2AUYA

Pterocarpus angolensis lectin in complex with the trisaccharide glcnac(b1-2)man(a1-3)man
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
240
structure length
240
Chain Sequence
EDSLSFGFPTFPSDQKNLIFQGDAQIKNNAVQLTKTDSNGNPVASTVGRILFSAQVHLWEKSSSRVANFQSQFSFSLKSPLSNGADGIAFFIAPPDTTIPSGSGGGLLGLFAPGTAQNTSANQVIAVEFDTFYAQDSNTWDPNYPHIGIDVNSIRSVKTVKWDRRDGQSLNVLVTFNPSTRNLDVVATYSDGTRYEVSYEVDVRSVLPEWVRVGFSAASGEQYQTHTLESWSFTSTLLYT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the recognition of complex-type biantennary oligosaccharides by Pterocarpus angolensis lectin.
pubmed doi rcsb
molecule tags Sugar binding protein
molecule keywords lectin
total genus 52
structure length 240
sequence length 240
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00139 Lectin_legB Legume lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2auyA00
3ENRA 1EPWA 4ASMB 1R1ZA 1FV3A 4YZ2A 3PVOA 2PHXA 1SLBA 1J1TA 2VY0A 1GKBA 3WUCA 3U4XA 4YLZA 1G9BA 4RL7A 1QNYA 3O0XA 1I3HA 2W68A 2EXHA 4YZ3A 5GLWA 4AVVA 5E8AA 1W6PB 1C1LA 2YV8A 4LBNA 1LHWA 1W6PA 2Z42A 3B9CA 1HQLA 3FFZA 3W59A 1FATA 4FPHA 4Y20B 1LHOA 2SBAA 4JCKA 3VV1A 3WG1A 1LOAA 3B3QE 4M3CF 4F83A 1AZDA 3PMEA 2AENA 4YGEA 4GXLA 3OBTA 1LEMA 1MS8A 4AGGA 1MS0A 3ZXKA 1GZWB 5JOYA 1O4YA 2GN3A 2ZHKA 1ULCA 3FUOA 5GZFA 1UZZA 5DXDA 4SLIA 5CA6A 3WDXA 2B7YA 3USUA 2NMOA 3HMYA 2DURA 2DVGA 4HL0A 2D6NA 3WCSA 3AFKA 4JC1A 5T54A 4DQAA 1SLTA 1KDKA 2GNMA 1FYUA 3IN9A 1URXA 4AGRA 4M3CA 4WVVA 2A6YA 1VALA 2ES3A 1G9DA 1SLAA 5E89A 1W6OA 4XYXA 3AP5A 4BMEA 1W6OB 3B00A 2CTVA 1LECA 4XIKA 1DGLA 2V5YA 2ZMLA 5DUWA 4M01A 5GLVA 3VKMA 1WD3A 3ZXEA 1DIWA 5IUQA 2ZGQA 4DRRA 1LODA 5JOXA 2D3PA 1SBDA 2ERFA 2NN8A 2VW1A 4FOVA 2EXIA 2ZHLA 1JOJA 4I30A 1AF9A 1JW6A 3RSJA 2ZGLA 4L8QA 4YFZA 1G9AA 3UK9A 4DS0A 4YW4A 3AP6A 1JN2P 3TAYA 5GALA 3SLIA 1SLCA 4K1ZA 1QU0A 3N3HA 1JHNA 1RITA 1G8WA 1WD4A 3O12A 4IQPA 4ATEA 1AJKA 1DQ5A 5DUVA 2PELA 4U36A 3WDVA 2EIGA 4PBPA 4FPFA 1MS5A 1GV9A 3C2UA 3NV3A 3SISA 1LGCA 1I1EA 2WLQA 2WSVA 3Q9OA 2E7QA 4H55A 2LALA 5GLUA 5DZFA 1UL9A 4YGCA 2JE9A 2DVBA 3M2MA 3WHTA 2R49A 1OKQA 1Z0HA 3WLUA 4AVTA 1DYPA 5DG1A 3SH4A 1GYKA 4ZXKA 4ZKTB 1FNYA 1MZ6A 4Q8KA 2AH2A 1O4ZA 1JBCA 1LGNA 2A6WA 4RA0A 5KXBA 4AGVA 2DTYA 3PJQA 1LOEA 1JXNA 4Y24A 2EAKA 1PZ8A 2JECA 4FPYA 4LBMA 2GNTA 3MPPG 2D6KA 3ZSLA 3AZZA 3KM5A 1CQ9A 4NOTA 1A78A 3AP9A 1W6MA 1DBNA 5JOWA 1W6MB 4YW3A 1GNZA 3OPZA 3WCRA 1C57A 1UPSA 2G4IA 5JDBA 3BODA 3ZPYA 3UJQA 1W6QA 2DUQA 2GNDA 2UWCA 2E7TA 1G9CA 1X50A 1VAVA 3GNEA 1MS3A 1YIFA 4XHBA 3AX4A 1YYNA 5F9TA 2LTNA 4XMAA 2GNBA 4PF5A 1KITA 1GLHA 1VLNA 1Q8OA 2JJ6A 3BIWE 1WLCA 3KQRA 5T5JA 3R05A 2EF6A 3V64A 5IK7A 2P3JA 3CNAA 1CJPA 2ZGPA 2ZHNA 3TB0A 4FPKA 3D6EA 1KJLA 3RMXA 5GZGA 4C1XA 2HYKA 2PHFA 1BJQA 1V6KA 1DZQA 2VH9A 3LSDA 1GBGA 1NLSA 2AYHA 2UURA 4P9XA 5GZCA 4UW3A 1LCLA 1FAYA 2P3KA 2ZABA 4XZPA 1LULA 3SNMA 1U0AA 4XDQA 3VKNA 1Q8PA 5CAZA 2GN7A 2ZBJA 4Y1XA 1F31A 1IS4A 1S0CA 1MS9A 2UU8A 3AYDA 1QDOA 1GNHA 3WVJA 3PVNA 3D5OA 3O0VA 2NM1A 4FPGA 2ZGMA 1ULGA 3ZYRA 2WT1A 3MW4A 2AGSA 4YZ5A 3AJZA 3IPVB 1FNZA 2D44A 2VXRA 4FP2A 4YM3A 2GDFA 4Q27A 1A8DA 3AYCA 3B69A 4XILA 4FPCA 5EYXA 1FV2A 1GSLA 4LBLA 5T52A 3RQ0A 1IKPA 2ZGOA 4DPNA 2OUJA 5AVAA 4YG3A 2A7AA 4R9DA 1Q8SA 3ZXLA 4YZ1A 5GZEA 3D4KA 1V6IA 2AR6A 4K1YA 5JVVA 5IT6A 2WJSA 2ZGKA 1DYKA 2D3SA 4AYUA 3N36A 4UW4A 1DFQA 1QMJA 2OW4A 2E6VA 4GKXA 4KBBA 1MVQA 1AX2A 4BM8A 2YXSA 2ENRA 4W65A 5BYNA 3B01A 5DUXA 3AP4A 1ULEA 3FLRA 3ZXFA 3IM0A 1V6OA 4Y26A 5HCFA 2DV9A 1C1FA 3OY8B 5H9QA 2C5DA 4OZXA 1WW6A 5KXEA 5FRAA 4U2AA 4Q8LA 2GALA 3ATGA 1HQWA 2EALA 2TEPA 5EYYA 1LJ7A 1NXD1 1CN1A 2W52A 4Z8BA 1CIWA 1UKGA 2CNAA 4FP3A 2CWMA 2A71A 4XJAA 4XJWA 1S0JA 3WDWA 2P34A 1LTEA 1SLLA 3L2YA 1GZ9A 4UW6A 4FOQA 2PHWA 3NV4A 1SFYA 5CB7A 4TYSA 4YM1A 5F5QA 1S0IA 5T5LA 3AJYA 1DHKB 1DQ4A 2GMPA 1RINA 4XJZA 4FQ4A 1N3OA 1S1AA 4YM2A 4YG6A 5LK5A 3VKLA 1N3PA 3OJBA 1H9PA 1LOFC 5H9SA 5DG2A 4FOYA 2OUHA 1SLIA 4CTEA 1GANA 4GALA 4XTMA 1RIRA 4R9BA 2ZMKA 5HCAA 4BLJA 3NV1A 1AXYA 3SITA 1ENQA 4DFSA 2D6PA 1W6NA 3N7JA 4YGBA 1UX6A 2R0FA 5DUUA 4CZSA 3ZSMA 5T55A 4XXPA 1JUIA 1CPMA 2AUYA 5CNAA 4FOWA 2Q5TA 4GWNA 4M00A 1V6LA 4GA9A 3IMNA 5T5OA 3INAA 1UMZA 3DGTA 2A75A 4ATFA 1QNWA 1WLDA 1G9FA 1DLLA 3MW3A 1V6NA 4K20A 3ZVXA 2DU1A 4Y1ZA 4DRVA 4MYEA 3OYWB 2C9AA 3AZYA 2A6ZA 1ZA4A 3OYWA 3V65A 1F5FA 2DVDA 3QLQA 1S0FA 3WDYA 1C4RA 2YROA 1AXZA 1W6QB 3M3OA 3OY8A 1WCSA 2BQPA 2WT2A 2R1BA 3HR9A 1QGLA 2OVUA 1ONAA 2NYYA 5JOZA 4Q2FA 4XBNA 1LHVA 4LBQD 1MS1A 1BKZA 2PHTA 3AP7A 4XBLA 3QCWA 1OFSA 3NWKA 1QDCA 3T1MA 1MVEA 1AX0A 2P37A 3WZ1A 1VAMA 2DU0A 1CPNA 2VUAA 4PQ9A 2ZHMA 3FUQA 2D6LX 4Q1RA 4R9AA 3A0KA 4LBKA 1GZCA 2YZ4A 5E88A 4XJ9A 1KJRA 1A3KA 1DQ6A 4BQ1A 1QOSA 2YY1A 3A4UA 4YG0A 3UJOA 2P3IA 1JYCA 1HDKA 4WV8A 4WZFA 1ENRA 1KQRA 4Y1UA 2R1DA 2NP0A 2CY6A 5GJ6A 5IK5A 1WBLA 2VW0A 4ISQA 3V0BB 2DVFA 1LU1A 2YMZA 4PBOA 3T2TA 5H9RA 5DZGA 1SBFA 1IKQA 3GALA 3IKWA 3W58A 1KDMA 3WDTA 1YO8A 2PHUA 1W0PA 1S0EA 2ZZJA 2A6VA 1LHNA 2ZGNA 1D2SA 2WNEA 1AVBA 5FREA 5GM0A 4D69A 3R4SA 4FPOB 3FBYA 5CBLA 1BZWA 2A3XA 3RMYA 1DQ1A 3ASIA 5SV8A 1HLCA 4FPLA 2SLIA 1Q56A 4XTPA 1LGBA 3OGGA 1YRZA 1N1TA 3WDUA 4Y1VA 1UN1A 2RHPA 2DVAA 4BLIA 2R16A 4P9WA 4XBQA 2E51A 3SH5A 2DUPA 5DZEA 2R0HA 3ILNA 3LSEA 1BYHA 3A0NA 3R4UA 3WHUA 3ZXJA 5IK8A 1QOOA 1FX5A 3APBA 1BQPA 4Y22B 1LOGA 4NO4A 5KXDA 4XOGA 4YZ4A 2A5ZA 2ZMNA 1GICA 2D6MA 1S0GA 3RG0A 3ZSKA 1MZ5A 1SCSA 3WG2A 2D3RA 2JKBA 3AZWA 2A70A 5GLTA 2ARBA 4GWMA 3MEPA 4YGDA 4K21A 4Y20A 4ITCA 3POYA 1UZYA 3JU9A 4WVWA 3BTAA 1N1VA 3UL2A 4ISRA 2GMMA 3POWA 1N3QA 4YW1A 1QKQA 3WG3A 3VUOA 2CL2A 1MS4A 1GZWA 1WUVA 1ULDA 1DQ0A 2JE7A 3FLPA 3LCPA 4R9CA 1G86A 4YW5A 3USUB 1CESA 1BXHA 4LBJA 4FVVA 3NV2A 3RS6A 4AVSA 3ZSJA 4Y1YA 5EWSA 4FPEA 2DYCA 1HKDA 4XIOA 3ILRA 4C1WA 2ZA9A 1MACA 4M3CB 5GZDA 1IOAA 5GLZA 1DQ2A 1SBEA 1V6JA 2P2KA 3I8TA 2I2SA 4YM0A 2KM2A 1UAIA 1WLWA 3PVEA 3H0OA 2EXKA 2JDZA 5L73A 3V0AA 1W6NB 3AZVA 1WW7A 1W0OA 3V0AB 2FHRA 1S0BA 2PHRA 3WV6A 1PZ7A 2NMNA 4BOWA 1YI7A 4JRAA 2A6XA 2W08A 1IS5A 1LEDA 3M3CA 1N1YA 2JD4A 5T50A 1SCRA 4YW2A 3N7KA 2WSUA 4BPZA 5JMCA 3VKOA 3DUIA 1QF3A 4FQZA 2D7FA 3ZYPA 2ZGRA 3M3EA 3N7MA 1N47A 4XJ8A 5IK4A 1CONA 2WKKA 3ILFA 2WT0A 4Y22A 4TZDA 5H9PA 4P9YA 3WG4A 2DTWA 1G7YA 2E53A 3AXDA 3SH3A 3RRDA 5HCBA 2UWBA 4XJUA 1LOCA 3JUUA 2A3WA 4FPJA 2A3YA 1XQNA 4PCRA 3M3QA 4Q26A 2WQZC 1IS6A 1PZ9A 4UW5A 4XE9A 1WBFA 1IS3A 2UWAA 3O0WA 5JLVA 3HN1A 1TEIA 4LBOA 1AXKA 1SACA 2ZACA 1V6MA 2DUOA 4HANA 4BMBA 2VW2A 1ULFA 2FMDA 2CWSA 3I4IA 3IPVA 1AX1A 1ENSA 2AREA 2H0BA 2ZGTA 4Q1PA 1S0DA 2ZAAA 1H30A 1H9WA 2D6OX 2XB6C 2CYFA 4GKYA 3AXEA 1JYIA 1QOTA 3FLTA 4M3CE 2D43A 1V00A 2W39A 1B09A 3AK0A 1WW5A 3N35A 4LBQB 1KRIA 4LBQA 4AWDA 2EXJA 5EXOA 1LESA 4YFWA 1Y7BA 3MW2A 1LENA 1VIWB 2NZ9A 5T5PA 1MR5A 3WNXA 1APNA 3V0BA 1LU2A 1LOFA 1LHUA 4P14A 1CVNA 4XHXA 5KXCA 1F9KA 1YXWA 4XXAA 1ZM1A 3VKFC 1AJOA 3AYAA 4XMIA 2VU9A 1Q8QA 3POSA 1Z78A 2ARXA 3N7LA 1WW4A 3WOGA 2XG3A 1LOBA 2V73A 1Q8VA 3T1LA 2ZKNA 3M1HA 2ZGSA 3WUDA 2GMEA 3O5SA 2DWRA 3BOPA 1D0HA 1N1SA 3AZXA 4CRQA 2ZGUA 3AYEA 1OQ1A 3OBRA 1CR7A
chains in the Genus database with same CATH superfamily
2CV6A 3H7JA 3VBHC 2BJSA 2IVJA 2HWC2 3ZFEB 2WO2A 3I2DA 1R1ZA 1FV3A 4QX5A 4JVAA 1J1TA 4QDRA 4YVWB 1WKYA 2G1MA 4BHPA 1QNYA 4IV3B 4IETA 2DFCA 1PIV1 4YZ3A 2Q1MA 3RZMA 4ZXEA 2KA3A 4BB3A 4CDWB 2IC1A 1O5UA 3B9CA 3MIHA 3VV1A 4JCKA 4LE3A 3WG1A 3CEWA 4QX7A 4IE4A 2AENA 5JAXA 4YGEA 2JX9A 4IEPA 3SKJE 3H50A 1MS0A 4GB33 5F39A 3UETA 2QDNA 1Y9GA 2ZHKA 4YW6A 2VULA 1CZSA 3OGRA 5FJKA 3VZLA 1UD1A 2PA7A 3S57A 3LIHA 4E4DX 3GXUA 4NIGA 1T6BX 3HMYA 2WO1A 2B9UA 3WCSA 3BB6A 4JC1A 1KDKA 4WM8C 2GNMA 2W47A 2WFF1 3IN9A 2E26A 4ONUA 2WS91 1G9DA 5CEHA 3I3QA 1PIV3 1SLAA 1W6OA 1KS4A 2HLEA 1REEA 2CTVA 1LECA 2QCSB 5IVYA 5GLVA 1OOPC 1DIWA 1OH3A 2ZGQA 5FLJA 3ZFEC 1PMHX 1SBDA 1RUE2 2ERFA 2NN8A 2R062 3FN9A 2EXIA 2ZHLA 3RFRA 1ZRCA 4BE3A 3OD4A 1VBE2 1AF9A 2DFBA 4ZY9A 4AEDA 3RSJA 3HIFA 2JG8A 2R073 1EUUA 1X8MA 1Y3TA 1YQ6A 2WNVA 4QX2A 5DAWA 2XVGA 3UK9A 3WQ7A 4N43B 4YWAA 1BVVA 4AL9A 4CP9A 3OD0A 1FMD2 1VE0A 1A6CA 3TAYA 3SLIA 3RZZA 5FP4A 2RJKA 1RITA 2OT7A 4CE8A 4I3PA 5K9YA 4COUA 1RVF2 3VB9A 3B94A 1AR73 1ZZ6A 5FXZA 2B4KA 1I9RA 2YUEA 4XCAA 5C3OA 4HONA 3KVAA 2PELA 4U36A 5DUVA 3ZIWA 4FPFA 1ZA7A 4Q0VA 3RZJA 3C2UA 4JZRA 3NV3A 3X29B 4XUPA 4OVEA 3OUJA 3M4FA 2Y64A 4H55A 5GLUA 1JU4A 3MLLA 3TWIA 5DZFA 5J7MA 1XXNA 4KGQA 5BY5A 2HBTA 3LA7A 3M2MA 5K4LA 4QB1A 1IPSA 4AVTA 1H2LA 5FYBA 2VZ1A 2EAAA 2ORXA 2BEOA 2XQRA 1ZRFA 4ZKTB 1FNYA 2WN2A 3GF6A 4S2GA 2AH2A 1JYXA 4DO0A 1RHI2 1SDWA 2MPFA 1JBCA 2A6WA 4HPKB 4TWTA 2PFWA 3C8XA 4HPKA 4EE2A 3SCGA 3GZTB 4M4PA 1X9TA 3ACLA 3NL1A 4FPYA 4XFIA 3ZSLA 1OPOA 3KM5A 3OB8A 4RFT0 4XW3A 3BTYA 3J7LA 4MGTA 4QWNA 5D1IA 1VMJA 5JOWA 3PU3A 3ALQA 4YW3A 3ZFFC 2IXLA 5A80A 5G04L 4BQ4A 3I2JA 2IUWA 1WMFA 1W8OA 2RDSA 3MUY1 4MGZE 4Q4V2 4UFHA 3WX5A 3BODA 3ZPYA 2ARCA 2CAUA 2WNUA 1V0AA 4AAPA 3GDBA 5LB6A 3O1UA 4S2HA 4GH4C 4OHVA 4CP2A 1IPJA 5JSOA 1SEFA 2VGDA 1MS3A 3GNEA 1YIFA 2L9LA 4JRLA 1W8ZA 1YYNA 4JGZB 2ZX3A 1K3IA 1NLQA 4RHV2 4XPVA 1O3TA 1KITA 5FZ3A 1S55A 2XONA 5J3UA 3B93A 1F4HA 5A7WA 2R072 3SKVA 1T2XA 2VECA 4NVPA 3LA2A 3WF4A 3FHAA 4DXTA 2QVSB 2RS11 5A6ZA 4CCEA 3IDBB 2OKXA 1RHI1 3CNAA 3O14A 5I0RA 2ZHNA 1D2QA 2PLV1 1MQTA 1W04A 3VBOA 5FV3A 1MQTB 1AR63 2ADEA 2JDMA 2HYKA 1H1IA 1OOPA 3MLKA 4UOJA 2VH9A 5IYYA 4AI3A 5LA2A 3SHRA 4BYYA 4UW3A 1PO11 5GZCA 3TEXA 1FAYA 2P3KA 2ZABA 4MSVA 4W6YA 4XZPA 3SNMA 1AR62 2JDAA 1U0AA 4H7LA 1ZREA 3VKNA 1Q8PA 3QOPA 4E2QA 2ZBJA 4CUBA 1JTZX 1MS9A 3HEIA 5FZ0A 1QXPA 1E5HA 4OULA 2ZEXA 3D5OA 4MO3M 5A6XA 1ZBA3 4LHLA 1ULGA 3VN4A 3ZYRA 3AJZA 1F2NA 1R081 1HN0A 4N9HA 4YM3A 4NIHA 2HWF3 2Q1FA 2B39A 3T2QA 5LBCA 2ZGOA 2R32A 2ZCWA 2OUJA 2PYTA 5FMCA 1GQGA 5FYSA 3RWNA 4DPNA 2Y0OA 4DUVA 1OURA 1X9PA 1FPN3 1ZZ9A 4NHMA 2Q8CA 4KWLA 4UW4A 5CYYA 4DEVA 4WBBA 1IQAA 4BM8A 3AVSA 1JUHA 4QPIC 3B01A 5FKCA 5LBBA 1ULEA 3I3MA 4LT5A 1OMIA 3ZXFA 4RHV3 3ORJA 2FDHA 5ABJA 5FPXA 1C1FA 1NCQB 4JDNA 1QH6A 5BNPA 5ACA3 4UXAA 2GALA 3THDA 3LEIA 2UYAA 5FK7A 1C3HA 3WNPA 4IXLA 2CWMA 2A71A 2VZVA 3NKTA 1S0JA 4CDXB 2XLFA 1LTEA 4XDOA 5FZEA 3ZXDA 2R071 2WUHA 3DYOA 4NWWA 2WZPP 4FOQA 5FZFA 2RS12 4YM1A 5JI7A 1S0IA 5T5LA 2ORZA 2B5HA 1DQ4A 1RUJ2 4XJZA 1N3OA 3CHXA 5FYHA 5D2AA 3RYKA 2XJPA 5A3TA 3LB9A 2HWD3 2ZXQA 3H1YA 1GWLA 3Q8FA 5G05L 3OJBA 1H9PA 3VKLA 5EIYB 1JZ8A 3T4VA 1LOFC 1OC1A 2DCYA 4IGOA 5FZKA 3TNPB 3ZM8A 2DDUA 4FOYA 1GANA 2VQTA 1W2OA 2Y38A 4GALA 3DPRA 4I02A 1AYN3 1QJZA 3U0ZA 3T2PA 1RIRA 4QXKA 1W8FA 1CAVA 3CJIA 5BNNC 1MZFA 4NIAA 1REDA 2WO3A 3ELNA 4BQ3A 3RZKA 2XJVA 4IEOA 1C8M3 5I0UA 1S2KA 1ENQA 3VBOC 3N7JA 3JD71 2VMDA 4XFHA 1PX3A 4QPIB 3BPZA 5D8AC 2X05A 4XXPA 1JUIA 5FJHA 4G9SB 2AUYA 1BVP1 2YBPA 5CNAA 3DXTA 4KG0A 4LA3A 3W9AA 4CEWC 3T3YA 4OYUA 1OFNA 2IFWA 2OIIA 3AL6A 3IMNA 4GA9A 3VZOA 3U37A 1R093 2GC2A 4P9GA 2VPVA 2HWF1 4K20A 3H8RA 4N53A 3NW4A 1LR5A 2C9AA 3AZYA 3V65A 5JI9A 2WBKA 1S0FA 2FCUA 2YROA 1RUH3 1UU6A 4KWKA 5BNPB 4BXFA 1C5HA 3PUQA 2J1EA 2OVUA 2GC0A 3S7IA 2VZPA 3GBFA 3M3IA 4PDWC 3TBDA 3CBNA 1RVF1 4PIYA 2C6SA 1UXZA 4AG4A 1MVEA 3A22A 2HWC3 2Y6KA 4YVWC 2P37A 2AC1A 3UNPA 2B45X 2ZHMA 3RJRA 4UF0A 1GZCA 2YZ4A 1O3QA 2HWE3 4QHBA 1W05A 2RS13 3HT1A 3EJKA 5DAPA 1XOYA 4Q4W1 1KD7A 4NJ4A 4QGLA 4WV8A 4IEXA 4Y1UA 1RUG3 1UYZA 3RVHA 4QX1A 3I59B 4JGZC 2RDRA 4ISQA 2WR9A 3CQOA 3PUAA 4PBOA 3BOWA 1UMIA 4PLOA 5H9RA 1NCQC 5FY1A 5HBAA 3HQXA 4V2VA 4XUOA 4DUWA 3MHZA 4QMAA 3MDPA 4NWVA 1LHNA 3T30A 2BNOA 2Q8DA 2VOXA 4QPIA 5SV5A 4D7SA 5GM0A 3R4SA 3MYXA 4FPOB 3IDAA 3RMYA 5FYZA 2XHKA 2BVBA 3ASIA 4B4RA 4JQRA 1COV2 2SLIA 3VBSC 3OGGA 3JBG1 5FP3A 2W3JA 4HZFA 4BLIA 4A44A 4P9WA 2R0HA 1HXS3 3C3VA 4IEUA 3MIFA 1BYHA 2XWJB 2ET7A 1FX5A 5FP9A 4KU8A 2CAVA 4AAXA 4K6BA 4XFAA 1QHDA 5HV0A 1JODA 1LOGA 1RUE1 2R061 2XR4A 1J3QA 3J8F3 2GP3A 4NO4A 3LOBA 4R52A 1ULOA 3ZMOA 4XOGA 2RMU2 1EAH3 5EJZB 3ZSKA 2P6CA 4XQDA 1SCSA 4E8DA 2XBO2 3WG2A 4DEQA 5GLTA 1QQP2 2K46A 2MHFA 4K21A 1W39A 2O1QA 2PAKA 4XF1A 3BUCA 3MZHA 3H8UA 1UZYA 2LW8A 1P8JA 3BTAA 3JU9A 1U5YA 4QU1A 2BW8A 4YW1A 4QB2A 4QAWA 3NRUA 3FX3A 5JMOA 5LATA 1V9U3 3PDQA 1VB2A 2LS6A 4NPLA 4XAEA 1DQ0A 2JE7A 4AHZA 2IWGB 1M4WA 5LASA 4YW5A 2WN3A 2WZR2 4FVVA 4NHKA 5IVEA 1AL0G 3ZSJA 4Y1YA 5AC93 3D3AA 2DYCA 1D4M2 5IVFA 4XIOA 3I59A 3ILRA 4C1WA 1W2NA 5FPBA 4M3CB 5GZDA 5JXHA 2Z5WA 4AI8A 4UAPA 4KNCA 2WZ8A 4GH4A 4AFCA 2VBBA 4R8HA 5KHKA 2RS53 3R4DB 4JV4A 3T09A 2JDZA 4LNVA 1W6NB 2H6BA 3O1RA 1WW7A 1X33A 2FHRA 1UZVA 1VRBA 2PHRA 3HD8B 2NMNA 1OLMA 1JH5A 3RNSA 1TQ5A 1LEDA 3IAQA 3M3CA 3DYMA 1PMJX 2JD4A 3BTXA 2VNOA 2C1FA 4NRMA 2YU2A 4YW2A 1CAXB 2LROA 1OVPA 4OMDA 4BPZA 3VKOA 3H3UA 3WEZA 2XL9A 2RR12 4C8DA 1FI2A 1AL23 1EYBA 4IEWA 3ZYPA 2YC0A 3M3EA 2FDGA 4XJ8A 2WKKA 3HJRA 4Y22A 4Z92B 4J6GA 4MGSA 5L7OB 1L3JA 2E53A 1G7YA 1K5JA 2VZOA 1U5XA 4UFLA 5F5CA 3JBG3 3UGGA 5FPUA 2J1VA 3BI3A 4C91A 1ZBE1 3EB7A 2B9VA 3TEYA 2XL7A 2GP5A 3JUUA 4HG6B 4K9SA 4XUQA 1JOPA 5FQ0A 4N53C 1BHGA 3M3QA 4R4ZA 4W50A 2AEZA 4YW7A 5K8SA 2F6BA 3AKQA 3G7DA 3P6BA 4MOAA 4UW5A 4XE9A 5F3EA 1AXKA 2V72A 2ZACA 2XJRA 5F8PA 3J26N 3KGZA 1VBE3 1J1LA 1ULFA 3I4IA 2Y60A 5FZ1A 1JZ6A 5LA1A 1ENSA 2EVXA 3BCWA 2H0BA 3RPQA 2K9ZA 3OF1A 5F5IA 1RMU1 4IE7A 5FPVA 1EV13 4QDSA 4PI0A 2CGOA 2CYFA 1ZBA1 4QQHA 3FLTA 5FMBA 1R083 3IZOA 5BNNA 3LQCA 2VUJA 3D0JA 3D8CA 4LBQB 2W95A 4XF0A 4LBQA 1OBNA 4GIQA 1TMF3 4CCOA 2XGXA 4XC9A 4QXCA 5T5PA 1LENA 4LLOA 4A45A 1VBA2 3GZEA 3NAPB 5FZCA 1LHUA 3NAPA 5JZGB 1Q5OA 2YPJA 2I74A 3A21A 1OA4A 5KXCA 1F9KA 1POV1 1KEXA 2Q0AA 2VMEA 4F7ZA 3VKFC 1JYWA 5FBZA 1ZZBA 1VBA3 1FMD3 3N7LA 5FY8A 1WW4A 4XURA 1Q8VA 1ZVFA 4WM8A 1UYYA 3UESA 2Z79A 3OUHA 1D0HA 5FCCA 2WYSA 3AYEA 4XF4A 3B5LB 4CDUC 1POQA 3MICA 1FOD1 1ULPA 3JBG2 4FI9A 4DB5A 3VBUA 3ZYGA 3GYDA 5JXGA 1EPWA 5FXXA 2JDKA 2ZOEB 3P3PA 2A1XA 2XQXA 5A7QA 1AR92 3ZDSA 4YZ2A 4GMP1 1SLBA 1GKBA 3P1IA 3WUCA 3H8OA 1RVF3 2J1AA 3PL0A 2DF7A 3IDCB 2CGPA 1PIV2 2W68A 5GLWA 2CSGA 3GCXA 4D7YA 2ZEWA 3DPRB 1Y4WA 1LHWA 1TNFA 2Z42A 3NJZA 3AC0A 4RS5B 1LHOA 1UKRA 1BEV3 1O6UA 3JQWA 4C0BA 3B3QE 1AZDA 4EJRA 5I93A 1UF2C 3CKHA 3B02A 4L11A 2PLV2 1LEMA 1VBC2 4AGGA 2VTFA 2JB4A 3WW3A 1K5MB 1O4YA 3I2GA 4LKEA 4WM7B 4X6QB 2X10A 3OEAA 5GZFA 2HEWF 1UZZA 4E4ZA 5CA6A 3O1SA 1UOGA 3CO2A 3I2IA 1RB8G 3USUA 4DOUA 1QJU2 4AEKA 1AR71 5CFCA 1DGRA 1D7PM 1FYUA 2XJTA 5AVPA 4CDQB 1ACCA 4CCCA 1URXA 4DNYA 4WVVA 5DABA 2VNVA 3P5BA 1O59A 1VALA 2QDRA 2Z4FA 4XYXA 4EN6B 3AP5A 1W6OB 3B00A 3KD4A 5JZGA 1W8TA 2V5YA 5BNOC 3PTRB 1OSGA 2J22A 1IGOA 4GMP0 1H2MA 3NNMA 5IUQA 4DRRA 1LODA 2Y6JA 4I09A 3FMGA 3KF5A 2HBUA 5BV6A 1LRHA 2VBPA 1JW6A 2JDYA 5A1LA 1JMUB 5FY4A 1G9AA 4CEWB 2BBVA 3AP6A 2XVKA 3EO6A 5GALA 3QACA 2WWSA 2ZAHA 3SEPA 4P9IA 5DDJ2 1RUI3 5JR7B 1WD4A 4PLMA 5FOBB 3M8LA 4ATEA 3FZ3A 4Q0UA 4UBHA 1AJKA 2ZX4A 4XFGA 3WDVA 3I2FA 5CKMA 4YNIA 3BIEA 5EJ3A 2BTVC 4E2GA 2P17A 2Y6GA 3SISA 4BZ4A 4DXZA 3Q8EA 1SPPB 2E7QA 2E31A 4BXSV 1ZBE2 4IE6A 4YGCA 5ERLA 4EWAA 4IGPA 1W8WA 1YFYA 1VBC3 3CZJA 2QQWA 2R49A 3IBMA 1XYOA 2R30A 2B42B 1DYPA 4QX3A 4ZXKA 1TE1B 1ND2B 4XACA 2XJQA 3A7QA 4MZUA 2ZX1A 1XNCA 1O4ZA 5F32A 4ARYA 4AQ6A 5JCTA 1E5IA 1RUJ1 1W28A 4RA0A 1YEWA 3IIAA 4MGYE 5K0UB 1LOEA 1JXNA 4Y24A 1PZ8A 1OH4A 2JECA 1S4CA 2VC9A 1AR81 2GNTA 5FZ6A 2ZS6B 4FFIA 4XF9A 5CIRA 5JPMB 1RUF1 1RHI3 5FZOB 2JDNA 2ZX2A 1A78A 4XFFA 2X29A 4UFMA 1W6MA 1F35A 5FYTA 1W6MB 1PK6B 5LK7B 2G4IA 4QQ2A 5JDBA 4R4XA 3U1XA 4IEZA 1OT5A 4N7UA 4YYOA 3UJQA 1W6QA 3E97A 2WNUB 4CPBD 1YJKA 2GNDA 2UWCA 2E7TA 2WFF3 1G9CA 3PTYA 1TME1 4NRQA 3WNOA 2WNOA 5JXJA 2YC2A 4LMFA 5F9TA 1HN1A 1RUE3 2R063 1IQDC 2GNBA 1RJ8A 1RXFA 4N43A 2EIBA 3VDDB 1RUNA 4AVBA 1H8VA 4AF9A 1SZBA 2VUCA 2WQ8A 5HV4A 1YUDA 1TG7A 2MEV1 2VQAA 1OF3A 5JSPA 4Y4RA 1A8MA 4FPKA 5C33A 1AYN1 4I01A 4QU2A 4FAHA 3UYJA 5C3SA 2E32A 2C0ZA 1K12A 1OVSA 3DCQA 4C1XA 3K51A 2UURA 2JDPA 1PO12 2QZ2A 2X8KA 5IVVA 4LK6A 2W1UA 4XDQA 3ZN4A 5JR2A 1I6XA 4QB6A 3IMMA 5C5TA 4Y1XA 3AYDA 1PO22 1QDOA 1Y9MA 2W1SA 5IJRA 1XU1A 4W4ZA 3K46A 4CU6A 3CJXA 2ZGMA 2BDRA 2OA2A 2WT1A 4YZ5A 1EPZA 3IPVB 1FNZA 2VXRA 4FP2A 1GOHA 2Q30A 2GDFA 4Q27A 4AOCA 4BISA 3AYCA 2O0OA 3B69A 4IL7A 1VBC1 4AZZA 4Y5SA 5LY1A 4R9DA 3DN7A 2WWUA 5GZEA 2AR6A 4K1YA 5FZOA 3UGFA 3RZHA 4KI5M 2HJIA 2D3SA 4JGYB 4MX3A 5JPNB 1R1A2 1PK6A 1QMJA 2XJUA 1H2NA 1PO13 1PM7A 2ILMA 4PF1A 1NUKA 2W87A 1RUH2 2YXSA 3MIGA 3MIBA 4W65A 3TRSB 1YLLA 2BV4A 1V6OA 5HCFA 2DV9A 5H9QA 2XBO3 5A3OA 2FDIA 1JZ5A 2OZ6A 4Q8LA 4QPGB 1HQWA 1PNFA 2EALA 5EYYA 4JGZA 5FLIA 2YBSA 4AVCA 5FZ7A 1NXD1 2W52A 2Y6LA 4COYA 1CIWA 1FOD2 4RGAA 3VDDA 4Z8BA 1UKGA 4FP3A 1O4TA 4CP9B 1Y43B 3LGRA 1ZBE3 5M0TA 1UY3A 1GZ9A 2AEYA 4JX0A 4UW6A 4LHNA 5CB7A 2MEV2 4AR2A 4ZZ5A 5FZ8A 4KH9A 4OI1A 2CDPA 3SC7X 4BQXA 1DHKB 1ND3A 5EQUA 3NMBA 4FQ4A 5AC92 4YM2A 1GR3A 1QJY1 4OLLA 5D8AB 2VL4A 4O9GA 5A1AA 1VBE1 2X53S 1N3PA 3ITQA 1YJLA 3NNJA 1GOFA 5ANQA 1DG6A 3THCA 1WMEA 1GWMA 2QFEA 3DKQA 2VOKA 4IEYA 2PAEA 5H9SA 2XBO1 3C7GA 1KFXL 1SLIA 2HWB3 4AQ2A 4EN8B 4XQ4A 5CG9A 1OI6A 3EXUA 1B35C 3WF0A 4CDWC 5ACA2 4JDOA 4BLJA 1OXCA 3NV1A 3NNFA 3SITA 4ZZ8A 1RUD3 2D6PA 1H6YA 1ZYBA 1MEC2 4YGBA 1SDDB 1UX6A 5FPAA 2D5HA 4C0HA 4DY3A 2V5DA 3CMGA 1ZBA2 4Q0PA 1CPMA 3O7OA 1O3RA 1HJGA 1OD5A 4IV1B 2Q5TA 4XETA 2Y8KA 5KC5A 1V6LA 4P5YA 3USSA 4AE2A 4PDWB 2RS31 3KSCA 4UFJA 1V9U2 3DGTA 5KBFA 2VZ3A 2A75A 4O9EA 4ASKA 3ZR6A 4CUAA 4YARA 3VBUB 1K5MC 4BQ2A 2VUDA 3ZLIA 3WNLA 3ZVXA 3ZFEA 4Y1ZA 4LIVA 4MYEA 4AEDC 2A6ZA 1HRV3 4MXVA 2WRAA 1D4M3 1L7LA 2DVDA 3OTFA 3H42B 3VD7A 1UOFA 2N7GA 1FOD3 3M3OA 1DZRA 1U5ZA 2BQPA 3CJIC 4XAAA 3ZN6B 1ENXA 3HR9A 2VZQA 2R043 1YCIA 2NYYA 4EWDA 2BGCA 2F4LA 1LHVA 4LBQD 3WY6A 1BKZA 1H0BA 1MEC3 1E57A 3CL1A 4XBLA 5FLHA 1NZIA 1PHMA 4CDXA 1LKNA 1UY4A 2RR11 1H8TA 3LEKA 1VAMA 1OLRA 1H8TB 2DU0A 4R9AA 4PQQA 4C90A 1GWKA 4P02B 1DGWX 3PJYA 1RUG2 5E88A 3I3EA 4HVOA 1QY4A 3V56A 4BQ1A 4W8JA 3AKPA 2BYVE 3A4UA 1XSQA 1NY72 4JKKA 4BQWA 3VBRB 4YSFA 4YVSB 3EHKA 3E5XA 3BU7A 2WA3A 4WZFA 1KQRA 1VMHA 2NP0A 4ZU7A 3ES1A 1CD3G 2BWCA 1YC61 3H9AA 3WQ0A 5IK5A 4IV3C 3RI9A 3V0BB 1IZ3A 1LU1A 2YMZA 2HYXA 4FFFA 3T2TA 3IDEA 1W9WA 3LD8A 3IKWA 3POIA 5JUVA 2WNUC 1XJAA 3WDTA 3ZIXA 1YO8A 1W0PA 2ZZJA 3VBHA 2A6VA 3RDIA 4BQ5A 2HWC1 4LITA 1AVBA 5FREA 3DECA 4AEDB 1BZWA 1UMHA 2A3XA 4WVMB 4IV1A 5SV8A 3CLPA 2ZEZA 3K4AA 2TNFA 1YRZA 5CISA 3VDBA 4CEYB 2DVAA 3FWEA 1GP6A 3FE5A 1QJX2 2DUPA 4GMP3 3SH5A 2V09A 3ZXJA 3UV9A 1QOOA 2JXAA 3BTZA 4HBNA 5K7PA 2HWB2 1BQPA 3ZPOA 3E5QA 4Y5Z0 4BCUA 3WF2A 1PNGA 4TLFA 4LHSA 4LEJA 5C70A 1LB2A 1R091 2PHLA 2YFUA 1CAWB 2A5ZA 1W9SA 4JKMA 2H0VA 2VMFA 1W9YA 1CAWA 1YHFA 3ZFFB 1H1AA 3POEA 1MZ5A 5CFCC 1BBT1 4META 1EV11 2A70A 4YVSC 1HRV1 3MEPA 1CWPA 2HWE2 1WCDJ 1JZ3A 1AYN2 1N1VA 3UL2A 4FBFA 4L97A 2BFUL 2PAMA 1RMU2 4LO6B 4J25A 1NCRA 1GZWA 1UIKA 4LKDA 1WUVA 1NCRB 3WNNA 5KHHA 4EV0A 1ZNPA 2VAUA 1ULDA 3FLPA 4FFHA 3ZKUA 5B2GB 4CCLA 4LBJA 5BUVA 3KV6A 1CIYA 1VP6A 3TOJA 3Q8BA 5C9AC 2ZA9A 1PO21 1MACA 1Z7S2 2HWD1 3TN92 1IOAA 1VBA1 2BERA 3JB4C 1DQ2A 1V6JA 3I8TA 4URAA 4B3NA 2I2SA 3CJIB 1DF0A 1AUYA 2PXJA 1UAIA 5FUNA 3J9SA 3OPWA 3H0OA 5BNOB 4RN5A 1RYYA 1WMDA 3VD9A 3O1VA 4NPRA 1ZZCA 1ZX5A 3AZVA 5L9RA 1AYM2 4IGQA 4UT5A 3SXWA 2FD8A 4JRAA 1RUI1 1YI9A 2W08A 5FR3A 5JIUA 1UOJA 3I49A 1N1YA 2GC3A 2I45A 5FP8A 5T50A 1W0NA 4LUKA 3BVCA 4OQ8A 3SCHA 4LR4A 3DUIA 3MUZ1 2VQ0A 4FQZA 1L7RA 1ALYA 4G3YC 2D7FA 4D6RA 3POGA 4N9IA 4QKNA 1CONA 1OA3A 3ILFA 2J1RA 3KT7A 4P9YA 4FXGB 5CG8A 5L7OA 3LDBA 5BPXA 3DEMA 5HCBA 1OA2A 1J84A 4Q4Y1 3F95A 4DXSA 3R0RA 4QQLA 3MGUA 4FPJA 1NKGA 4DXRA 1XQNA 1BMV1 5FQ0B 1VRH1 1Z7S1 2HWD2 5AFBA 2QQIA 4Q26A 4FSJA 1VBD1 1W03A 4PHZA 1R64A 3FHIB 2UWAA 1PX4A 5C9AB 2R042 2QE3A 4LBOA 3T0AA 5I8YA 5J48A 2D98A 1J3RA 1V6MA 1NYWA 5C9AA 2PQQA 2QQUA 2ZZQA 5C8CA 2XJSA 3T2OA 1AX1A 4F3JA 2AREA 4UF0B 2IVIB 1UXXX 4HK9A 4Q1PA 2ZAAA 1F8VA 2GSYA 4N7IA 5B4NA 4HMZA 1S2EA 4MH0E 4MHRA 2QQJA 2XB6C 1ODNA 3IT8A 3VBFA 4FTEA 2QQPA 1JYIA 1QOTA 4M3CE 4OI2A 4WVZA 3HQUA 1H8TC 3VBFB 5FY0A 1DU3D 3AK0A 1VAKA 1Y9QA 2Y6FA 4TXWA 5C5UA 1NLRA 1KRIA 1W8NA 4AWDA 4E4SA 5EXOA 1LESA 2P1BA 3PMSA 3P3NA 3WNXA 3JCIA 3WNKA 1MR5A 2RMU3 2W5FA 5A3NA 4K3UA 2ID4A 3VZKA 4P14A 1CVNA 4XHXA 2GZWA 3MV01 4CP1A 5BNOA 5I0DA 4XXAA 5FKBA 4AW7A 2WZR1 3J7MA 3ZSEA 3VLBB 4I0WB 3AYAA 4XMIA 2VU9A 3POSA 4LULA 2VG9A 4CDQC 2JWPA 2V73A 1R1A3 2ZKNA 2FCVA 3M1HA 1GUIA 3WUDA 3W5MA 4RFRB 1CAXA 2O8OA 2PLV3 1F4AA 3BOPA 1YQ5A 4GZ9A 2ZGUA 3WR0A 3LIGA 4WM7C 3R6SA 2ZKLA 1OQDA 3ENRA 2FQPA 1CZVA 2C24A 4IV1C 4DMIA 3WSOA 5D8AA 5A70A 5C6CA 3LFIA 1QJU3 2FCTA 4Q5OA 2CHHA 2PHXA 4B4PA 5JLVA 2VY0A 1UU5A 1FT9A 2Y33A 5ABJC 5LRSA 3ZYJB 3U4XA 3WINE 4UYBA 2OQ7A 5FMOS 4Q4Y2 1I3HA 1CX4A 2BU9A 3DF0A 1AL21 1BMV2 3K2OA 3KWVA 5F3IA 5FZLA 1W6PB 3PU8A 1C1LA 4QHZA 1W6PA 4E27A 1HQLA 5F3CA 3W59A 1FATA 4Y20B 2X5IC 2SBAA 5LA9A 4ZU4A 1LOAA 4M3CF 3QH7A 5C8CB 1NXMA 5L19A 2WDBA 3PMEA 1QEXA 2OX0A 4A42A 3OBTA 1MS8A 1ZRIA 4ET7A 1YFWA 3ZXKA 3VZJA 1D4VB 5JOYA 2GN3A 3NO8A 3WF1A 1O5LA 1ULCA 4MVTA 4Z2AA 2J1TA 4MG2A 4XCBA 5DXDA 5C4WA 4JQTA 1C8M1 1UOBA 2B7YA 1PGL1 4OHWA 4PDWA 4BK4A 1AYM3 4CVUA 2DVGA 2D6NA 4AFBA 3AFKA 1W8UA 5T54A 4DQAA 1SLTA 5IHRA 1W3VA 4MADA 2VZUA 3WD5A 4X8PA 4KGGA 1QWRA 1X82A 2JB8A 4Q4V3 4LXLA 4AGRA 4M3CA 4CDQA 4Q4X3 4GWIA 2ES3A 5EP9A 1XSRA 3WQ1A 4J1XA 4RQPB 5FWJA 4V1PA 1KXGA 4BMEA 3IWZA 4BK5A 2VVEA 1NG0A 1RJ7A 4JHZA 1DGLA 1WCUA 2ZMLA 4GJYA 3MO4A 3E6DA 4M01A 2VQUA 5DUWA 5F6KA 1WD3A 1IG3A 1XYPA 2FZ1A 3GBWA 4YRDA 3NAPC 1WGPA 3N9OA 4S2DA 4EROA 4AQSA 4FOVA 5JOXA 1JZ2A 1JOJA 4I30A 1D4M1 2W2IA 2ZGLA 1HXS1 4A7ZA 5IVJA 4L8QA 4YFZA 3KB5A 3K4DA 1QJX1 4DS0A 4YW4A 4XQWA 4A3ZA 1JN2P 5FYVA 4NHLA 1POV3 1SLCA 2BZDA 2ZPXA 3N3HA 3KCCA 3ME2A 1JHNA 1YQ8A 1UWWA 3O12A 5E16A 1US3A 2VNRA 5FBJA 3N4MA 3ZYIB 4Q4X1 4PBPA 1MS5A 1GV9A 1X7NA 2FZ2A 1EP0A 1XE0A 2D40A 4NAOA 1EV12 2WSVA 1BCXA 3BN6A 2XOMA 3Q9OA 5FFOC 4LIUA 2RDNA 3JXSA 3ZOIA 2BFUS 1UL9A 4IESA 1NAEA 2W94A 3U07A 2DVBA 3I54A 4Q4Y3 3WHTA 4NIIA 3VBRC 3WLUA 2BNMA 1W06A 1GQHA 5DG1A 3GGLA 1MZ6A 5DAVA 3B7MA 3HAGA 5DDJ1 1QJFA 2RVAA 3AKSA 4Q8KA 3POFA 5C8WA 5I91A 3EBRA 1LGNA 5KXBA 3VHNA 2KD7A 4AGVA 4QDQA 2EAKA 1PO23 2F4PA 5C4WB 1RTVA 4AFMA 1HW5A 5FMOL 4LBMA 1MPXA 4OUEA 4UI9L 4LKSA 2D6KA 4LKFA 4OHZA 1XNAA 3AZZA 3D82A 3AP9A 3O1MA 1QQP1 5AFEA 3QD6A 1DBNA 4L9BA 4I3GA 4BDVB 1NQDA 2QQVA 1H1MA 3OPZA 3HBZA 3WCRA 1W2UA 2VOWA 4IEVA 4P9JA 2VCAA 2BGOA 3KHCA 4CA9A 3M70A 4HLTA 4LE4A 3AX4A 3TYJA 5F3GA 2LTNA 2BOJA 4FTBA 2XUMA 4JGYC 3LA3A 2JIJA 1VLNA 1AR82 1GLHA 1OLQA 2Y26A 2YYOA 1PVC2 3I3DA 3OEBA 4CEWA 4P9LA 3ZYFA 2D93A 4LO5B 1UYPA 3V64A 4E8CA 2P3JA 3LKJA 1CJPA 1SHWB 3ST7A 2ZGPA 1YQCA 3KV5A 3TB0A 1DGRN 5F6LB 4AVAA 3HT2A 3KZ4C 4I0AA 4D7TA 3D6EA 1NZCA 1XE8A 1O91A 1XE7A 1PVC3 1KJLA 1VBD3 3RMXA 5GZGA 4BA6A 4NROA 4GAZA 2FDKA 3EMRA 3T0DA 5C3QA 1DZQA 2Q1ZB 1NLSA 2AYHA 2ZEYA 4W6WA 3K75B 1HV0A 1I5ZA 1VB4A 5DMYA 4B4QA 1ST8A 1TME2 1LULA 1WZXA 2PQSA 2C9KA 4ZU5A 4QKFA 5A33B 4QKBA 3TEZA 5E6HA 1Q3EA 1RUD2 2GN7A 4LO4B 1IS4A 2UU8A 4G4FA 4RS5A 4A6SA 4AI0A 2WFPA 1OUSA 3PVNA 3VBFC 4AHWA 3O0VA 1AR91 4JTOA 1ND3C 5KR7A 3MW4A 2AGSA 3KS7A 2OPKA 3CF6E 2V4AA 1COV3 4Q29A 4NUBA 5EYXA 5A32B 3ZR5A 1JYTA 3J7NA 2VE1A 2RS32 4YZ1A 4YG3A 3ZXLA 1Q8SA 2YHJA 2X5IB 4GB31 1PVC1 1F15A 1V6IA 3OSDA 5FZDA 5DPNA 5IT6A 2ZGKA 1STMA 3UT0A 2VTXA 5KHIA 4AYUA 1LNSA 3N36A 4JGYA 2OW4A 1QJY3 2E6VA 4Z07A 5KC6A 1MVQA 5BYNA 4OFGA 4IERA 5DUXA 5FZGA 4NMIA 5BNQA 1HV1A 3FLRA 2W91A 3IM0A 4Y26A 5FXWA 5APAA 4EN0A 3OY8B 2Y0IA 1PK6C 2QNKA 1SMVA 1WW6A 5FRAA 4U2AA 3PIJA 2IXHA 3ATGA 3VBUC 2TEPA 4NIDA 1LJ7A 1T6GC 1W3XA 2HEYF 3ETPA 1UYXA 2WINB 2W92A 2CNAA 4NN0A 4AHYA 3S5AA 1RGSA 1SLLA 1CGPA 1NE4A 5A3MA 5IATA 1VRH3 1RUG1 2JKXA 1BK0A 3NV4A 4D94A 5FTTC 4TYSA 5FY5A 3AJYA 3TNQA 1RINA 3AL5A 2Q4SA 1QIQA 4YG6A 2VMGA 3RYPA 4YVWA 5DAXA 1J59A 5A3UA 1VBD2 1SPPA 1XU2A 1UY2A 2GAUA 2QQKA 2AZ5A 4UFKA 3CZUA 4XTMA 5BNPC 3WW2A 4R9BA 5HCAA 5HPOA 5KHJA 4B1LA 1E5SA 3LPGA 2IXJA 1M06G 3MIDA 1NA1C 3KHBA 2VMIA 2YB7A 3CIHA 4OHXA 4DFSA 1ZZ7A 2Y6HA 3VGIA 5DUUA 2P6HA 5EPAA 5T55A 3U4SA 2JG9C 4QQOA 5EHDA 1QJY2 3ZFGB 1AHSA 2RR13 1RUJ3 3MLJA 4M00A 1YFUA 3K3OA 5FYIA 1QH7A 4B7EA 1UMZA 1HRI2 2VJXA 2IZWA 4ATFA 4IE0A 1QNWA 1WLDA 1A34A 4KMQA 2CU5A 1DLLA 2GH2A 1IG0A 1V6NA 2EA7A 3MW3A 4P08A 3OYWB 2YPDA 4EZ4A 1F5FA 3HNBM 1R092 4QGMA 4ARXA 1WCSA 1ZRRA 4XF3A 2FBEA 2ETEA 2QQLA 4BU2A 1UY0A 1ONAA 1ZZ8A 5JOZA 2QJVA 2B46X 1MS1A 1HQNA 4X8NA 4I2OA 2WFF2 2XVLA 4FFGA 1H2KA 1OFSA 2RDQA 1UPIA 2YBKA 3NWKA 1TME3 1RUC3 3AKTA 4COVA 1WWYA 3DV8A 4HKLA 3GJBA 2D6LX 1MQTC 4EN9B 4LBKA 4TN7A 4COZA 4XJ9A 2VVDA 5LRRA 4LUMA 2WL1A 1QOSA 4YG0A 3UJOA 3ZXAC 3H3LA 1JYCA 1OOPB 3LOIA 1HDKA 3UKTA 3VBRA 4CSWA 2JE8A 3K77A 1AL22 2VMHA 4CU8A 2RMU1 1ENRA 2EIEA 2R1DA 1DGWA 4KWUA 3FL7A 2CY6A 5DQ0A 1WBLA 1TVGA 1W9FA 3RJ2X 3SCFA 5FZAA 5DZGA 3S5QA 1NT0A 1IKQA 1SBFA 2FDFA 5LZ6A 4Q0QA 5CKQA 2WYFA 4UBGA 2PHUA 1S0EA 2ZGNA 2KR2A 1D2SA 5LEKA 2WNEA 5JIAA 3LAGA 3AMPA 3FBYA 5CBLA 2C4XA 2RS52 3AMHA 1CZTA 3ZFGA 4WVMA 3WP6A 4FPLA 1WMXA 2E63A 3RYRA 1LGBA 1QXJA 2VZSA 4CP0A 1N1TA 2JIGA 3AKRA 1OQEA 1XYNA 4XBQA 2E51A 5DZEA 4EYUA 2C26A 2HKXA 2JEMA 3ILNA 3A0NA 3R4UA 1NX9A 2Z69A 3APBA 1HX6A 4MGKE 1MZEA 5HI0A 5JZGC 5ABJB 5F5AA 5FPZA 5J09A 3NSTA 4M4RA 5D21A 2WO7A 1SFPA 2Y34A 1GICA 2D6MA 3FFQA 4YZ4A 5LCWL 1PVXA 4MV2A 4E4HA 2D3RA 4QM9A 3AZWA 5I0TA 2ARBA 3BPSA 3NJYA 3RZGA 4ITCA 3POYA 5FIXA 5DN2A 3KVBA 4HETA 5FY7A 5A3WA 1YFXA 4ISRA 3ZKYA 1JU3A 4TLGA 1QKQA 3NVCA 5K0UA 2BUKA 3NNGA 2RJ2A 5K0UC 3USUB 3KQ4B 3O1OA 4AVSA 3U75A 1ND2C 5KHGA 1H4GA 3LPFA 1AR93 1B35B 3I2OA 2VNGA 4CUGA 4IW3A 4RD7A 2AACA 1OUXA 1SBEA 2P2KA 3AM2A 4Y5TA 2VVFA 4AHXA 1K42A 5CU1A 1CAUB 4YM0A 1RL3A 2O14A 5FZ9A 3KT1A 3VL8A 3WT3A 1XC6A 1Z7S3 5FYYA 5L73A 4RGGA 5IAXA 4NRPA 3CDZB 3ZX7A 1HB2A 5LA0A 1E5RA 4CDUB 3WV6A 1S2BA 1GP4A 2ATFA 1PZ7A 5F1RA 1RUF2 3N9QA 4BOWA 2LM3A 2A6XA 4CXWA 1IS5A 1QJU1 4QGNA 2W46A 5A1FA 1FXZA 1PGW1 1SCRA 2VOTA 3K48A 5HXVA 3AB0A 1HB1A 3E6BA 3UGHA 1O7FA 2VMCA 3LDKA 2ZGRA 3N7MA 5ISLA 1N47A 3C7EA 2LRPA 4IEQA 5IK4A 3WP4A 4RYDA 2WZEA 3DYPA 4OQ9A 1NA1B 2WWJA 4FAGA 4GJZA 3SH3A 3AXDA 2WIIB 3RRDA 3U11A 2UWBA 4TTGA 1LOCA 2YG0A 2A3WA 2RE9A 2A3YA 2PHDA 4K7JA 4PCRA 5FUPA 2J1UA 3KCYA 1IS6A 1PZ9A 4K40A 4E9KA 4I0BA 3FBMA 2ARAA 2QUOA 3WP3A 4LOTA 1SACA 2DUOA 1OD3A 3MF9A 4BMBA 4ZPIA 2FMDA 2CWSA 4QKDA 4DIQA 3IPVA 2JG9A 3I97A 2ZGTA 5A7OA 4FCAA 3JQXA 1S0DA 1GQPA 1H30A 1TMF2 1BBT3 2ZX0A 1C8M2 1PGL2 1SG3A 3JD72 1RC6A 1UO9A 2W1QA 4CEYC 2QTWB 5A6YA 3AXEA 1V00A 2HWE1 1B09A 2Z2SB 1WW5A 5HXMA 4QT6A 1DZTA 3IB3A 4ORFA 5C3RA 1DP0A 2EXJA 1RUD1 4YFWA 4HOOA 1Y7BA 5C71A 1VIWB 2NZ9A 3V0BA 1XB9A 5EFUA 4AEMA 1KFUL 4IE5A 3TN93 1QJX3 1CAVB 3KMHA 4PIZA 1FPN1 2OZJA 1ZM1A 3PLQA 3W20A 4RSUA 1AJOA 3PURA 1Q8QA 1GU3A 1HB4A 2IXIA 3LWCA 4KBZA 1Z78A 5FOJB 5F2WA 2P5BA 2H6CA 2XG3A 1LOBA 3VBSA 4EZHA 3T1LA 4Z82A 2TUNA 2RS51 2ZGSA 5CADA 4HVRA 4FXKB 1N1SA 3AZXA 3G6JB 3C7OA 4B29A 2E7AA 3VDDC 1EY2A 1WA6X 2B8MA 4CCNA 3N9PA 5J98B 4EQVA 1CR7A 4CPBA 1ND3B 3ZFGC 3OGVA 4ASMB 4LJHA 1AYM1 5C8CC 1G6NA 3OCPA 4ASLA 1MEC1 3PVOA 1UCXA 2VCBA 3MI8A 1UU4A 2E33A 2VO5A 4XFCA 3T08A 3ZXGA 1LAJA 4YLZA 4IV3A 1G9BA 4RL7A 3U14A 3W5NA 3O0XA 5IAVA 5TSWA 5FYMA 2EXHA 3ZFFA 1W9TA 4XEZA 4CDWA 3J8F2 4AVVA 4RGKA 5E8AA 3SMHA 5A6QA 4M0HA 2YV8A 4LBNA 1KS5A 1GFF2 2VTXJ 3OOXA 4QX8A 5A7PA 3FFZA 3O1TA 3GZAA 4FPHA 1R1A1 4F83A 4A7YA 4JHTA 2QQNA 3VL9A 2VZTA 4Z2WA 4GXLA 4QQPA 1ASJ2 4RR3B 1DLCA 4KG8A 1GZWB 5FZBA 4A4AA 2QQOA 3T4HB 2K2SA 3FUOA 5JXIA 1W99A 5FO8B 1W90A 1H6XA 4SLIA 3T0BA 3WDXA 2NMOA 2DURA 4HL0A 3D0SA 1QJEA 4H7MA 4XABA 3HNYM 4S2FA 1IHMA 4OUSA 4PI2A 2BOIA 5EZWA 3S6PA 3FJSA 3ZN5A 5I8TA 5JWPA 2A6YA 2GH8A 4LPLA 5E89A 2VCCA 4CUCA 3JZVA 4GH4B 1BK1A 4CCJA 4XIKA 3B9IA 2XHNA 3VKMA 1XRUA 3C7HA 4QXHA 3ZXEA 3THPA 4NHXA 4ES9A 2D3PA 2VW1A 3LEMA 1GP5A 1NY71 2NQYA 4NE9A 3QH6A 3FC0A 1VR3A 5FWEA 4MUVA 3LDRA 1J83A 2XH6A 4QD2A 5DAQA 3VBSB 4D6QA 1NOVA 4GB32 5J1XA 1IPKA 2PTMA 4JKLA 5FPLA 5FY9A 2DCJA 1K45A 1TZOA 1QU0A 1PGW2 4K1ZA 3ACFA 4QX0A 1G8WA 2OQ6A 4J1WA 1NCRC 2P3YA 4IQPA 2XDVA 1EAH1 2WC2A 3VHPA 1AR83 3U10A 5I8SA 1DQ5A 4AEJA 1OHFA 1I5PA 3GHMA 2EIGA 4FTSA 3Q8AA 3AVRA 5CFDA 4YPJA 2D97A 1QXRA 1LGCA 1PMIA 4GULA 5C7GA 2BVVA 2WLQA 4XZUG 2DCKA 5FZHA 1JOBA 4D6SA 2LALA 4B1MA 4V2WA 4A2UA 2XWBB 1EUTA 4QPGC 2JE9A 3W21A 2G19A 5FO7B 1ASJ3 4N8MA 1OKQA 3O1PA 4NAMA 1Z0HA 4HXCA 4BWOA 2LUWA 4MHUA 1UZ0A 3ROUA 1JI6A 5FP7A 1GYKA 3SH4A 5CKNA 5IK7A 2HWF2 1J3PA 4HK8A 4MLOA 4Y4YA 3VD3A 1UX7A 4JDMA 5AC91 4E2SA 4XVHA 4MXWA 1F5JA 2UYBA 2DTYA 3WNMA 1I1EA 3PJQA 2VBDA 4MXWB 4UWDA 2OS2A 3OGJA 3KV9A 3MPPG 1YIPA 2ADDA 2QQMA 3AMMA 1CQ9A 5EV7A 4NOTA 1YWKA 2P4EA 3E5UA 1XNTA 1HRV2 5A3LA 2ZTNA 5ACA1 1O8PA 4XFBA 1GNZA 4ES8A 4Q0SA 2HH9A 5L9VA 3PUIA 1C57A 1UPSA 2XLGA 4GWJA 2J7MA 3LEGA 3SEEA 1UW8A 4DUXA 2JD9A 2VD7A 4UFIA 2DUQA 1NCQA 3I2HA 5CZKA 2Q8OA 4O61A 1X50A 4BIFA 1VAVA 1BEV2 3VZNA 4RQPC 1US2A 4XHBA 5DDJ3 4Q4W2 2KXLA 3M7AA 2JDUA 4XMAA 3EYPA 4PF5A 4WM8B 5A7NA 1RUOA 4HFSA 1Q8OA 5A7WB 3HPNA 5FDBA 2JJ6A 1HRI1 2NLRA 3BIWE 4INDA 3VHRA 1VBB2 1WLCA 3KQRA 1DCSA 3KLSA 5T5JA 3R05A 2EF6A 3VBOB 3ACIA 4HN1A 1XNKA 4SBVA 3NKGA 3WW4A 2BGPA 3MIEA 4LQRA 3GBGA 5FO9B 5CFDB 2PHFA 4N90A 1BJQA 1V6KA 2BBAA 1BLZA 2BNNA 2DCZA 2RM22 3LSDA 1BBT2 1GBGA 2G9FA 2WQ4A 5BXXA 4P9XA 5A7SA 4CXXA 4ZONA 1LCLA 1XPWA 3JD73 1U5IA 2XKPA 3VD4A 4HN0A 5ANNA 3J7HA 5LW9A 2WAOA 1POV0 2OPWA 4PT6A 4O7XA 5CAZA 4QPYA 1ODMA 1CAUA 3H8XA 1F31A 1S0CA 2RM23 3ABZA 2IXKA 2VZRA 1GNHA 4Q4X2 3WVJA 1OF4A 5LY2A 2R6QA 2NPIA 1HJFA 2NM1A 3H7YA 4FPGA 4LHKA 3VBHB 4HKWA 3LE0A 2D44A 4CU9A 5B4XA 4W6XA 5J96B 1A8DA 2PMWB 4XILA 4FPCA 1ASJ1 1FV2A 1GSLA 4LBLA 5L9BA 1UIJA 1IKPA 5T52A 3RQ0A 3HQRA 4BJ0A 2VCMA 3MV11 2A7AA 3GHNA 5AVAA 3N9LA 3D4KA 2X5IA 5JVVA 2J42A 2WJSA 2Q8EA 1DYKA 4OZOA 1O3SA 1DFQA 2R041 3U78A 1WCQA 4GKXA 4KBBA 1AX2A 4N53B 4IDZA 2ENRA 1NA1A 3AP4A 3I3BA 2MNGA 2YFZA 4L2NA 4LTAA 1OPMA 2RM21 1C8NA 2C5DA 4FO9A 4OZXA 4CCMA 4KU7A 4K8RB 2YDEA 4QXBA 1VBB3 3AMNA 3OBAA 3WQBA 5I0SA 5KXEA 4D8MA 1Q43A 5HCHA 1O8SA 5IWFA 1CN1A 2OYZA 5FZMA 3UKVA 1VPHA 3JB8A 1V9U1 3MF6A 4Q4W3 4XJWA 2E9QA 4XJAA 1GMMA 2P34A 2G9ZA 3WDWA 4B8EA 3L2YA 3HNMA 3RI8A 2JG9B 2PHWA 1SFYA 4OI4A 5C4WC 3WF3A 5F5QA 4TSVA 2GMPA 3ZMNA 5FUIA 1GNYA 1S1AA 1WLTA 5LK5A 3CU7A 3GM8A 1VRH2 3URFA 5F37A 1HXS2 1X36A 5DG2A 3S30A 2OUHA 1W2TA 3WW1A 1XNDA 3MFCA 4ZS2A 4CTEA 2CDOA 1PM4A 4AK3A 2VM9A 1AR61 2XLAA 3OBZA 2BP6A 1RUH1 2ZMKA 3DL3A 3ON7A 4HSJA 4KWJA 3VD5A 5A3PA 1AXYA 4QM8A 3PVBB 1W6NA 3KV4A 5LBFA 1XNBA 2R0FA 4A41A 4CZSA 3ZSMA 2R7EB 5FMDA 2XXZA 2VR4A 1K5MA 3L9JT 4P00B 1JYVA 4FOWA 2K0GA 4GWNA 4N43C 4DINB 3C7FA 4A7KA 3A23A 4XUNA 2QBXA 5FAXA 3INAA 2W1WA 5T5OA 1FMD1 1X8EA 1G9FA 4IUGA 3PIGA 4O65A 2DU1A 3E6CC 2JG8C 2WNVC 4OMCA 5FXVA 3VZMA 1FPN2 1H4HA 1GOGA 4DRVA 4P5HA 1ZA4A 2YC4A 3IAPA 3OYWA 3OG2A 3K4ZA 3ES4A 3QLQA 3WDYA 3S0MA 1C4RA 4RS5C 1AXZA 1W6QB 3OY8A 5L7OC 2WT2A 3MFAA 2R1BA 2TBVA 1QGLA 2F17A 3ACGA 3DPRC 3OUIA 1C5IA 5FK8A 3BYWA 4Q2FA 4XBNA 2PHTA 5T3NA 4HVQA 4L99A 3AP7A 3HBKA 3K3NA 3QCWA 5GKAC 2XPJA 2D5FA 1QDCA 5FYCA 5A32A 3T1MA 1EAH2 2XUEA 1AX0A 5F2SA 2ET1A 3WZ1A 2HEVF 3H1WA 4BQYA 1VJ2A 1CPNA 2VUAA 4PQ9A 4Q1RA 3FUQA 1VBB1 4CYDA 3A0KA 4RR3A 4OHYA 3AMQA 1HRI3 4FT8A 5LBEA 1KJRA 3NJVA 1TNRA 2PN5A 1A3KA 1DQ6A 3N9MA 2MEV3 2I07B 2YY1A 3GCWA 5IFPA 3NQHA 3BU0A 1NQJA 2P3IA 5EJ1B 4H3WA 5KWRA 3ETQA 2WAAA 4QPWA 1W8HA 2O8QA 2G9GA 4M0NA 3RGBA 4MGQA 5GJ6A 1SFNA 4LA2A 2VW0A 1REFA 2DVFA 5A33A 5J37A 2WZR3 3THTA 1CX1A 3TEWA 1YNAA 4LLFA 3GJAA 2XKOA 3GALA 3W58A 1KDMA 3KGLA 4DY5A 4LO8A 2WS92 3MPBA 4Q4V1 3VDCA 2QKDA 3LFMA 1WA4A 4HKOA 3OGSA 5IVCA 5JSRA 1XBFA 4LOSA 4D69A 4RR3C 2V4VA 1DQ1A 3EQEA 1HLCA 3I2KA 5IW0A 1Q56A 1COV1 4XTPA 3WDUA 4Y1VA 1UN1A 2JDHA 2RHPA 3H3ZA 4CU7A 2R16A 1WCKA 2WLPA 3F2ZA 3ZDVA 4D3WA 3LSEA 3WHUA 5IK8A 3HWJA 1UZWA 3PUHA 3OPTA 3QBQA 4L92A 4Y22B 2RJLA 4OI0A 1JYNA 2JENA 2EICA 4Y33A 5LWBA 5L36A 4PJYA 5KXDA 2WABA 3DXUA 2ZMNA 1S0GA 3RG0A 1RMU3 4H2AA 2JKBA 3ZO0B 4D0QA 4GWMA 4A6OA 4YGDA 1PGSA 4Y20A 4JTNA 3KT4A 1C28A 5CFDC 4WVWA 2VOVA 1OLME 2GMMA 3GZUC 4AI1A 3POWA 1N3QA 1UQXA 1TMF1 3WG3A 3VUOA 1RUC2 2CL2A 1MS4A 3ACHA 3HN3A 4AI2A 2BRTA 2RG4A 2W9XA 1R082 5CVRA 3LCPA 5FYUA 3VHOA 4R9CA 1G86A 3IIIA 5LEJA 1CESA 1BXHA 3BGAA 3RS6A 3NV2A 4ZS3A 5EWSA 3SQOA 2BWAA 4FPEA 2UY9A 1HKDA 3J8F1 3N9NA 5FZ4A 4X6RB 3DKWA 4GQ7A 5GLZA 4F8AA 3BALA 4RQPA 3PHMA 1RUF3 3HVDA 2KM2A 2HWB1 1KGYA 1WLWA 4MGIE 4XDPA 3PVEA 2DCTA 1QQP3 2EXKA 1JS9A 3NNLA 3V0AA 2BPA2 4KL1A 1W0OA 3V0AB 1S0BA 4NHYA 2RV9A 4PIXA 4CDUA 4GD4A 2GU9A 4XUTA 1YI7A 1V70A 2DBIA 3ECQA 2FMYA 4K8FA 4URTA 4HSLA 4AFDA 4H14A 4CDXC 3N7KA 4AFAA 2WSUA 5JMCA 2IFRA 1NE6A 4AI9A 3NJXA 4ZHNA 1QF3A 4RHV1 3Q8CA 1J58A 2FDJA 3WXPA 2ZJCA 5FZIA 4WZCA 1JZ4A 1L7QA 4B7KA 3LF7A 1YQ2A 2WT0A 1ZRDA 4TZDA 5H9PA 3WG4A 2DTWA 1BEV1 3VDAA 1VMFA 2W0XA 4L0PA 1UY1A 4EWEA 4AQTA 4XJUA 3ZN6A 2GC1A 4A3XA 3RZLA 5E1RA 4EN7B 3MBWA 4QPGA 4BH9A 2WQZC 3H1MA 3TN91 3KCXA 2UY8A 4NPMA 1WBFA 1IS3A 3O0WA 2A73B 3HN1A 1TEIA 1AR72 3AFGA 4OCTA 4HANA 1ND2A 2YGLA 3L2HA 2VXJA 2VW2A 4OUMA 1U12A 3J4UH 4JAAA 2WA4A 5C3PA 4HT1T 1JHJA 2YU1A 1D0GA 1RUC1 1OKOA 2WS93 3WP5A 4BIOA 3FHQA 1DYOA 4WM7A 1H9WA 2J1SA 2X09A 1DDLA 2D6OX 1RUI2 4GKYA 3ZYHA 3PUSA 4PLNA 4YVSA 4CCDA 5BNNB 2D43A 5J36A 2W39A 3RWKX 3N35A 3PNAA 5CFCB 2IXCA 1B35A 1W2AX 2DBNA 3MW2A 4Y3OA 4LO7A 1HIXA 3HOBA 1APNA 1LU2A 1LOFA 3POBA 5IVBA 3KF3A 4KQ7A 4CCKA 4Z1VA 1HB3A 1RXGA 3E1F1 5IFTA 1YXWA 4LK7A 1JZ7A 3I7DA 2RS33 4LORA 4CXYA 3BKZA 2QZ3A 1UNBA 4COWA 2ARXA 2YGMA 3ZYBA 2JICA 1CJDA 1SQ4A 3WOGA 2JG8B 2WNVB 4NR1A 2XMLA 4QHOA 3LZZA 2GMEA 3O5SA 4DZGA 2DWRA 3POJA 4CRQA 4CEYA 2EIDA 1OQ1A 1GZTA 5F7UA 4AXOA 2CGNA 2OXBA 3OBRA 3UKNA 3S7EA
chains in the Genus database with same CATH topology
2CV6A 3H7JA 3VBHC 2HWC2 3ZFEB 3I2DA 1R1ZA 1FV3A 4QX5A 4JVAA 1J1TA 4YVWB 4BHPA 1QNYA 4IV3B 4IETA 2DFCA 1PIV1 4YZ3A 2Q1MA 2KA3A 4CDWB 2IC1A 1O5UA 3B9CA 3MIHA 3VV1A 4JCKA 4LE3A 3WG1A 3CEWA 2AENA 5JAXA 4YGEA 2JX9A 4IEPA 3H50A 1MS0A 4GB33 2QDNA 2ZHKA 2VULA 3VZLA 1UD1A 2PA7A 4E4DX 3HMYA 2B9UA 3WCSA 3BB6A 4JC1A 1KDKA 4WM8C 2GNMA 2WFF1 3IN9A 4ONUA 2WS91 1G9DA 1PIV3 1SLAA 1W6OA 1KS4A 1REEA 2CTVA 1LECA 2QCSB 5GLVA 1OOPC 1DIWA 3ZFEC 2ZGQA 5FLJA 1SBDA 1RUE2 2ERFA 2NN8A 2R062 2EXIA 2ZHLA 1ZRCA 4BE3A 3OD4A 1VBE2 1AF9A 2DFBA 4AEDA 3RSJA 3HIFA 2JG8A 2R073 1X8MA 2WNVA 1Y3TA 2XVGA 3UK9A 3WQ7A 4N43B 1BVVA 3OD0A 1FMD2 3TAYA 1A6CA 3SLIA 3RZZA 2RJKA 1RITA 4I3PA 5K9YA 4COUA 1RVF2 3B94A 1AR73 1ZZ6A 2YUEA 1I9RA 5DUVA 2PELA 4U36A 3ZIWA 4FPFA 4Q0VA 3C2UA 3NV3A 3X29B 4OVEA 3M4FA 4H55A 5GLUA 3TWIA 3MLLA 5J7MA 5DZFA 1XXNA 4KGQA 5BY5A 3LA7A 3M2MA 4AVTA 1H2LA 2EAAA 2BEOA 1ZRFA 4ZKTB 1FNYA 3GF6A 4S2GA 2AH2A 1RHI2 1SDWA 2MPFA 1JBCA 2A6WA 4HPKB 4TWTA 2PFWA 4HPKA 3SCGA 3GZTB 3ACLA 3NL1A 4FPYA 4XFIA 3ZSLA 1OPOA 3KM5A 4RFT0 4XW3A 5D1IA 5JOWA 3ALQA 4YW3A 3ZFFC 2IXLA 3WX5A 1WMFA 4MGZE 4Q4V2 3BODA 3ZPYA 2CAUA 2WNUA 4S2HA 4GH4C 4OHVA 4CP2A 1IPJA 5JSOA 1SEFA 2VGDA 1MS3A 3GNEA 1YIFA 4JRLA 1YYNA 4JGZB 2ZX3A 4RHV2 4XPVA 1O3TA 1KITA 5J3UA 1S55A 3B93A 2R072 2VECA 4NVPA 3LA2A 2QVSB 2RS11 3IDBB 1RHI1 3CNAA 3O14A 5I0RA 2ZHNA 1D2QA 2PLV1 1MQTA 3VBOA 1MQTB 1AR63 2HYKA 1H1IA 1OOPA 3MLKA 2VH9A 4AI3A 3SHRA 4BYYA 5GZCA 4UW3A 1PO11 1FAYA 2P3KA 2ZABA 4MSVA 4W6YA 4XZPA 3SNMA 1AR62 1ZREA 1U0AA 4H7LA 3VKNA 1Q8PA 3QOPA 4E2QA 2ZBJA 1JTZX 1MS9A 1QXPA 4OULA 3D5OA 1ZBA3 4LHLA 1ULGA 3VN4A 3ZYRA 3AJZA 1F2NA 1R081 4N9HA 4YM3A 2HWF3 2B39A 2ZGOA 2R32A 2ZCWA 2OUJA 2PYTA 3RWNA 1GQGA 4DPNA 2Y0OA 1FPN3 1ZZ9A 4NHMA 4KWLA 4UW4A 4WBBA 1IQAA 4BM8A 1JUHA 4QPIC 3B01A 1ULEA 4LT5A 1OMIA 3ZXFA 4RHV3 5ABJA 5FPXA 1C1FA 1NCQB 4JDNA 1QH6A 5BNPA 5ACA3 4UXAA 2GALA 2UYAA 1C3HA 4IXLA 2CWMA 2A71A 3NKTA 1S0JA 4CDXB 2XLFA 1LTEA 3ZXDA 2R071 2WZPP 4NWWA 4FOQA 2RS12 4YM1A 5JI7A 1S0IA 5T5LA 2B5HA 1DQ4A 1RUJ2 4XJZA 1N3OA 3RYKA 2XJPA 3LB9A 2HWD3 3VKLA 3H1YA 3OJBA 1H9PA 1LOFC 2DCYA 3TNPB 4FOYA 1GANA 2Y38A 4GALA 3U0ZA 3DPRA 4I02A 1AYN3 1QJZA 1RIRA 4QXKA 1CAVA 3CJIA 5BNNC 1MZFA 1REDA 3ELNA 2XJVA 4IEOA 1C8M3 5I0UA 1S2KA 1ENQA 3VBOC 3N7JA 3JD71 4XFHA 4QPIB 3BPZA 5D8AC 4XXPA 1JUIA 4G9SB 2AUYA 1BVP1 5CNAA 4LA3A 4KG0A 3W9AA 4CEWC 1OFNA 2IFWA 2OIIA 4GA9A 3IMNA 3VZOA 1R093 2GC2A 4P9GA 2VPVA 2HWF1 4K20A 4N53A 3NW4A 1LR5A 2C9AA 3AZYA 3V65A 5JI9A 1S0FA 2YROA 1RUH3 1UU6A 4KWKA 5BNPB 1C5HA 2OVUA 2GC0A 3S7IA 3TBDA 3GBFA 3M3IA 4PDWC 1RVF1 4PIYA 4AG4A 1MVEA 4YVWC 2HWC3 2P37A 2B45X 2ZHMA 3RJRA 1GZCA 2YZ4A 1O3QA 2HWE3 4QHBA 2RS13 3HT1A 3EJKA 4Q4W1 1KD7A 4QGLA 4WV8A 4IEXA 4Y1UA 1RUG3 3I59B 4JGZC 4ISQA 4PBOA 3BOWA 4PLOA 5H9RA 1NCQC 5HBAA 3HQXA 4QMAA 3MDPA 4NWVA 1LHNA 2BNOA 2VOXA 4QPIA 5SV5A 4D7SA 5GM0A 3R4SA 3MYXA 4FPOB 3RMYA 2XHKA 2BVBA 3ASIA 4B4RA 4JQRA 1COV2 2SLIA 3VBSC 3OGGA 3JBG1 4HZFA 4BLIA 4P9WA 2R0HA 1HXS3 3C3VA 4IEUA 3MIFA 1BYHA 2XWJB 2ET7A 1FX5A 4KU8A 2CAVA 4K6BA 4XFAA 1QHDA 1LOGA 1RUE1 2R061 1J3QA 3J8F3 4NO4A 3LOBA 4R52A 3ZMOA 4XOGA 2RMU2 1EAH3 3ZSKA 4XQDA 1SCSA 2XBO2 3WG2A 5GLTA 1QQP2 2MHFA 4K21A 1W39A 2O1QA 2PAKA 4XF1A 3MZHA 3H8UA 1UZYA 3JU9A 3BTAA 1U5YA 2BW8A 4YW1A 3FX3A 1V9U3 1VB2A 1DQ0A 2JE7A 4AHZA 2IWGB 1M4WA 4YW5A 2WZR2 4FVVA 4NHKA 1AL0G 3ZSJA 4Y1YA 5AC93 2DYCA 1D4M2 4XIOA 3I59A 3ILRA 4C1WA 4M3CB 5GZDA 2Z5WA 4AI8A 4KNCA 4GH4A 4AFCA 4R8HA 5KHKA 2RS53 3R4DB 4JV4A 2JDZA 4LNVA 1W6NB 2H6BA 1WW7A 1X33A 2FHRA 2PHRA 3HD8B 2NMNA 1JH5A 3RNSA 1TQ5A 1LEDA 3M3CA 2JD4A 2VNOA 2C1FA 4YW2A 1CAXB 4BPZA 3VKOA 3H3UA 2XL9A 2RR12 1FI2A 1AL23 1EYBA 4IEWA 3ZYPA 2YC0A 3M3EA 4XJ8A 2WKKA 4Y22A 4Z92B 4J6GA 5L7OB 1L3JA 2E53A 1G7YA 1U5XA 3JBG3 4C91A 1ZBE1 2XL7A 3JUUA 4K9SA 5FQ0A 4N53C 3M3QA 4R4ZA 5K8SA 2F6BA 3AKQA 3G7DA 4UW5A 4XE9A 1AXKA 2ZACA 2XJRA 3J26N 3KGZA 1VBE3 1J1LA 1ULFA 3I4IA 1ENSA 2EVXA 3BCWA 2H0BA 3RPQA 2K9ZA 3OF1A 1RMU1 1EV13 2CGOA 2CYFA 1ZBA1 4QQHA 3FLTA 1R083 5BNNA 3D8CA 2VUJA 3D0JA 4LBQB 4XF0A 4LBQA 4GIQA 1TMF3 2XGXA 5T5PA 1LENA 4LLOA 1VBA2 3NAPB 1LHUA 3NAPA 5JZGB 1Q5OA 2YPJA 2I74A 1OA4A 5KXCA 1F9KA 1POV1 2Q0AA 4F7ZA 3VKFC 5FBZA 1ZZBA 1VBA3 1FMD3 3N7LA 1WW4A 1Q8VA 1ZVFA 4WM8A 2Z79A 1D0HA 5FCCA 3AYEA 4XF4A 3B5LB 4CDUC 3MICA 1FOD1 3JBG2 4DB5A 3VBUA 3ZYGA 3GYDA 1EPWA 3P3PA 2ZOEB 3ZDSA 1AR92 4YZ2A 4GMP1 1SLBA 1GKBA 3WUCA 1RVF3 2DF7A 3IDCB 2CGPA 1PIV2 2W68A 5GLWA 4D7YA 3DPRB 1LHWA 1TNFA 2Z42A 3NJZA 4RS5B 1LHOA 1UKRA 1BEV3 4C0BA 3JQWA 3B3QE 1AZDA 4EJRA 5I93A 1UF2C 3B02A 4L11A 2PLV2 1LEMA 1VBC2 4AGGA 3WW3A 1K5MB 1O4YA 4X6QB 4WM7B 5GZFA 2HEWF 1UZZA 4E4ZA 5CA6A 1RB8G 3CO2A 3USUA 4DOUA 1QJU2 4AEKA 1AR71 5CFCA 1DGRA 2XJTA 1FYUA 5AVPA 4CDQB 1URXA 4DNYA 4WVVA 1VALA 2QDRA 4XYXA 4EN6B 3AP5A 1W6OB 3B00A 3KD4A 5JZGA 2V5YA 5BNOC 1OSGA 4GMP0 1IGOA 5IUQA 1H2MA 4DRRA 1LODA 4I09A 3FMGA 5BV6A 1LRHA 1JW6A 1G9AA 4CEWB 2BBVA 3AP6A 2XVKA 3EO6A 5GALA 3QACA 2WWSA 2ZAHA 4P9IA 5DDJ2 1RUI3 5JR7B 1WD4A 4PLMA 5FOBB 3M8LA 4ATEA 3FZ3A 4Q0UA 4UBHA 1AJKA 2ZX4A 4XFGA 3WDVA 4YNIA 5EJ3A 2BTVC 4E2GA 2P17A 3SISA 4BZ4A 4DXZA 2E7QA 1ZBE2 4YGCA 4EWAA 1YFYA 1VBC3 2R49A 3IBMA 1XYOA 2R30A 2B42B 1DYPA 4ZXKA 1TE1B 1ND2B 2XJQA 4MZUA 2ZX1A 1XNCA 1O4ZA 4AQ6A 5JCTA 1RUJ1 4RA0A 4MGYE 3IIAA 5K0UB 1LOEA 1JXNA 4Y24A 1PZ8A 2JECA 1AR81 2GNTA 2ZS6B 4XF9A 5CIRA 5JPMB 1RUF1 1RHI3 2ZX2A 1A78A 4XFFA 2X29A 1W6MA 1W6MB 1PK6B 5LK7B 2G4IA 4QQ2A 5JDBA 4R4XA 4IEZA 4YYOA 4N7UA 3UJQA 1W6QA 3E97A 2WNUB 1YJKA 2GNDA 2UWCA 2E7TA 2WFF3 1G9CA 3PTYA 1TME1 5F9TA 1RUE3 2R063 2GNBA 1RJ8A 4N43A 3VDDB 1RUNA 4AVBA 1H8VA 4AF9A 1YUDA 2MEV1 2VQAA 5JSPA 1A8MA 4FPKA 5C33A 1AYN1 4I01A 4QU2A 4FAHA 2C0ZA 4C1XA 3K51A 2UURA 1PO12 2X8KA 2QZ2A 4XDQA 3ZN4A 1I6XA 4Y1XA 3AYDA 1PO22 1QDOA 1XU1A 3CJXA 2ZGMA 2OA2A 2WT1A 4YZ5A 1EPZA 3IPVB 1FNZA 2VXRA 4FP2A 2Q30A 2GDFA 4Q27A 3AYCA 2O0OA 3B69A 4IL7A 1VBC1 4R9DA 3DN7A 5GZEA 2AR6A 4K1YA 2HJIA 2D3SA 4JGYB 4MX3A 5JPNB 1R1A2 1PK6A 1QMJA 2XJUA 1H2NA 1PO13 1PM7A 2ILMA 3MIBA 1RUH2 2YXSA 3MIGA 4W65A 3TRSB 1YLLA 1V6OA 5HCFA 2DV9A 5H9QA 2XBO3 2OZ6A 4Q8LA 4QPGB 1HQWA 1PNFA 2EALA 5EYYA 4JGZA 5FLIA 4AVCA 4COYA 1NXD1 2W52A 4Z8BA 1CIWA 1FOD2 4RGAA 3VDDA 1UKGA 4FP3A 1O4TA 1Y43B 3LGRA 1ZBE3 1GZ9A 4UW6A 4LHNA 5CB7A 2MEV2 4KH9A 4OI1A 1DHKB 1ND3A 5AC92 4FQ4A 4YM2A 1GR3A 1QJY1 4OLLA 5D8AB 4O9GA 1VBE1 2X53S 1N3PA 1YJLA 1DG6A 1WMEA 2QFEA 2VOKA 4IEYA 2PAEA 5H9SA 2XBO1 1KFXL 1SLIA 2HWB3 4AQ2A 4EN8B 5CG9A 1OI6A 3EXUA 1B35C 4CDWC 5ACA2 4JDOA 4BLJA 3NV1A 3SITA 1RUD3 2D6PA 1ZYBA 1MEC2 4YGBA 4C0HA 1UX6A 2D5HA 4DY3A 1ZBA2 4Q0PA 1CPMA 3O7OA 1O3RA 1OD5A 4IV1B 2Q5TA 4XETA 5KC5A 1V6LA 3USSA 4AE2A 4PDWB 2RS31 3KSCA 1V9U2 3DGTA 5KBFA 2A75A 4O9EA 4YARA 3VBUB 1K5MC 3ZVXA 3ZFEA 4Y1ZA 4MYEA 4AEDC 2A6ZA 1HRV3 4MXVA 1D4M3 2DVDA 3OTFA 2N7GA 1FOD3 3M3OA 1DZRA 1U5ZA 3CJIC 2BQPA 3ZN6B 1ENXA 3HR9A 2R043 1YCIA 2NYYA 4EWDA 2BGCA 1LHVA 4LBQD 3WY6A 1BKZA 1H0BA 1MEC3 1E57A 3CL1A 4XBLA 5FLHA 1PHMA 4CDXA 1LKNA 2RR11 1H8TA 1VAMA 1OLRA 1H8TB 2DU0A 4R9AA 4C90A 1DGWX 3PJYA 1RUG2 5E88A 4HVOA 1QY4A 3V56A 4BQ1A 3AKPA 2BYVE 3A4UA 1NY72 3VBRB 4YVSB 3EHKA 3E5XA 3BU7A 2WA3A 4WZFA 1KQRA 2NP0A 4ZU7A 3ES1A 1CD3G 2BWCA 5IK5A 3H9AA 3WQ0A 4IV3C 3RI9A 3V0BB 1IZ3A 1LU1A 2YMZA 3T2TA 3IDEA 3IKWA 2WNUC 3WDTA 3ZIXA 1YO8A 1W0PA 2ZZJA 3VBHA 2A6VA 3RDIA 2HWC1 1AVBA 5FREA 4AEDB 1BZWA 2A3XA 4WVMB 4IV1A 5SV8A 3CLPA 2TNFA 1YRZA 4CEYB 2DVAA 3FWEA 4GMP3 3FE5A 1QJX2 2DUPA 3SH5A 2V09A 3ZXJA 3UV9A 1QOOA 2JXAA 4HBNA 5K7PA 2HWB2 1BQPA 3E5QA 4Y5Z0 4BCUA 1PNGA 4TLFA 4LEJA 1LB2A 1R091 2PHLA 1CAWB 2A5ZA 2H0VA 3ZFFB 1CAWA 1YHFA 1H1AA 1MZ5A 5CFCC 1BBT1 4META 1EV11 2A70A 4YVSC 1HRV1 3MEPA 2HWE2 1WCDJ 1AYN2 1N1VA 3UL2A 4FBFA 4L97A 2BFUL 2PAMA 1RMU2