A 2OW4A 4IEQA 1DQ0A 2OIIA 4QGNA 2TNFA 2Q8OA 3IWZA 1VBC3 2ZBJA 4YG3A 2P3IA 2HKXA 4R4XA 4UBHA 2EVXA 5GZFA 2ZJCA 3FLPA 2GN7A 1UD1A 1UIKA 5E88A 3D0JA 1GLHA 2K9ZA 2VOWA 1QDCA 5C9AB 2BWCA 3O5SA 5J7MA 1W6QB 4PBOA 3UV9A 4P9YA 1ASJ1 3THTA 4BMBA 1KQRA 4FBFA 2RMU3 5AFBA 1DGWX 3WQ1A 1ZNPA 3B69A 2R1DA 1XYPA 2CWMA 3WR0A 4QPGA 1D4M2 2MEV3 1DBNA 2XL7A 3BIWE 1WW5A 2D44A 4FT8A 4M3CB 5FBZA 1WD4A 4U36A 1H30A 4YLZA 4P9WA 1CX4A 4FPJA 2XJPA 1HXS2 1VBE1 2NQYA 3WDXA 1LOAA 2E53A 3ZFEA 1HLCA 1W6MB 3N3HA 4QPYA 4JTNA 1RUJ2 4QQLA 1HRI1 4FP2A 1FOD2 5A33B 3B7MA 4C0HA 3H1MA 4M3CF 2JE9A 1PO13 3JD73 4XMIA 3WOGA 1POV0 1VIWB 4L99A 1D0HA 2FQPA 1BK1A 3AKSA 3IPVB 4MX3A 4IERA 1AR93 4R52A 4Y1ZA 2RJKA 2ZX0A 3RNSA 3MDPA 3KGZA 5KXCA 1G9AA 5T3NA 2GMEA 3TBDA 3L2YA 2PHDA 1HRI3 1IPJA 1NLRA 1Q5OA 5D1IA 4CP2A 4IETA 1O3QA 3UJQA 1H0BA 1VBB2 1H4HA 1X36A 1DGLA 3BOPA 3ZFEB 2PLV1 2WLQA 3ZYJB 4AHXA 2QQPA 1AL0G 2TEPA 4QX5A 4COYA 2IXJA 5FREA 4BH9A 1SBFA 2K2SA 1ZA4A 3VZNA 4Q1PA 1OLQA 3NKGA 4LA2A 3E5XA 1COV1 3N7KA 1H1IA 1Q8PA 4XIKA 2AENA 5B2GB 1IS6A 5KWRA 2HWF3 4QPGB 4Q26A 3I54A 3AKTA 2UWCA 3ZSKA 1IHMA 4IV1B 1CPNA 3R6SA 2GC2A 4FPOB 4R9DA 2E9QA 1LKNA 3GHMA 3OGJA 4LT5A 1R1ZA 1N3OA 2HWF1 1Z0HA 1VBB3 3SITA 4COUA 5JLVA 1YWKA 1PVXA 4RQPA 3ZXKA 1XNCA 2WQZC 4AVTA 3HAGA 4G3YC 2XPJA 2DCTA 4XXAA 4RS5B 1VRH3 5GM0A 3POSA 4ZXKA 2V5YA 1ZRDA 1C1LA 1PIV2 2RS31 2R49A 2LUWA 3PVNA 5KC5A 5DXDA 1QQP3 5LK5A 3WP6A 1S0JA 2RM21 3FUOA 2DCJA 2VH9A 4AI0A 2TUNA 2QUOA 2ARXA 3JD72 4S2HA 3ZYRA 5IT6A 1UKGA 2BVBA 5F5QA 1UX6A 4JC1A 3W58A 3LA2A 1R1A1 1DDLA 1KRIA 5BNOC 4N53B 4WVWA 1AR83 4N7UA 4DZGA 4FVVA 1UMZA 3KB5A 2WJSA 2HWE1 4R9CA 2RS51 3APBA 2WS91 1AXZA 2BVVA 2RR11 4IXLA 4MUVA 5ABJB 3PLQA 3AMNA 4KG8A 2F6BA 1Q8OA 4QU2A 4AVBA 2NMOA 2Q5TA 1UKRA 1FPN1 2HWC2 4HN1A 5CBLA 4BIFA 2DVGA 2VPVA 3SISA 1LGNA 4OHVA 3AZZA 1ZZ8A 1GBGA 4HSLA 1N1YA 2WFF3 3E6BA 2D3SA 3VLBB 4N90A 4B4RA 3VBSC 1JBCA 3WDVA 2B42B 2DVBA 5L7OC 2NLRA 4AQ6A 2P2KA 2JJ6A 4H55A 1AHSA 4IESA 3D4KA 3WP3A 3QH7A 1DZRA 2ZHNA 5JMCA 4JGYC 1REDA 1F5JA 1R092 3KM5A 3O0XA 1KD7A 3SMHA 3WD5A 4BCUA 1C28A 4AI2A 4M0HA 2ZACA 3CLPA 1NA1A 3N7JA 1AYN3 1SBDA 1F31A 2XGXA 1O5LA 1Y9QA 3VDDB 4PLOA 1R081 2A6ZA 4IEZA 2WT1A 5FPZA 1CD3G 1NY72 4AE2A 2PQQA 1O3TA 4UBGA 2Y0OA 3WZ1A 2ZZJA 3WY6A 1RUD3 2OYZA 3JB4C 4KGGA 3VN4A 1WMEA 3AP5A 4YW2A 2NP0A 2P3KA 3LB9A 4YM1A 2B5HA 4FPYA 1RUC1 2MPFA 4AEDB 4GH4C 4AG4A 3AP6A 4FQ4A 1WW6A 3PMSA 2BTVC 2WZR1 4X6RB 5KXDA 1PK6C 2VMGA 4HBNA 1TNRA 5F9TA 4QQPA 1NE4A 2ENRA 3OY8A 2IWGB 3CJXA 1H8TB 1WW4A 1NG0A 3VBSA 5L7OA 3J8F3 1FMD2 4FXKB 2B8MA 2D6NA 2R041 1PNGA 1DZQA 1R083 5GJ6A 4RL7A 5A3MA 1B09A 1NCQB 2GDFA 2ARBA 5IK8A 5DG2A 2VNRA 3SCGA 4Q27A 3LSEA 5FMOS 1WUVA 3DUIA 2WSUA 4Y24A 1MS1A 3ZSMA 1TME3 2O8OA 2ET7A 3VBHA 2DCZA 3WV6A 3PVOA 1N3QA 1NOVA 1PGW1 1WW7A 4YNIA 3HD8B 5JSOA 4IV1C 3U07A 1VALA 1ZZBA 1DF0A 1AR73 4WM8A 4YW1A 1RUD1 1AR91 5EFUA 2YDEA 1RGSA 3AYAA 3WP5A 4EROA 1KITA 4JRLA 2YPJA 3J8F2 1ZBA1 2WA3A 4RQPB 3AYEA 5E8AA 5HCBA 5A3LA 4XF3A 5FPXA 2WNEA 4XTPA 4ATFA 4XFHA 5FAXA 1GNZA 1G8WA 5K0UB 3LAGA 4EJRA 2VVDA 1RUNA 3R0RA 1UN1A 3RI8A 4GB33 4FO9A 1K5MB 1PO23 2XJSA 2B46X 4FOYA 4R9AA 4Z8BA 1HX6A 4JQRA 4RHV1 2BGCA 3OPZA 1HW5A 2WSVA 3ZXFA 3V0BB 4ZU7A 1U12A 1SFNA 1TME1 4C1WA 4NWVA 5I93A 2JECA 4Y22A 3AMPA 3SNMA 1BEV1 5JPNB 4R9BA 2XL9A 5H9RA 1PVC1 4JCKA 4MYEA 2ILMA 1QWRA 3ZN4A 1F8VA 1VAMA 3MF6A 1X50A 4CDQC 2BPA2 4FPFA 1UCXA 1VBA3 2NN8A 3WCRA 2RR13 2VY0A 3ZIWA 1ENSA 2DVDA 3PVBB 3WT3A 1ENRA 3IMNA 1LGCA 1TE1B 3UKVA 1EPZA 2OA2A 4INDA 4Q4V2 1KS5A 4ITCA 2ZX1A 4AGRA 1JN2P 3DV8A 4IEUA 3DPRC 2EA7A 2ET1A 4NVPA 1MS8A 3R4SA 5J48A 4PJYA 2DFCA 4AEKA 4QQOA 1V6OA 4LHLA 2VVEA 3GZUC 1X82A 4M3CA 3CL1A 4XQDA 3S7IA 5K7PA 2D5HA 4IEVA 4DFSA 2BFUS 1G9DA 1RUI2 4L9BA 1GQHA 1NLSA 1QY4A 3M3IA 1F2NA 1V6KA 3B94A 3T1LA 4L97A 3V0AA 2DUOA 5ABJA 5GZEA 2W39A 3WUDA 4GA9A 4W65A 1ZZ7A 1AUYA 1BEV3 4M01A 1VBA1 1IKQA 2ZGQA 3AJYA 2GN3A 1JOJA 2DUQA 4LBQB 4WM7B 3VBFA 4KU7A 1Z7S1 1FT9A 3M3QA 4GALA 4U2AA 1V6IA 4F3JA 3R4DB 1QHDA 3WW3A 2C0ZA 4LA3A 2Q30A 4XYXA 3ZSLA 5CFDC 2DF7A 2N7GA 2OZ6A 3OBTA 2GALA 3JU9A 2BQPA 3CNAA 4HVQA 4AVCA 1RUE1 4BLJA 4NR1A 3VBOB 1HXS1 1VBE2 4FOWA 5JZGC 2SBAA 4XBNA 2XBO1 4J6GA 1WMFA 1BQPA 1RJ8A 4CEYB 1ZBE1 1V9U3 2H0VA 2Y26A 3FFQA 2ZX3A 4UW6A 4ES8A 3RQ0A 1QOTA 5CFCA 4XQ4A 4HKLA 1TEIA 5LRSA 3I8TA 4AEJA 1V9U1 4OUSA 1OA3A 4IEWA 3LA7A 4TLFA 2RS13 3VZJA 1H8VA 4H7MA 3CF6E 3J8F1 2R071 1S0DA 3ZSJA 2X8KA 1NE6A 2D6PA 1QNYA 1HQLA 1J3RA 5C8CC 1YRZA 3THPA 1BZWA 2VNGA 1S0GA 1VBB1 3MFAA 2BNNA 4G9SB 3WHUA 4KWKA 1ND2A 1YI9A 2F4PA 3NO8A 2D6OX 1OFNA 2CV6A 1TNFA 4YG0A 2A73B 2R062 1PM7A 2EIGA 1AYM2 5I0SA 3CJIC 2PAKA 4B29A 1L3JA 3FWEA 4PIXA 2XH6A 4XETA 4EN0A 2RM23 3U11A 1EAH2 1U5YA 4Q4W2 4ZU4A 5KXBA 4LO7A 5H9SA 2WZR3 4Q0VA 4GKYA 3IM0A 3GF6A 3WG1A 1FOD1 3NV4A 1RINA 2D93A 1H2LA 2XBO3 4ISQA 2Z5WA 5JAXA 1CAVB 1MQTB 3VDDA 5BNPA 3DN7A 4BA6A 5L19A 1VBA2 3ZDSA 5DZFA 3KT7A 3N35A 4M3CE 4CEWB 1REEA 1GICA 4E4DX 4XF1A 1O4ZA 1POV3 1LOFC 2R063 3P3NA 4V1PA 3W9AA 2E6VA 1O3RA 3NAPA 4P9IA 5GLTA 1HIXA 1YIPA 3RS6A 5GZCA 1J3QA 5DZGA 3EO6A 2OVUA 3T1MA 4WVMA 5I8TA 3AKQA 1FXZA 4EN9B 1F9KA 1RUE2 1QJX3 3H0OA 2XBO2 2RS12 1MS0A 3MEPA 1YJLA 2WS93 4QHBA 2P3JA 1MS9A 2UYBA 2YHJA 4AGGA 4Q4Y2 1OHFA 3FX3A 4BE3A 3KLSA 4N43C 3JB8A 4CDWB 1QXPA 4LHNA 1V9U2 3MW2A 1OPOA 3ZXLA 5K0UA 2DTYA 5C9AA 1KFUL 1BBT3 4S2FA 1R1A3 3CJIA 3AP9A 2VQAA 4NOTA 3B93A 1PGL1 2A3YA 4BMEA 2DURA 2XVLA 3G6JB 3MIGA 3PHMA 4BIOA 4FTBA 2EAAA 1RJ7A 3R4UA 2HWE3 2R32A 1SCSA 1C1FA 1UZZA 2PA7A 1SLAA 5FCCA 2VQ0A 1CAXB 5J98B 3PVEA 4HZFA 3VGIA 1HQNA 1PZ8A 3I2DA 1PHMA 2HYKA 2OUJA 2YMZA 1RVF3 2VOKA 3POWA 4AI8A 5HI0A 3TNQA 4DOUA 5C33A 1OSGA 1CAUA 2G9FA 1AX2A 1RHI3 4XJAA 3SCHA 4DRVA 5IK7A 5CFDB 5DDJ2 4CDUC 2EXIA 5C4WC 1QMJA 4LTAA 5BV6A 4LBMA 1T6GC 5I8SA 4ONUA 3A0NA 3B9CA 4IV1A 1RUI3 2QZ3A 5AFEA 1J59A 2IXHA 4GXLA 4DB5A 1RB8G 3TN91 1RMU3 1Y43B 3HN1A 3NL1A 3B00A 4D3WA 4PCRA 5BY5A 4Y20B 5KHHA 2WINB 4Q4Y3 3DGTA 2DWRA 1QJY1 4PIYA 5E16A 1LODA 4SLIA 1NY71 2R043 4XMAA 2VUJA 3B3QE 2ZGLA 1N1TA 1MS4A 4AI1A 1QOOA 1IQAA 2GZWA 4GH4B 5CADA 1YFYA 4XJUA 4I0AA 5A32A 1CAXA 1DG6A 2GMMA 2VW2A 1VLNA 4D7YA 4L11A 3MGUA 1I6XA 4YRDA 2CTVA 1IKPA 1DQ4A 3KD4A 1YO8A 4E2GA 1QJU3 2HWD1 2OUHA 2PHWA 3NWKA 2VGDA 5CA6A 4ATEA 1VBE3 2Q4SA 3EQEA 5DUXA 3FC0A 4TWTA 3ZXGA 3UJOA 3AKRA 1ZYBA 4UXAA 2D7FA 5BNOA 4AYUA 2LTNA 1MVEA 4RS5C 3BOWA 4E4ZA 2DVFA 4QGMA 4FCAA 2ZX4A 1DIWA 4P9XA 1FV3A 4LBOA 1G9CA 4EWAA 2D3RA 5JI7A 5JSPA 5D8AA 2AUYA 2ZGOA 2WNUC 3BB6A 3ES1A 5ACA2 1ZZ6A 2RE9A 5T5LA 4CEWC 1XNDA 1C8M1 4OHWA 2WNVB 1ALYA 4FAGA 4N53C 2FMYA 2WWSA 2TBVA 2XWJB 4W6XA 4GMP0 1V00A 1RVF1 4KWJA 2X5IB 3JQXA 1GANA 4AI3A 4MZUA 1AR72 2ZMKA 3HT1A 3K51A 4BLIA 3WP4A 1V6MA 2XB6C 5DUUA 3L9JT 4E27A 2GNTA 1PK6A 2CL2A 1MQTA 4GB32 3OCPA 3C2UA 3AJZA 3ZXJA 1IZ3A 4I09A 4YFWA 1FNZA 2B45X 3M1HA 5T52A 4LNVA 4DY3A 5KXEA 1ND3B 3QD6A 1PGSA 1YLLA 1WD3A 4N43B 1MZ5A 1HV1A 2YY1A 5EJ3A 4HVRA 3ZN6B 4ZKTB 4YVWA 4NHKA 3D0SA 4YZ1A 4BQ1A 2D97A 1DZTA 4GWNA 3MW3A 1B35B 2Z69A 1EV12 4WM8C 2GAUA 3FJSA 3VBSB 5L7OB 2EALA 4MXVA 3I59A 4K3UA 4TZDA 2VW1A 5BNNB