2AUYA

Pterocarpus angolensis lectin in complex with the trisaccharide glcnac(b1-2)man(a1-3)man
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
240
structure length
240
Chain Sequence
EDSLSFGFPTFPSDQKNLIFQGDAQIKNNAVQLTKTDSNGNPVASTVGRILFSAQVHLWEKSSSRVANFQSQFSFSLKSPLSNGADGIAFFIAPPDTTIPSGSGGGLLGLFAPGTAQNTSANQVIAVEFDTFYAQDSNTWDPNYPHIGIDVNSIRSVKTVKWDRRDGQSLNVLVTFNPSTRNLDVVATYSDGTRYEVSYEVDVRSVLPEWVRVGFSAASGEQYQTHTLESWSFTSTLLYT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords lectin
publication title Structural basis for the recognition of complex-type biantennary oligosaccharides by Pterocarpus angolensis lectin.
pubmed doi rcsb
molecule tags Sugar binding protein
total genus 52
structure length 240
sequence length 240
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00139 Lectin_legB Legume lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2auyA00
2CNAA 2ZHKA 2JE9A 3FUQA 1FNZA 4XMIA 1U0AA 3VKNA 3ZSLA 4BM8A 2R49A 2WJSA 2A6YA 4XZPA 5HCFA 3ZSJA 1LHWA 2DVGA 2P3KA 3TAYA 2GNBA 4Q26A 1MR5A 2A70A 2EXHA 3WV6A 1G86A 1LU1A 4WZFA 1LULA 1FAYA 4YGBA 2XG3A 1DHKB 3ZYRA 1CVNA 5JLVA 4Y1XA 4WVWA 5KXEA 3OBRA 1GZCA 3V0BB 5GJ6A 2ZMKA 4LBOA 1S0BA 3SH3A 3N7KA 2R1BA 1W6QA 4LBQB 5JMCA 3NV3A 5JOYA 4XOGA 1WLCA 1LTEA 4M00A 1JN2P 3ATGA 1KQRA 4FPKA 1N3PA 1G9BA 3AYCA 3WUDA 3ZSMA 2ZGKA 4BLIA 3D6EA 1DQ5A 2ZGQA 1N1SA 1BJQA 2TEPA 3ZPYA 4ITCA 2P34A 2WSUA 2R16A 2WT2A 1VLNA 4D69A 3M3CA 3DUIA 4FOYA 5DUVA 3IPVA 2GALA 4AVVA 2GMMA 4Y1VA 2GN7A 3APBA 2YV8A 1IKQA 5CAZA 4YG3A 2C5DA 1C4RA 2DV9A 3DGTA 4Y1ZA 5IK4A 4P9WA 1XQNA 3I4IA 1YRZA 4Q2FA 4Y20B 1MS4A 3GALA 4C1WA 4Y1UA 2E6VA 1S0EA 4XJ8A 1A78A 1OFSA 2YY1A 3WDXA 2VY0A 4BOWA 2AUYA 2UWAA 3KM5A 3RMXA 1J1TA 3RRDA 3B69A 2NYYA 2D6NA 3GNEA 5CBLA 1GZWB 4DRVA 4XJUA 1ENSA 2DUPA 2E7QA 5GLWA 1GV9A 3OY8A 1WLWA 2FMDA 3POSA 3WOGA 1MS0A 2P3JA 4GWNA 2NMNA 1JBCA 1SLCA 4P14A 3AP7A 1SLAA 2OUHA 1ZA4A 1QGLA 2D44A 3N36A 1GKBA 5GLUA 3B9CA 5EXOA 1RIRA 2GNDA 4GALA 5GLZA 2ZGNA 1UZZA 1GLHA 2CWMA 3TB0A 5IT6A 3D5OA 3FLPA 3FFZA 4CZSA 3USUA 3M3OA 3R05A 2P3IA 1IS4A 1BQPA 4ZXKA 5SV8A 4FOQA 3WLUA 3PMEA 1W6PB 2UWCA 1DZQA 1LHOA 2A6XA 3UJQA 1ONAA 4XHBA 2ZGTA 2A7AA 3WCSA 2A71A 1DQ1A 4GWMA 4YW1A 2ZMNA 1AF9A 3ZXKA 2GNMA 4BMBA 3M3EA 2DTWA 4XJAA 1O4YA 4CTEA 1S0CA 1DQ0A 1UZYA 4GXLA 4YM2A 4YLZA 1W6MB 3SISA 1S0GA 1QKQA 1LGNA 1Q8SA 4XIOA 1QNWA 1H9WA 1QU0A 1SLTA 2WQZC 2W52A 1SLIA 1ULGA 2GDFA 2D6PA 3CNAA 1CQ9A 4BPZA 4YZ5A 2HYKA 2PELA 2DU0A 4YW3A 2VU9A 3OBTA 5GZFA 5DUXA 1RINA 5HCBA 1R1ZA 2UURA 1WUVA 3N7MA 4Y1YA 5GZGA 2ARBA 3BODA 1DYPA 3NV2A 4ISRA 2EXJA 5CA6A 3WHTA 3WCRA 2GMEA 3A0NA 3BTAA 3N3HA 1MS5A 4XJWA 4RL7A 3INAA 2ZA9A 3RSJA 2AH2A 5T5JA 1CR7A 2P2KA 2ZAAA 1QF3A 2EAKA 1MS1A 1JOJA 4Y22B 3ZXEA 2EIGA 4XYXA 1G9DA 3OYWA 1DBNA 2GMPA 1QOOA 1C57A 3NV4A 3HMYA 4M3CB 4UW3A 5T5LA 5E8AA 1JYCA 3SNMA 3WDUA 1S0IA 4KBBA 3T2TA 4JC1A 1G9CA 3OJBA 3O0VA 1V00A 1KDMA 1FV2A 3ASIA 1KJLA 1UKGA 1GANA 3LCPA 5E88A 1YYNA 2DVBA 2D7FA 3SLIA 3ZXJA 3AJYA 5F9TA 1AXKA 1ENRA 1YXWA 2P37A 2A6WA 1DQ4A 4M3CE 1D2SA 2PHXA 1OQ1A 3WUCA 4R9DA 5T52A 4FPHA 1TEIA 1JYIA 2NZ9A 3AYAA 4XMAA 1W0OA 1V6NA 2CL2A 2VW0A 1LEDA 2YMZA 3L2YA 4R9AA 1GNHA 5KXBA 4DQAA 5H9PA 3VKFC 4XE9A 2DYCA 1LGCA 1LOBA 4NOTA 3N7JA 4LBNA 3FLRA 4CRQA 1FV3A 2NN8A 4XBNA 4YZ1A 1JHNA 1DFQA 4JCKA 2A6VA 2NMOA 4YM3A 2WKKA 3I8TA 4FOVA 1IS5A 4FPJA 4W65A 1AX2A 1W6NB 4FPYA 1LECA 2ZABA 1HQWA 1Q8PA 2DWRA 4FPLA 3T1MA 5IK5A 1W6OB 4YFWA 1LU2A 2PHRA 5GZCA 1HKDA 4FPEA 3WNXA 2CY6A 1LOGA 2SLIA 4H55A 5GZEA 4K20A 2ZACA 3HN1A 2EXKA 1CPNA 2W08A 2ZHNA 3RMYA 3AP6A 3Q9OA 3SH4A 3V0BA 1I3HA 2ZZJA 1WCSA 5T50A 5CB7A 1S0DA 2NM1A 2FHRA 1MS8A 5FRAA 3PJQA 4SLIA 4LBQA 1AX1A 4XJZA 2R0HA 4Q8KA 2AENA 2KM2A 1EPWA 3V65A 2AR6A 1AJOA 2R0FA 4TYSA 3SITA 1LHVA 1A8DA 4Q27A 1DGLA 4AGVA 3NV1A 1MZ5A 1SCRA 1MVEA 1BZWA 3WDWA 5GLVA 3WVJA 1AVBA 1BYHA 1QOTA 4YG6A 4JRAA 5T5PA 1G9AA 2JDZA 2A3XA 1F31A 5DG2A 1FATA 1JXNA 1LESA 1PZ8A 3IMNA 1C1FA 1ULCA 1SLLA 3MW4A 1Q8VA 1V6KA 3ENRA 3AZWA 4YM0A 4BQ1A 1O4ZA 2ZGLA 1VAVA 2E51A 1SFYA 2ZGOA 5LK5A 3VV1A 1APNA 2PHFA 4XBQA 2DVAA 3B3QE 4FPFA 1WBLA 1Z78A 3M1HA 1DYKA 5IK7A 3NWKA 4Y20A 4XBLA 5GLTA 2CWSA 4Q1RA 3ZSKA 1V6IA 1AZDA 2ZGMA 1H9PA 2C9AA 2CTVA 3AP4A 2JECA 1Q56A 1LOFC 1QOSA 3N35A 3POWA 4RA0A 5T55A 3WG4A 3O0WA 3U4XA 1URXA 3R4UA 5DZFA 1LODA 1MS3A 2D6KA 3V0AB 1SBFA 4LBQD 4NO4A 2E53A 5EYXA 3AYEA 1GZWA 3ZVXA 4C1XA 1VIWB 2XB6C 1H30A 3WZ1A 4XTPA 3VKLA 2DVDA 2SBAA 1V6LA 2ZGUA 3T1LA 4BMEA 1G9FA 4LBLA 2ERFA 3AXEA 3OYWB 1ENQA 2EF6A 4ATEA 3LSDA 1KITA 4FQZA 3RG0A 2GNTA 1IKPA 2D43A 3QCWA 4U36A 3VUOA 4FPOB 4YGCA 3SH5A 1KJRA 2DURA 3MW3A 1NLSA 3AK0A 5JOWA 4YZ3A 1GYKA 4YW4A 1NXD1 4Y24A 1PZ7A 1SBEA 1N3QA 1Y7BA 2JJ6A 4GKXA 5E89A 1RITA 1JUIA 4K1YA 1UAIA 3WHUA 2NP0A 4HANA 3O12A 4R9CA 2B7YA 3FLTA 1JW6A 1YIFA 3MEPA 1FYUA 4MYEA 4WV8A 3AXDA 1QDOA 2CYFA 1DIWA 1W6QB 2D3RA 2EALA 4YM1A 5F5QA 5KXCA 1UL9A 2R1DA 1WD4A 4IQPA 4YW2A 5H9QA 2YZ4A 3LSEA 1SBDA 3ZYPA 5T5OA 3UJOA 2ENRA 1DLLA 1LOAA 2ZBJA 4LBJA 2WLQA 1A3KA 1W6MA 2WNEA 2OW4A 1F5FA 2ZHMA 5JOZA 2AREA 2ZGRA 4AYUA 1Z0HA 4UW5A 3KQRA 1LOFA 1Q8OA 1GBGA 2UU8A 1BXHA 2A3YA 4PCRA 5T54A 1N1VA 3O0XA 3W59A 1X50A 2D3PA 2ES3A 2VXRA 3IM0A 3IPVB 2A6ZA 1B09A 3WDTA 2W68A 3VKOA 4AGGA 4XXPA 4BLJA 1YO8A 4FPCA 4YFZA 1GSLA 1WW6A 5DXDA 3OPZA 3O5SA 4YW5A 5H9SA 2PHWA 4P9YA 4DPNA 2AGSA 2BQPA 4UW4A 4GKYA 4AVSA 2V5YA 3ZXLA 4F83A 3FUOA 2LTNA 3PVOA 3B01A 3AFKA 4PQ9A 1LOCA 4FPGA 1N47A 4Y22A 2A75A 2Z42A 4XILA 5GALA 2D6LX 5BYNA 2A3WA 1UX6A 3OGGA 1CJPA 3POYA 4YGEA 1IS3A 4M3CA 4HL0A 4M01A 3OY8B 1BKZA 3VKMA 3JU9A 5EYYA 5IUQA 1ULDA 1V6OA 1WBFA 1QMJA 3IN9A 4PF5A 2GN3A 3WG2A 1YI7A 3AX4A 3QLQA 4AVTA 1N3OA 3A0KA 3AZZA 1WD3A 2PHUA 3V64A 5GM0A 3N7LA 1QNYA 5IK8A 1Q8QA 3AP9A 3HR9A 2YXSA 4TZDA 2ZGPA 3AZVA 3USUB 1W0PA 3PVEA 3JUUA 4DFSA 5JOXA 2OUJA 5JDBA 5L73A 3WG1A 1PZ9A 1V6JA 5AVAA 2ZGSA 3PVNA 4YZ4A 1AXYA 1IS6A 2D6MA 1CONA 1AX0A 1SACA 1LOEA 1ULEA 4AWDA 2DTYA 1CN1A 2JE7A 3MW2A 2PHTA 4FP3A 5DUWA 4FVVA 1G7YA 2AYHA 4P9XA 1V6MA 2JD4A 1LEMA 3M3QA 4M3CF 1CESA 5KXDA 2ZHLA 3AZXA 2VUAA 4R9BA 2A5ZA 1DQ6A 1QDCA 4Q1PA 4Q8LA 4WVVA 3A4UA 5H9RA 3W58A 1HDKA 1W6NA 1C1LA 1GZ9A 3WDVA 4YG0A 2VW2A 2ZKNA 1S0FA 1W6OA 2G4IA 3R4SA 2DUQA 1LGBA 1UN1A 1F9KA 3H0OA 4U2AA 4Z8BA 1ULFA 4UW6A 3UL2A 3BOPA 3ZXFA 2RHPA 2I2SA 2D3SA 1HLCA 1LHNA 4XDQA 1WW5A 4AGRA 5EWSA 2WSVA 1FX5A 2Q5TA 2DU1A 5DZGA 1S0JA 2YROA 4LBMA 1UMZA 1HQLA 1AXZA 3IKWA 4XIKA 3AZYA 1KDKA 1D0HA 4XTMA 5CNAA 5DZEA 4DRRA 4DS0A 1IOAA 2DVFA 1MVQA 2EXIA 2OVUA 3ILRA 4XJ9A 4FOWA 1MACA 1I1EA 1MZ6A 1LCLA 4I30A 4YZ2A 1FNYA 1G8WA 1GICA 3RQ0A 2D6OX 1KRIA 1VAMA 3M2MA 1N1TA 3B00A 1LJ7A 2VH9A 2DUOA 3C2UA 4ASMB 4K1ZA 4PBOA 3ILFA 4L8QA 3ILNA 1SLBA 3FBYA 2VW1A 3WG3A 2LALA 4ISQA 3AYDA 3AP5A 5DUUA 4LBKA 5GZDA 2WT1A 3WDYA 5FREA 2H0BA 1W6PA 1S1AA 3UK9A 1DQ2A 1MS9A 1OKQA 1WLDA 3RS6A 2WT0A 4FQ4A 3MPPG 4XHXA 1VALA 1ZM1A 2JKBA 4OZXA 4YGDA 5DG1A 1GNZA 4PBPA 1AJKA 1CPMA 5HCAA 4ZKTB 2ZMLA 2W39A 1LENA 2E7TA 1WW7A 4FP2A 4ATFA 1CIWA 4XXAA 2V73A 4GA9A 4K21A 1LHUA 3V0AA 5JVVA 3D4KA 1N1YA 2UWBA 1SCSA 3BIWE 1UPSA 4Y26A 1WW4A 2ARXA 3AJZA
chains in the Genus database with same CATH superfamily
2R6QA 1OMIA 2W9XA 1JZ7A 1FNZA 4XMIA 3VZMA 1UIJA 2R49A 2WJSA 4XZPA 5IVBA 3ZIXA 2BNMA 2DCKA 4Q26A 3NQHA 1IQAA 4BQ2A 5FP9A 1JOPA 4KGGA 3H8XA 3EB7A 2YDEA 5EHDA 1NOVA 4YGBA 3ZYRA 4HSJA 5DMYA 5JLVA 2BVBA 3PTRB 4WVWA 4GH4B 3GBFA 5GJ6A 3ZMOA 2ZMKA 3HVDA 2ZEZA 1ZRFA 2VNVA 4JV4A 3MLKA 2XLFA 1W8UA 3KGLA 4AQ2A 2R1BA 4AFDA 1W6QA 2VNRA 4LBQB 1RUE3 5JMCA 2R061 3NV3A 4AVCA 4INDA 2FCTA 2UYAA 3DYOA 4AQTA 3ATGA 1KQRA 4PT6A 4CVUA 2C6SA 3U14A 3WUDA 4DO0A 2HWB3 1C8M3 3ZSMA 2ZGKA 1MQTB 1X33A 2CHHA 3E5UA 4IEXA 4Q4V1 1POV1 4JKMA 5IVFA 3VBFC 1AYM2 4XFBA 1RGSA 2AEYA 3WR0A 2XKOA 1XSRA 3ZPYA 3MIDA 1BBT2 1RHI3 4BH9A 4C91A 4JGZA 1JYWA 1W8NA 2FZ2A 3DV8A 3HNBM 3POJA 4P9GA 4Y1VA 5DDJ3 3APBA 2YV8A 1IKQA 5KHJA 2JDAA 2DBNA 3VBUA 3C8XA 2AEZA 3U10A 5FK8A 4QHZA 3N9PA 4NIAA 1OQEA 2WWJA 4G3YC 4MXWA 4ASLA 4M4RA 3GALA 4XUTA 4B4QA 2ATFA 4I09A 4Y1UA 1RUG1 1HN1A 4C1WA 5FZ4A 1A78A 4UI9L 5FPBA 2YY1A 3OTFA 4QQHA 1K3IA 4IV1B 2X5IA 4DUVA 4BQWA 2UWAA 5KR7A 1WCQA 2Q8EA 1AL21 2D6NA 3ZYHA 2R7EB 4COWA 1W8OA 3AC0A 4IETA 1UYXA 3OY8A 2XBO3 4RQPB 1JUHA 4JKKA 2ID4A 3BN6A 2DFCA 4GWNA 4XFIA 2I74A 2BGCA 3EMRA 1RUOA 1GNYA 1RVF2 2Y6LA 4FFGA 5FZ8A 3ZYGA 3THTA 1V0AA 2XH6A 4AFMA 4AI0A 2Y8KA 4GALA 4QAWA 4LK6A 1UZZA 1QWRA 4YWAA 4XURA 2CWMA 5IT6A 2RS52 1OD5A 3DPRA 3JBG1 5C5TA 1LRHA 4YW6A 1IS4A 1BQPA 2YYOA 4ZXKA 2QUOA 3GZEA 3HJRA 1US3A 2WAOA 2ZCWA 4L0PA 2RS31 3LA2A 2QZ3A 2V5DA 4PF1A 1HJFA 1R64A 2ZGTA 5C9AB 3WCSA 3KB5A 1F4HA 4OHZA 3OD0A 2IC1A 4GWMA 2BPA2 2GU9A 4JGYA 5ISLA 4QPWA 4QX5A 4L92A 1RUNA 5EPAA 1ZNPA 2DTWA 3VBSB 3TWIA 1DQ0A 4F7ZA 4Y4RA 1UXXX 4COYA 2HKXA 2OZ6A 2ZS6B 4YLZA 1W6MB 3J8F2 1S0GA 5LWBA 1LGNA 4XIOA 1QNWA 3WF1A 2IXLA 2PAKA 2VTFA 4QX0A 2W52A 3CNAA 3NL1A 3Q8CA 2VNGA 2O14A 4ZU7A 4YW3A 2PYTA 4XCAA 1CZTA 3ZIWA 5HCBA 1R1ZA 3NKTA 1WUVA 5GZGA 3O1RA 1VBC3 1RUD2 2BZDA 3BODA 3WHTA 4IE7A 2GMEA 3WCRA 2W1QA 1O3QA 4N9HA 4BWOA 1XE7A 4XJWA 4CCDA 1W3XA 4P9JA 3RSJA 1XNAA 4AEKA 1CR7A 2ZAAA 3DKWA 1FOD1 4IV3C 2G9ZA 1UD1A 3C7HA 4Y22B 1TNFA 2EIGA 2PMWB 4PLMA 4IE5A 4TN7A 3HMYA 1NXMA 5LA0A 1ACCA 3DXTA 5ACA3 4KBBA 3S0MA 4COVA 4JRLA 3OJBA 3O0VA 2OQ7A 3ON7A 2J1UA 4CCJA 1EV12 3LCPA 5L7OA 4HK8A 4HXCA 1YYNA 5I8YA 2VZVA 2DFBA 3MFAA 1ENRA 1K5MA 1PGW2 2UY8A 1D2SA 2PHXA 4M3CE 5BNPB 1H6YA 1WWYA 3G7DA 3ES4A 3H3UA 4N9IA 2Y60A 2PLV3 5FK7A 1AR62 4R9DA 5A6XA 1P8JA 1ZBE1 4EWEA 5T52A 5D2AA 1V6NA 2VW0A 1LEDA 3K3OA 5KC5A 1VBE1 2QKDA 4XW3A 3DEMA 5JI7A 3JB8A 3CDZB 5FZKA 3CMGA 1XJAA 1YCIA 2J22A 4MGYE 3PVBB 5FYIA 2HWF3 2VZQA 4IGOA 3ZFEC 3ZYBA 2CSGA 2VC9A 5FJHA 1ZRDA 4XPVA 4Q0PA 1KS5A 4CU6A 5BY5A 1JHNA 2VTXA 4JCKA 2Z69A 2P3YA 4IEZA 3AMMA 3NAPC 3EHKA 1NZIA 3TEWA 1IS5A 2BV4A 4OI2A 4P02B 1W6NB 4BQ4A 3F95A 1ZYBA 5A32B 3ORJA 5IVEA 4JVAA 3FZ3A 1HQWA 4OFGA 2DWRA 3P5BA 4FPLA 2CU5A 1U12A 4YFWA 2IVJA 2B9VA 4H55A 1LOGA 1GFF2 2XL7A 3FE5A 4L97A 3K75B 2ZACA 4YVWB 4GH4A 2EXKA 1CPNA 2ADEA 4Y3OA 3RMYA 3ZFFB 3BGAA 1W2NA 3OGJA 2VMHA 3BU0A 2ZZJA 4LE3A 1WCSA 3CZUA 3BCWA 1AR81 4ZS2A 4LBQA 5TSWA 2VZSA 3H8RA 3Q8FA 3C7EA 3SMHA 2EIBA 1ST8A 4LEJA 5EJ1B 3THPA 4FSJA 2AR6A 4TYSA 2R0FA 3SITA 5FY9A 1LHVA 1A8DA 1BHGA 4AGVA 3NV1A 5FZIA 5A33B 5F5CA 3ZX7A 3NNMA 1MQTA 3S5AA 3VBOC 1ASJ3 2RMU2 1PGSA 2FDHA 2JDYA 4CP9B 4YG6A 3UV9A 4Q4Y3 3K4ZA 3AL5A 4RGGA 4W6YA 2FDIA 3O1VA 1J3QA 4F3JA 1FATA 4B8EA 1C1FA 4K9SA 1TME1 3T2OA 1SLLA 1HRV3 3ENRA 4YM0A 1O4ZA 2ZGLA 1OBNA 5K0UC 1PIV2 3T2QA 1Y9GA 1DYOA 3E1F1 5LA1A 1DGRA 1Z78A 4KG8A 2Y6JA 3I2HA 5AVPA 2ARAA 1HJGA 2X10A 4AEMA 2MEV1 4XBLA 5EJZB 4QM9A 4LKFA 1OOPB 3ZSKA 1AUYA 4UT5A 2P6CA 4CDWB 3U4XA 4Z82A 4LLFA 5T55A 3POWA 4IV1A 4A3ZA 3CF6E 2WNVB 2Z5WA 5A7NA 5JUVA 3R4UA 4ZU5A 3JXSA 4TTGA 1VBB1 2QDNA 3ZVXA 1VIWB 5LBBA 4RQPA 2DVDA 4AHWA 3OBAA 1V6LA 3T1LA 2W1SA 1G9FA 2MHFA 2WO1A 1ENQA 2EF6A 4RR3C 1GP6A 4CEWC 2VMEA 3IDCB 2GNTA 3T30A 1CZVA 2TNFA 4YGCA 1VR3A 5FYCA 3WP4A 2B9UA 2DURA 2Y34A 4AEDB 1UZ0A 4CU8A 1D2QA 4CDUC 2JB4A 4YW4A 5APAA 4Y24A 3AMHA 5E89A 1Y7BA 2JG8C 1RITA 2R042 3MYXA 3MPBA 1AYM1 1UAIA 3WHUA 4HANA 4B4RA 3WF3A 1WLTA 1FXZA 1OLME 2NLRA 4LLOA 5LB6A 1FYUA 4WV8A 5DAXA 2D3RA 4YM1A 3H1WA 2HYXA 2PTMA 5C9AA 1XNBA 5KHHA 1WD4A 1XNTA 1Z7S3 2ZEWA 2E31A 1AR92 4AK3A 5FP7A 1L7LA 2TUNA 3LSEA 3VBSA 3ZYPA 5F37A 5T5OA 3UJOA 4EROA 4JAAA 4P5YA 2K2SA 1LOAA 1NE6A 1A3KA 1VAKA 1W6MA 2ZGRA 2V72A 4Y5Z0 2JDKA 2I45A 3KQRA 1LOFA 4W4ZA 3PUSA 1GBGA 2UU8A 4IEQA 5CKNA 2UYBA 4NROA 1FMD3 5G05L 4QXBA 4QGLA 4I2OA 2A6ZA 2HBTA 2CGNA 3AL6A 4AGGA 5BNOB 4ZONA 1X82A 4KL1A 1GSLA 2KR2A 5DXDA 2WYSA 4XF3A 3OEBA 5H9SA 1J58A 5FTTC 1HRI2 2PHWA 2JG9B 5FY4A 4DPNA 5JIUA 1UKRA 5KHIA 3ZXLA 4BQ3A 1R1A3 2LTNA 3O7OA 3KCXA 3PJYA 5CKMA 3AKPA 3PVOA 1QXPA 2QTWB 5FXXA 4GZ9A 2I07B 2Y26A 1PO13 1N47A 4FPGA 4Y22A 4ZU4A 5SV5A 1PX4A 1ZZ7A 5GALA 5A3OA 2A3WA 2FQPA 2D93A 3G6JB 4LULA 2C1FA 5BYNA 5IYYA 1CJPA 4MV2A 3THCA 3BTXA 3JU9A 2OIIA 3T3YA 2YBKA 2OS2A 5EYYA 1K42A 1LNSA 4D6QA 1V9U1 1W8TA 1WBFA 2QJVA 3IN9A 4IEPA 4LO4B 4O61A 3S7IA 5FKBA 3WG2A 3LDKA 3QLQA 4Q0SA 3DKQA 3AZZA 5FYBA 1WD3A 2QQKA 3TEZA 3HAGA 4QX2A 2O8OA 2Q1MA 1QNYA 1CD3G 1H2KA 4LHLA 4CU7A 5IK8A 1RUE2 3QOPA 1EUTA 2BVVA 2VBBA 2OT7A 3AP9A 3HR9A 4OHXA 4S2DA 4BQXA 2IUWA 3DCQA 3N9NA 3S30A 4AVAA 3AZVA 1KS4A 4PDWC 1NAEA 3UKNA 1PO21 2HWB2 1YIPA 5JAXA 4Q4X3 1VMJA 5LBFA 3WG1A 1V6JA 5DAWA 4AE2A 1ZZBA 2HWD3 2QQWA 2WNOA 2J1RA 1AXYA 4OUEA 3B94A 1CONA 5IFPA 1LAJA 4YRDA 2X53S 2DTYA 5FMBA 4XQWA 3MW2A 4FP3A 1ZZ9A 2XPJA 3UETA 4RFT0 2JD4A 1RUD1 4MSVA 4QB2A 2X05A 2VUAA 2X09A 4HVQA 4I3GA 1DQ6A 4IL7A 4QX1A 1WCDJ 4WM7B 2F4PA 5H9RA 2R062 1W6NA 5K9YA 1C1LA 2BP6A 3VBHC 5A32A 5KHKA 3LEIA 3ZFGB 1S0FA 3BIEA 3R4SA 2DUQA 4CUGA 1UN1A 4O7XA 3VBHB 4QGNA 4Z8BA 1ULFA 3UL2A 2ZZQA 3PMSA 1CWPA 2BOJA 2D3SA 3I59B 1QJEA 1QY4A 4KI5M 2IXJA 2K9ZA 4YVWA 4QHOA 3ZFFA 1FX5A 2Q5TA 4OZOA 3LZZA 2HEYF 3K3NA 1QJFA 4B7EA 2YROA 2QQUA 1AXZA 4HVOA 5FP3A 4LORA 4QHBA 3AZYA 1YFYA 4XTMA 4LPLA 1NQDA 2C24A 4E8CA 2QZ2A 2EXIA 1IG0A 2ZEYA 2OA2A 3ILRA 4XJ9A 4EN7B 1MACA 4HBNA 5FWEA 2EA7A 3FHAA 4H14A 2O1QA 2F6BA 4LO5B 1KRIA 1VBA3 5LA2A 4OUSA 2FMYA 1LJ7A 1NYWA 2DUOA 2VOVA 1E5IA 4PIZA 3U4SA 1X9TA 2WO3A 5B2GB 3ILNA 1SLBA 5F7UA 1ULPA 1J84A 2VW1A 2PA7A 1C3HA 2LALA 4FXKB 1JMUB 4H7LA 2XJSA 3AP5A 4OCTA 4EZ4A 3USSA 4C0BA 5AC91 2XKPA 2H0BA 3LAGA 3D0JA 5FP8A 3UK9A 1W06A 4IESA 5BPXA 2V4VA 2WT0A 1Y3TA 2RS11 1JYNA 4FQ4A 2Y6GA 4XHXA 4OZXA 4QM8A 4V1PA 5DG1A 1UO9A 5C8CB 4PBPA 4QMAA 5I0DA 4OMCA 1ZA7A 1OOPA 3P3NA 1TMF1 1NZCA 3SEPA 4ET7A 1NT0A 1FPN3 4CDWA 4ZKTB 5HCAA 1PVXA 2E7TA 5K8SA 1DDLA 2ET1A 2WNVA 4XXAA 4BYYA 1ND3C 2Y0IA 1NQJA 1XNKA 4I01A 3RJRA 3BPZA 3FFQA 5A7WB 1W2OA 1RB8G 4UFIA 3PNAA 5JVVA 1U5XA 3D4KA 2WZR1 3L9JT 1H0BA 1N1YA 1TZOA 2UWBA 1ND3B 3BIWE 1VBC2 1GU3A 1UPSA 3VBUC 5FBJA 4IERA 4NN0A 1WW4A 5AC93 2XMLA 2QFEA 3FUQA 4IE0A 1ZRRA 3VKNA 4BM8A 5HCFA 3ZSJA 1LHWA 2DVGA 2P3KA 1PVC3 2JDMA 1V70A 2Q1ZB 3PU8A 2A70A 3WV6A 4MLOA 4WZFA 3VZLA 4AEDA 4ES8A 2X5IC 3KCCA 4CEWA 3BTZA 1TMF3 5C33A 3K2OA 1CVNA 4LITA 5D8AB 5HPOA 4OVEA 3V0BB 4GWIA 4D6SA 1MEC3 4RHV3 4TXWA 3QD6A 4LBOA 1GR3A 1IHMA 3NNJA 1GWMA 1S0BA 3SH3A 1EP0A 5ACA2 2WZPP 4NMIA 5L9RA 3EJKA 2QQMA 5C3PA 1ODNA 1ZBA1 4CP1A 4HETA 3O1MA 3GZAA 1LTEA 5B4XA 1JN2P 4CDQB 1N3PA 4ZPIA 3AM2A 2RDQA 2ETEA 4JDOA 2V09A 4BLIA 4NE9A 5CEHA 5FWJA 3DPRC 2PLV2 1VRH3 2ZGQA 1UY3A 1BJQA 2TEPA 4UFHA 2P34A 4PHZA 2WT2A 4QKFA 5C6CA 1CZSA 3CL1A 4D69A 3ABZA 3DUIA 4UOJA 3KQ4B 3O14A 5BNOA 4DIQA 1I1EA 5BV6A 2WQ4A 4ORFA 2VMFA 2C5DA 4XDOA 2DV9A 3LB9A 3MFCA 4JGYC 4ZZ5A 1O59A 3DGTA 2YHJA 2ZX0A 4JQTA 4P9WA 2QQOA 3QBQA 5DAPA 1OPOA 1ZBA3 5IK4A 2JG9A 3WQBA 2VMIA 4KMQA 5EFUA 5I93A 1JHJA 4IGPA 5F2WA 1S0EA 2VUCA 2E63A 4NPMA 1WMFA 1OFSA 5A3PA 1AYN3 3I2OA 3BYWA 2GZWA 5CZKA 2AUYA 4A6OA 3KM5A 1J1TA 3CBNA 2VZ1A 5FY8A 4A6SA 4BXSV 5CFDB 3GNEA 5C5UA 1RXFA 1VBE2 2VAUA 2WS93 1Q3EA 2DUPA 4NIGA 2QE3A 1GV9A 3ZO0B 5A7SA 3GZTB 1GWKA 1RUI1 3POSA 3LOBA 1YC61 3WOGA 1JYVA 4LIVA 4P14A 1DGRN 1SLAA 2OUHA 1QGLA 2VZTA 1GKBA 4LUKA 1ZZCA 2J1EA 1ULOA 2R071 4UFLA 2ZGNA 5FYTA 4JZRA 4COUA 1CAUA 3BKZA 3TB0A 2E33A 4CEYB 3FFZA 2XONA 3M3OA 3FJSA 5IFTA 3ES1A 4E2QA 4OHYA 5SV8A 1UZWA 2B45X 3JCIA 1DZRA 4FTSA 3PMEA 2UWCA 1JYXA 1ASJ2 3VBRB 3H3ZA 4PDWA 1ONAA 1BK1A 1XYPA 1UY4A 2LS6A 4XHBA 4XZUG 5J96B 2A7AA 4P9LA 2A71A 5JSPA 3I3BA 4Z92B 5FXVA 3HQXA 3M3IA 5FPZA 1AF9A 5KWRA 5E16A 5HV4A 5L7OC 3HEIA 1JZ2A 2GNMA 5CG9A 2ADDA 2EIDA 1HRV2 4LNVA 2NQYA 1S0CA 4NPLA 3UKVA 1K5MC 2VVEA 1UYYA 2D5HA 2IVIB 3SISA 1QKQA 4XVHA 3ZYIB 2WQZC 5JXJA 1SLIA 2GDFA 4GMP3 2D6PA 3UKTA 2BGPA 2VMDA 4XUOA 1X8EA 5E6HA 3ZFGA 4FXGB 1YQ6A 4P08A 5FUNA 4EN6B 3WW1A 3OBTA 4QPGB 5GZFA 3VBHA 2RDRA 1RINA 5K4LA 1MZFA 2Q4SA 3P6BA 1VMFA 3I59A 5IVYA 2Q0AA 2RE9A 2G9GA 4ISRA 2EXJA 2VZOA 3ZXGA 3IZOA 3WF2A 4X6RB 1MS5A 2FDFA 2BYVE 1A8MA 1TME2 4RL7A 5T5LA 3WT3A 4K8FA 5T5JA 3URFA 2WZEA 3MIFA 1U5IA 2NPIA 2L9LA 1RUH3 1JOJA 1RUE1 4L99A 5EZWA 2B42B 3OYWA 4Q0QA 2WYFA 4XETA 1CIYA 4AI3A 3MZHA 2HWB1 1NLQA 3WDUA 1C8M1 1G9CA 3T2TA 4JC1A 4GH4C 5B4NA 1O8PA 2ILMA 1V00A 2Z79A 1FV2A 4NR1A 3ASIA 4H2AA 4QDRA 1UKGA 1RUC3 1GANA 1VBB2 1YUDA 4RYDA 1RHI1 3SLIA 3ZXJA 2RM23 5FLJA 4A4AA 2HBUA 4AVBA 2A6WA 1DQ4A 5DDJ1 3KCYA 1O91A 1VRBA 5LASA 4MUVA 3WUCA 3C3VA 3O1SA 1HIXA 5FCCA 1W2AX 1TEIA 3KT7A 1HXS1 3AYAA 2RVAA 2CL2A 3L2YA 4R9AA 1MQTC 1GNHA 1DLCA 5D21A 4KH9A 3LEKA 4DQAA 3N9MA 3K51A 2DYCA 2VBDA 2VULA 3U11A 4MGTA 3RFRA 3ECQA 3EO6A 2WQ8A 4NOTA 3UNPA 3WINE 1ND2B 4FI9A 1FV3A 5A7WA 3RI8A 4CRQA 1DFQA 3H1YA 1OVSA 1ND3A 4CYDA 3I8TA 4FOVA 1UY0A 1LB2A 2EVXA 2OXBA 2XBO1 1W9TA 1AX2A 4W65A 4WVZA 2W2IA 5C71A 4FPYA 1R093 2HH9A 2ZABA 3FC0A 5FZEA 4CXWA 4AI9A 1HX6A 2W46A 1VB2A 2DF7A 1KEXA 1W6OB 1UU4A 1HXS3 1LU2A 2WO2A 3ETPA 3RJ2X 1A6CA 4FPEA 4AF9A 4IV1C 5IVVA 1PO12 3OPTA 1RL3A 4JDNA 4MZUA 3VDDB 3RZGA 5D8AA 2W08A 2ZHNA 3AMNA 3AP6A 1FI2A 3HNMA 4OHWA 3V0BA 4KU7A 1I3HA 4LKDA 4RQPC 3AKRA 1GP5A 4FFHA 2WBKA 5T50A 1MS8A 3ZDSA 4NRQA 5FYVA 4YVSB 3WNNA 3ZOIA 2WFF3 3KVAA 2Y6HA 3I2JA 2R0HA 4Q8KA 1XC6A 2ORXA 2AENA 1EPWA 1IGOA 4Z1VA 4UBHA 4CDQA 1DGLA 3KS7A 4JHTA 1NLRA 2VNOA 1MZ5A 1BCXA 3H7YA 5FQ0B 4MXVA 4CU9A 2FD8A 1IPKA 1XU2A 3MICA 4MVTA 4MGSA 5F5AA 3VHRA 2A1XA 3D82A 1JTZX 1I5PA 5GKAC 3WQ1A 2VTXJ 4XABA 2XUMA 1G9AA 2W5FA 1OT5A 4Q4X2 5DG2A 1GZTA 2VOKA 4KQ7A 4EN0A 5LW9A 3V56A 2HWD2 2WN2A 3KF5A 5C9AC 1Q8VA 1W8FA 1V9U2 3CJIB 3X29B 3E6BA 1VAVA 3I3MA 2E51A 5CKQA 1VBC1 1O4TA 1GQPA 2DVAA 4FPFA 4QX8A 1JU4A 1WBLA 3M1HA 3LFMA 3VBSC 3WQ7A 1ZZ8A 4MGKE 2CWSA 4GB33 4NRMA 5A3MA 3OD4A 3KHCA 1DCSA 1AR73 1H9PA 2CTVA 3AP4A 3MLLA 2JECA 1Q56A 1LOFC 3VHOA 4RA0A 1PK6B 1WZXA 2JDNA 1URXA 2VOWA 3O0WA 4MX3A 4RFRB 4QWNA 5I8TA 1PO22 2JKXA 5CFDA 1SBFA 4LBQD 4NO4A 1W99A 2E53A 2DCTA 2YFZA 3M4FA 3WP6A 1SZBA 4C1XA 1SEFA 2XB6C 1ZREA 3WZ1A 4XTPA 4V2WA 1MPXA 1UU6A 4BMEA 2C26A 2ERFA 1EAH3 2ZJCA 1GQGA 4ATEA 5ACA1 3LSDA 5J48A 2YU2A 3RG0A 3VUOA 1IKPA 3QCWA 2BTVC 5JR2A 2JWPA 4GQ7A 3SH5A 3C7FA 1IQDC 4QU2A 4RGKA 3MW3A 5FR3A 5FPUA 4CEYA 3ZM8A 1JYTA 3AK0A 1S55A 2J7MA 2VM9A 1GYKA 4FO9A 4QQLA 1QJZA 4GKXA 1N3QA 2JE8A 4LXLA 3DF0A 4LO7A 1RUJ1 4ARYA 2PLV1 4DXSA 1NCRB 2GAUA 1YEWA 1OFNA 3VBRA 4MYEA 2BUKA 4D6RA 3AXDA 3MIBA 2EALA 2VMCA 5KXCA 4AFBA 2R1DA 2VL4A 2WWSA 2HWF1 3OUJA 5CVRA 3WEZA 4DY3A 2JB8A 4IEOA 2HWC3 2YZ4A 5F3IA 4OUMA 3WF4A 1DLLA 2J1VA 2C4XA 3ACFA 4LBJA 5BNPC 5FY0A 2D40A 5AFBA 1FT9A 3AMPA 3E97A 2GP3A 3BVCA 4UW5A 5T54A 5A3TA 1TNRA 2A3YA 4PCRA 1N1VA 1D4M3 2IFWA 3ZXAC 3W59A 3IM0A 1RUJ3 2D3PA 2VXRA 5BNQA 4QPGA 2W47A 1B09A 2VCBA 1FPN2 4N7IA 4QXCA 2WFPA 2Y33A 1EYBA 3OB8A 1OF3A 3VB9A 4DUWA 1QEXA 4GIQA 3ITQA 4FPCA 5JIAA 5CBLA 4YFZA 3MV11 1RJ8A 4BJ0A 4N43C 2BQPA 3ZN5A 4AVSA 2V5YA 3FUOA 2VQUA 2XJRA 3AFKA 5AC92 4UWDA 4PQ9A 4N43B 3P3PA 5F6LB 3UGGA 3RZJA 3LDRA 2FBEA 2RS12 1D4VB 3OGGA 2FDKA 3RWNA 1KFXL 3A22A 4WM8B 5JR7B 1BEV3 4HL0A 1BKZA 4BISA 3IT8A 1TMF2 4UYBA 2LROA 1SG3A 2VVFA 1ULDA 3W5MA 2HWE3 2O0OA 4PIYA 3AKTA 4YVWC 3ZFFC 1ASJ1 2GN3A 2J1TA 1MEC2 5FP4A 2W95A 1N3OA 3A0KA 4Q4Y1 2PHUA 4KWKA 2WZR2 5GM0A 3CEWA 2OKXA 3N7LA 2OQ6A 4B7KA 2GC3A 1Q8QA 2YXSA 1HRV1 3JZVA 2ZGPA 4R4ZA 5F6KA 3USUB 1W0PA 4FCAA 4S2FA 5JDBA 5FBZA 3HWJA 1OA4A 1WKYA 2P4EA 1PZ9A 4E4HA 5FKCA 4BA6A 1DP0A 2D6MA 1M4WA 1AX0A 1XE0A 1ULEA 4F8AA 1UPIA 1CN1A 2JE7A 3CHXA 4LA2A 4XFFA 1ND2A 2AYHA 4P9XA 1F2NA 5KXDA 1H1MA 1LEMA 1YFWA 3M3QA 3PIGA 2ZHLA 2A5ZA 4Q8LA 5A1AA 3A4UA 3J7LA 1ZBA2 2IXKA 1UOFA 5G04L 5IATA 1JH5A 1W6OA 2G4IA 1O5LA 1KD7A 1O6UA 1OOPC 3FN9A 1LGBA 1OHFA 3H0OA 3MIGA 4C90A 4CDWC 2JENA 5LCWL 4FTEA 3ZYJB 4UW6A 1HB4A 2EIEA 2WNVC 3PTYA 3K4AA 3VDDA 3GCXA 1W2UA 1OI6A 3ME2A 3WXPA 1QJX3 2WL1A 5FZ9A 3ZN6B 4BHPA 5EWSA 2VJXA 2WSVA 4DY5A 2WS92 3PLQA 5DZGA 4NHMA 3UGFA 1WGPA 2FDGA 1HQLA 1PGL2 3IKWA 4YVSA 5FZAA 4XIKA 4Z2AA 1Y43B 3SCFA 3E6CC 1WMXA 1L7RA 3PUQA 4LO8A 3GDBA 5CNAA 5DZEA 5FY5A 4UXAA 1Z7S1 4MHRA 2YC0A 1MVQA 1SPPB 4FOWA 4AEDC 4YZ2A 1FNYA 5FQ0A 1H8TB 4D3WA 4JQRA 3CU7A 4KG0A 5J3UA 3NNFA 1N1TA 4ASMB 1BK0A 2HEWF 3OPWA 4K1ZA 4PBOA 3GZUC 3FBYA 2D98A 2EAAA 5FPLA 4XUNA 4A44A 4ISQA 4AQ6A 4ES9A 1FMD1 1RUI2 4LBKA 3CJIA 5GZDA 3WDYA 5C3QA 5FREA 2VGDA 3T0AA 1WLDA 3AMQA 3RS6A 4BE3A 2Y0OA 1R083 3MHZA 1ZM1A 5F1RA 1OUSA 1L3JA 2R072 1GNZA 1RYYA 1OA2A 4GMP0 5K7PA 1QJU1 1AJKA 2ZX3A 1CPMA 2FCVA 1CJDA 2YC4A 3H7JA 1R1A1 1LENA 3NJXA 5JPMB 1CIWA 1PK6A 2WNUC 4C0HA 5C7GA 1POQA 3GJAA 5DABA 4CPBA 3T09A 1LHUA 1PO11 3V0AA 2ZXQA 1JU3A 2YUEA 5FZCA 4I0AA 5BNOC 2WIIB 5L19A 4LUMA 1SCSA 2WNUB 4AXOA 4J1XA 2Z4FA 4A7ZA 1JZ5A 3IDEA 4NHXA 5AVAA 2JG9C 2ZHKA 5C8WA 1U0AA 3ZSLA 1E5SA 4XF1A 3LWCA 4DEQA 1XU1A 2A6YA 4BCUA 4NAMA 3POFA 3HIFA 2GNBA 1WMDA 1MR5A 3TAYA 4MO3M 1G86A 1Q5OA 1LU1A 1QJU3 1TE1B 1LULA 5FZ6A 4OQ9A 2VQ0A 2ET7A 3RYPA 2P5BA 2WA3A 2GC1A 5CB7A 3SXWA 4JDMA 1GZCA 3CKHA 1XE8A 2XQRA 4UF0B 2IZWA 5FMOL 3B9IA 1NCRA 4AI2A 5J7MA 1JZ3A 4A41A 2W1UA 3HT2A 1Y4WA 3O1OA 4YSFA 1UMIA 4LA3A 4Q4X1 5DAVA 4NIIA 2PXJA 2HWD1 1BBT3 2WC2A 3ZR6A 4QKDA 1T6BX 1LKNA 1WLCA 3DECA 4M00A 3NVCA 2RM22 4L9BA 4XF0A 3OSDA 1OLRA 1F8VA 3LFIA 1QIQA 1A34A 3ZMNA 1N1SA 4XAEA 4ITCA 2R16A 2K0GA 1VLNA 4Q4W1 5BNPA 2JDHA 3M3CA 5DUVA 3TOJA 2CGPA 2XJVA 2GALA 4AVVA 2GMMA 2BRTA 4NHYA 2GN7A 3QH7A 1YWKA 1BLZA 3AFGA 1C8M2 2WR9A 4YG3A 5L9BA 1OPMA 3VHNA 5FPXA 1BMV1 1JS9A 4DXTA 5LEKA 2F17A 3IWZA 4J1WA 4Y1ZA 2QQLA 2XJPA 3NJVA 3THDA 3H8OA 3I7DA 3POEA 3I4IA 1EUUA 4Y20B 1BVP1 5FOJB 1RHI2 4BDVB 1XSQA 4XJ8A 2Q1FA 4WM7C 4D94A 2GSYA 5DDJ2 5F3GA 2WO7A 4N43A 1RVF3 1TVGA 5EIYB 4TWTA 3ZFGC 2QDRA 3RMXA 3RRDA 3B69A 2NYYA 1NCQB 1HXS2 4R8HA 4I3PA 5EV7A 2XWJB 4JTNA 4Q4W3 1GZWB 4WM8A 2ZKLA 4XJUA 1ODMA 3VHPA 2E7QA 3KSCA 4DRVA 4NPRA 4MGQA 4N53B 4UAPA 2FMDA 1YQ2A 1MS0A 1RC6A 3OGVA 4TLGA 5LY1A 1JBCA 1PMIA 1SLCA 1VBA1 4CP2A 4WBBA 2VUJA 3AP7A 3BPSA 4XFAA 4AW7A 3N36A 5C4WB 4CCCA 4YPJA 3VDBA 1RMU3 2WWUA 5FZOB 2GNDA 3WNOA 5HCHA 2G19A 2WFF2 3I2FA 2C9KA 1PMHX 2XBO2 3ZPOA 3FLPA 1T2XA 4CZSA 3USUA 2ARCA 4DNYA 4XQDA 3RYKA 3MF9A 3CO2A 3WLUA 3LPGA 4NIDA 1W6PB 3J8F3 1POV0 3B5LB 2A6XA 2W91A 3UJQA 3ZKYA 2DCYA 4XQ4A 3VZNA 5A33A 4Y5TA 1DQ1A 1FPN1 3K77A 3GYDA 3WF0A 2QCSB 2XWBB 4CP9A 4BMBA 5JSOA 3M3EA 4W50A 4CTEA 4WVMB 1UZYA 4GXLA 1COV1 3PU3A 3V0AB 1QU0A 1D0GA 4GJYA 4QQPA 2Q8DA 1SLTA 2FZ1A 1ULGA 4L11A 4YZ5A 1CQ9A 3QH6A 4BPZA 1H2MA 2DBIA 5C8CC 1M06G 5KHGA 4GB32 2HYKA 2RR11 3O1PA 1W9YA 3VD9A 3P1IA 1PVC1 2BOIA 1U5YA 4XDPA 5EJ3A 3N7MA 3H8UA 1F4AA 1PMJX 3ZN6A 2ARBA 3NV2A 1DYPA 5CA6A 3HN3A 4PLOA 4K3UA 3BTAA 4WZCA 3KHBA 2XJUA 1MEC1 3HOBA 3PDQA 4RHV1 3VZJA 5J37A 5J1XA 5IAVA 2P2KA 1COV3 3H42B 1NE4A 1QF3A 2Q8CA 4AFAA 3HBZA 1X8MA 1MS1A 2IFRA 2PAEA 3ZXEA 1OF4A 4XYXA 1EV13 3CJXA 1G9DA 3TNQA 2XR4A 5FZ1A 1W8HA 1DBNA 1SPPA 1F15A 1C57A 1QOOA 2RR13 3GBGA 2IXIA 3NV4A 4M3CB 1VPHA 3A7QA 4UW3A 5E8AA 1JYCA 1CX1A 3E6DA 3SNMA 1KFUL 3OUHA 3U78A 4IE4A 1S0IA 3TN91 4B3NA 3F2ZA 5D8AC 5I0RA 1UOGA 4XUQA 3EBRA 1VRH1 1KDMA 1S4CA 1RUF3 1KJLA 2J1AA 5JMOA 1VBD1 1JI6A 4ZS3A 3FBMA 2DVBA 1KXGA 2D7FA 4A7YA 3AJYA 5FZGA 5F9TA 1AXKA 1HB1A 1YXWA 2P37A 4X6QB 3RPQA 3WW3A 2Y6KA 4AHZA 3WNMA 2E26A 4W6WA 4AZZA 5I91A 2HWC2 3R4DB 4P00B 4CDQC 2VZ3A 1JYIA 2YMZA 4YW7A 3ALQA 4EWAA 5KXBA 2N7GA 2Z2SB 3OG2A 4XE9A 1W3VA 3VZKA 5C70A 2B8MA 1LGCA 1LOBA 3ACLA 4D0QA 2XGXA 5FLHA 1AYN1 1XOYA 4MADA 3TN93 5JWPA 3QACA 1ZZ6A 4LBNA 1NA1B 1RUJ2 3FLRA 2NN8A 2XL9A 4GD4A 4XBNA 3GJBA 4YZ1A 2A6VA 4BQ5A 2NMOA 3IDAA 3J7HA 1VBD3 2WNUA 5FMDA 3WY6A 4DUXA 2WS91 4CPBD 1K45A 3TBDA 2HWF2 4NRPA 1PGL1 1WCUA 5A1FA 3ROUA 4OI0A 1I6XA 1F35A 1SHWB 1Q8PA 5LBCA 2OPWA 1QJY1 1S2BA 2RJKA 3BB6A 3WNXA 3PURA 5A7OA 5GZEA 4C8DA 5IHRA 2J1SA 1REFA 4K20A 3VN4A 2R30A 4RS5B 2CDOA 5FY1A 3HN1A 4MH0E 1HN0A 4PIXA 5CFDC 3T08A 1C5HA 3PUAA 1BEV2 5BNNB 4K40A 4NAOA 5CYYA 1DF0A 4URTA 2NM1A 4IE6A 2RMU3 2HWE2 5A3WA 4E2SA 1JOBA 5JZGB 3HT1A 1AJOA 3KMHA 5FOBB 2X8KA 4XACA 1CAVB 1PM7A 1QJY3 4Q29A 1SCRA 1BZWA 3WDWA 3NSTA 4CEYC 3WVJA 2JXAA 1AVBA 1PIV3 5FO8B 1BYHA 3A21A 1QOTA 4NWVA 5T5PA 2JDZA 2A3XA 3LIGA 1F31A 5FYZA 3IDBB 4GMP1 2CGOA 3VBRC 3LA7A 4ONUA 4CDXB 4ZHNA 1U5ZA 3UYJA 4AL9A 3MW4A 3I2DA 4BQ1A 3KD4A 1YQ8A 5LK5A 4OI4A 4FTBA 1APNA 2PHFA 2XJQA 2J42A 3B3QE 4Q4Y2 4XEZA 1T6GC 5J09A 1DYKA 4Y20A 3E5XA 5DN2A 2QVSB 3KV4A 2BBAA 4Q1RA 4HPKB 2ZGMA 4GWJA 2C9AA 1QOSA 5FZ7A 4XC9A 2HLEA 3AKSA 1XBFA 4WM7A 3B02A 4KNCA 1NCQA 1RUH1 3FHIB 4QPGC 3W20A 5EYXA 3AYEA 1GZWA 2P6HA 2Y38A 2OYZA 2BERA 4COZA 4N53A 3N9LA 3VKLA 3MF6A 2SBAA 2ZX4A 1SFNA 2DCJA 5C4WA 1W03A 2R043 5FPAA 2WAAA 4FQZA 5IJRA 4IDZA 4A45A 4BU2A 5FZOA 2RDNA 5ABJB 1B35C 1RUC1 3RYRA 5CIRA 4HVRA 1UU5A 1NLSA 4AFCA 3O1TA 5JOWA 1AR93 2RM21 3JD73 1TQ5A 4YZ3A 3FX3A 1NXD1 1PZ7A 1SBEA 1B35B 2JJ6A 1X36A 4LKSA 1JUIA 1Q43A 4K1YA 4JHZA 4R9CA 2B7YA 5JCTA 1JW6A 2KA3A 5CADA 2LUWA 3MEPA 1NY72 4KWJA 3MDPA 4LHNA 1OH3A 2P1BA 3H1MA 1UL9A 3GF6A 1H6XA 4IQPA 3B7MA 4LHSA 1J3PA 4E2GA 4O9EA 3K4DA 4K8RB 2WZ8A 1SBDA 2PQQA 2DCZA 3TEYA 2ENRA 4MG2A 1DGWX 2GC0A 2ZBJA 2WLQA 3LEMA 2WNEA 4AAXA 1F5FA 4M4PA 3WNKA 5JOZA 1YLLA 4LK7A 2ZX2A 3NJYA 1YNAA 1AL0G 1HRI3 1Z0HA 1R082 2C0ZA 3LE0A 1BXHA 1Z7S2 2B4KA 3AB0A 1YJLA 1R091 2D97A 4OYUA 3O0XA 3RI9A 2ES3A 5C3SA 3IPVB 3WDTA 2W68A 4ZY9A 3VKOA 4XXPA 4CA9A 5C8CA 4KU8A 3ZKUA 5A6QA 1WW6A 4Q5OA 4QPIC 2GC2A 3OPZA 1ND2C 1YFUA 3O5SA 4YW5A 3JQWA 4A2UA 2H6BA 1GP4A 1O8SA 4UW4A 4F83A 4QQOA 3PUIA 4QPIB 5C3OA 1FMD2 1I5ZA 1PHMA 1XYOA 3MBWA 1XNDA 4GULA 4YNIA 4FAHA 1LOCA 4QX3A 2WFF1 1E5HA 4QDSA 2LRPA 1MZEA 2XVKA 3D3AA 4KWLA 4XCBA 2Y6FA 4W6XA 4YGEA 1QJU2 4JKLA 4M3CA 3VKMA 1K12A 1R1A2 5IUQA 3VDDC 1V6OA 1JODA 1QMJA 4HONA 2R32A 3MIHA 4AVTA 5KBFA 1GOGA 2VXJA 5A70A 1S2EA 3V64A 3J7MA 2W94A 4YVSC 4PQQA 5F39A 5JXIA 2EICA 1PNGA 4V2VA 3SEEA 3T0BA 1W28A 1W04A 4XFCA 1US2A 2H0VA 3MUZ1 4QB1A 3OUIA 4R52A 3PVEA 3VBFB 3I3DA 3JUUA 4BIOA 2OUJA 1NKGA 1C8NA 5FPVA 4QKNA 1YQCA 2XLAA 5L73A 3VL9A 1O3RA 2ZGSA 4G4FA 2R063 1JZ8A 4GB31 3H50A 3BU7A 4OLLA 1AR71 1SACA 5FJKA 5DUWA 3RZHA 3AKQA 1NA1A 2VG9A 3T0DA 1V6MA 2AACA 4CCEA 1CESA 2OPKA 3AZXA 4IEYA 2LW8A 1POV3 2PHLA 1IPSA 3CJIC 1VMHA 3MLJA 4LKEA 4Q4V3 5FMOS 5BXXA 1QDCA 3J9SA 3RVHA 2QQNA 3EQEA 3UESA 3IAPA 1HDKA 3I2GA 3WDVA 3WX5A 4YG0A 2XVGA 1NG0A 1EAH1 3U37A 4YARA 1W9WA 1DU3D 3IIAA 1G6NA 1QQP1 1F9KA 3N9OA 3BOPA 3ZXFA 4AEJA 1PK6C 2RHPA 2I2SA 2XUEA 4RS5A 4E9KA 1HLCA 3W9AA 1QHDA 4XDQA 2VCMA 1UYPA 2QNKA 4A7KA 1WW5A 4Q4W2 3I2KA 3MI8A 1RUG3 2DU1A 5BNNA 2O8QA 4CCKA 5M0TA 5LZ6A 2P17A 1IZ3A 5FZHA 4YYOA 1BMV2 3JQXA 3CIHA 4AI1A 2W87A 3I3EA 4CXYA 5J36A 1AL23 2KD7A 3KZ4C 5FZ3A 5JZGA 1RMU2 4DRRA 4DS0A 1VP6A 2WRAA 4UFKA 5DPNA 2BBVA 3E5QA 4AG4A 1CAVA 3WNPA 1MZ6A 1C28A 2HWC1 1LCLA 1XPWA 1QQP3 4I30A 4N90A 1GICA 5EP9A 3RQ0A 2D6OX 4BZ4A 3ZYFA 5IWFA 2VOTA 4FFIA 3C2UA 2VH9A 4EQVA 2ZX1A 3PUHA 3ILFA 1NCRC 4L8QA 3DXUA 3HBKA 4PI0A 4X8PA 5FZLA 3WG3A 2HJIA 4CDXA 1D4M1 2WT1A 3JBG3 1VBA2 1S1AA 1ALYA 3OGRA 1MS9A 4D7TA 3FL7A 3HQUA 2UY9A 2RS33 3MPPG 1VALA 2YGLA 4YGDA 4GJZA 5A3UA 3M7AA 5FFOC 4HPKA 1DG6A 3MUY1 2JDPA 2BW8A 5HV0A 2W1WA 4FP2A 1WW7A 2XVLA 5DAQA 3BTYA 2ORZA 4XFHA 3VD3A 2V73A 4GA9A 5A80A 4CUAA 4K21A 1HQNA 3NNGA 2G9FA 5CISA 3T4HB 2PQSA 4KWUA 1XNCA 2JX9A 4J25A 5CFCC 3EXUA 3LEGA 1BEV1 2WINB 4EZHA 1YFXA 2XHNA 2BFUS 3AJZA 3I54A 4IV3B 2CNAA 4Z07A 3SCGA 2JE9A 2HWE1 3U0ZA 1OLMA 5CFCB 3RDIA 1IG3A 4NHKA 3NO8A 1GOHA 5ABJA 2EXHA 2W0XA 1COV2 4UBGA 1OKOA 2PAMA 1Y9MA 5F32A 5JSRA 4CSWA 4QDQA 1FAYA 4N8MA 2XG3A 1DHKB 2GH8A 1UW8A 1HW5A 4Y1XA 1B35A 5KXEA 3OBRA 4WM8C 1UCXA 2RR12 3N7KA 1FOD3 1PVC2 3ETQA 3ST7A 1WMEA 3IIIA 4IW3A 5LATA 1O3SA 2QBXA 2VBPA 2Y64A 1REEA 4IGQA 1RUF2 4XOGA 5JOYA 4A3XA 4DEVA 4HLTA 4FPKA 4DZGA 1G9BA 2JEMA 3DYPA 3AYCA 3HQRA 4RHV2 4D8MA 3GCWA 5A1LA 3L2HA 3RZKA 1PX3A 1OC1A 5A7PA 1X9PA 1S2KA 3SKJE 1W9FA 3D6EA 1DQ5A 3ZFEB 3U07A 4UFMA 2WSUA 4XF4A 2XXZA 3LF7A 3UT0A 1W2TA 2KXLA 4FOYA 1AHSA 2GP5A 3IPVA 4Q0UA 5I8SA 1YHFA 4XF9A 5CAZA 3TN92 3N4MA 3NAPB 1C4RA 1H8VA 1RJ7A 5IW0A 1ZBE3 1VRH2 1XQNA 2XJTA 5FZBA 1VBE3 1QJX1 1YRZA 1VBD2 2BDRA 1MS4A 2RG4A 4Q2FA 4QPIA 2E6VA 4E4DX 3S6PA 5FXZA 3DL3A 1E5RA 4S2GA 2VPVA 2VY0A 3WDXA 4BOWA 2YPDA 4HG6B 3T2PA 2QQIA 3KV5A 4TLFA 3FWEA 1W8WA 1GOFA 1HB2A 3UGHA 1E57A 5GLWA 1ENSA 3HPNA 1W8ZA 1WLWA 3WSOA 4OQ8A 2LM3A 4EE2A 2JIJA 2P3JA 2VQTA 2NMNA 1AYN2 1QH7A 2A73B 1NY71 3KF3A 3IMMA 1H2LA 1ZA4A 2D44A 5GLUA 4HZFA 4MOAA 1ZX5A 5FAXA 3B9CA 1UQXA 1UZVA 1RIRA 2B39A 2W3JA 3I3QA 4RN5A 5EXOA 1UF2C 5GLZA 4OHVA 1GLHA 1OURA 1YQ5A 4L2NA 5FZMA 2JIGA 3VBOB 1W05A 3D5OA 3CQOA 5FYSA 4JX0A 3VBFA 4D7SA 3R05A 4HKWA 1O5UA 2P3IA 4NJ4A 5LBEA 4RD7A 3GGLA 1AR83 1QJY2 2VUDA 3LKJA 4FOQA 5I0TA 4NIHA 4HKLA 1H8TC 1R081 2VQAA 4HKOA 4LOSA 1DZQA 1LHOA 3NMBA 3PHMA 3C7OA 4XAAA 4XUPA 3WP3A 4EN8B 5FYMA 3NW4A 1VE0A 2HEVF 2ZOEB 1OLQA 2IWGB 4YW1A 2VZRA 4FFFA 5E1RA 3N9QA 1VJ2A 2ZMNA 5K0UB 2BU9A 1H1IA 3OBZA 4LOTA 3ZXKA 4HFSA 4XJAA 1O4YA 4O65A 1UOBA 2K46A 3J4UH 4YM2A 4IUGA 3VL8A 1Q8SA 1H9WA 2F4LA 2CV6A 5FO7B 4DXRA 4OI1A 1H1AA 4QXKA 5I0UA 3LIHA 5F3EA 1NX9A 2XHKA 3MIEA 4A42A 3NKGA 1TME3 2PELA 2DU0A 3Q8BA 2VU9A 4LTAA 3PL0A 5DUXA 2BWCA 2VR4A 2UURA 4Y1YA 5AFEA 4Y4YA 4Y5SA 3LOIA 2MEV3 5IVCA 4RR3B 5FZFA 3A0NA 3N3HA 2FDJA 2RDSA 3I97A 3KT4A 5FYHA 2BWAA 2XOMA 4AI8A 3INAA 1J3RA 4CEWB 2ZA9A 2AH2A 3AVSA 2VZUA 4CCNA 3I2IA 2EAKA 3GM8A 5L9VA 4QU1A 3LGRA 2WUHA 5HXVA 1VBB3 4CDUB 1HV1A 1BBT1 4EN9B 2RJ2A 2JG8B 3WD5A 2GMPA 3RNSA 4DMIA 5ANQA 3RZLA 3A23A 5A3NA 3IBMA 3JD72 5JI9A 4CP0A 1W0NA 4AQSA 5JPNB 3B93A 1RUH2 1SQ4A 4DOUA 5IAXA 2VECA 1I9RA 1J59A 3LDBA 5E88A 2QQVA 5CG8A 1GMMA 3WW4A 3I49A 1GUIA 2VMGA 3ZR5A 1OQ1A 3VGIA 1QH6A 2ZTNA 1AYM3 4M0NA 2JICA 4QKBA 4FPHA 4QT6A 2CAUA 2NZ9A 4XMAA 1K5JA 1W0OA 5FUPA 1RUC2 5BUVA 1SDWA 2V4AA 5H9PA 3VKFC 4IEVA 4ZXEA 4PJYA 1SDDB 2VVDA 4D7YA 1RVF1 3N7JA 4HN0A 1OH4A 1XYNA 5FYUA 4CUCA 4YM3A 2WKKA 1IPJA 3Q8EA 4G9SB 4DXZA 1X7NA 1Y9QA 4FPJA 4BK5A 3U75A 4IV3A 1LECA 1WA4A 3TRSB 2RS51 4LQRA 4Q0VA 5CFCA 5F2SA 1REDA 1H2NA 3T1MA 4BIFA 5IK5A 3BALA 3FMGA 3VD4A 2PHRA 5GZCA 1RMU1 1HKDA 1DZTA 2CY6A 2SLIA 3K46A 3KV6A 5HI0A 1OUXA 4BB3A 4LIUA 4UFJA 1ENXA 1STMA 1ZRCA 4I0WB 3HNYM 1NCQC 2XQXA 4QB6A 1CAWB 1R092 3Q9OA 5F5IA 2DDUA 3SH4A 5C3RA 1CAUB 4CCOA 4N53C 3GBWA 1PNFA 1WA6X 2X29A 1KGYA 1S0DA 2PFWA 4HOOA 4PI2A 2E7AA 1YJKA 2FHRA 2ZPXA 3CLPA 3JB4C 3POBA 3POGA 3PJQA 3J8F1 3OF1A 4SLIA 5FRAA 1AX1A 4XJZA 3S5QA 3WP5A 4AHYA 5C4WC 4KBZA 1HB3A 1CAXB 2KM2A 3V65A 2RS53 3VZOA 4PDWB 4Q27A 1V9U3 3KLSA 1MVEA 1OSGA 5GLVA 4NWWA 3OOXA 3ZFEA 3S57A 4S2HA 4JRAA 2BNNA 2WLPA 4QGMA 2BGOA 2VCCA 1H4GA 5A3LA 2RV9A 1LESA 1JXNA 1PZ8A 2VZPA 3IMNA 4CE8A 1ULCA 4SBVA 4AOCA 4E27A 1V6KA 2PHDA 3AZWA 3NAPA 1WCKA 1SFYA 2ZGOA 3VV1A 1PO23 2BFUL 5FZ0A 2IXHA 4XBQA 1O3TA 3KWVA 4IEUA 1UXZA 4B4PA 5IK7A 3DYMA 3KT1A 4Q4V2 3NWKA 3KVBA 1LR5A 1OQDA 1UX7A 2VD7A 5GLTA 4QPYA 5L36A 3TNPB 1V6IA 1AZDA 2WA4A 3N35A 3KV9A 3WG4A 2YB7A 3LQCA 5LY2A 1EPZA 4N7UA 1XXNA 1RUD3 3DN7A 1LODA 1MS3A 5DZFA 1YI9A 2D6KA 4P5HA 3ELNA 1O7FA 4URAA 4FAGA 4CUBA 1EV11 4ASKA 3WW2A 1GQHA 5T3NA 5A6YA 1H30A 4E4SA 2YFUA 3ZSEA 1SMVA 2D5FA 2GH2A 2B46X 1AR72 2YU1A 1PGW1 2ZGUA 1TG7A 4LBLA 3OYWB 3AXEA 2MNGA 3R6SA 1AR61 3VDCA 1RUG2 1W9SA 3J7NA 1W39A 4AAPA 1KITA 2G1MA 3RWKX 4TSVA 3VDAA 2ZEXA 4LO6B 2D43A 1RUF1 3Q8AA 4LMFA 4U36A 4FPOB 3TYJA 1KJRA 5FZDA 4HMZA 1AL22 1UOJA 3J26N 1UIKA 5FO9B 3VBOA 5FDBA 2OZJA 5EQUA 5FUIA 3T4VA 4R4XA 1EAH2 3K48A 3GHMA 2NP0A 1QQP2 3O12A 5CU1A 3FLTA 1YIFA 3BOWA 3GXUA 3KGZA 1UMHA 2FCUA 5LA9A 5F5QA 1QDOA 2CYFA 1DIWA 1W6QB 2PN5A 1JZ4A 1ZRIA 5KC6A 4FBFA 3MV01 4RSUA 2WN3A 4YW2A 1H8TA 2XLGA 1D7PM 1AR63 5H9QA 4K7JA 5K0UA 4ZZ8A 4EJRA 3BUCA 1UWWA 1RTVA 5FV3A 1W90A 3POIA 2VOXA 1UY1A 3JBG2 4K6BA 4QX7A 2OW4A 2W92A 2ZHMA 4JGZC 2AREA 4HT1T 4AYUA 3BI3A 4HN1A 2QQPA 2RS32 1Q8OA 2Q8OA 3AVRA 5FIXA 5I0SA 4BQYA 4JGZB 1X50A 4I02A 1XB9A 4BLJA 1YO8A 2YPJA 4DINB 2YGMA 3NJZA 4MHUA 5FXWA 4BXFA 3VBUB 2RS13 1NA1C 4LR4A 4PLNA 3FHQA 4MXWB 1F5JA 4P9YA 4RR3A 4OULA 2AGSA 5LRRA 4GKYA 1GWLA 1D4M2 4EWDA 4AHXA 4I0BA 3RZMA 2IXCA 4IEWA 3B01A 3MGUA 1DGWA 3M8LA 2RMU1 5JXGA 2X5IB 5FY7A 2VO5A 4NHLA 3ZN4A 2A75A 2Z42A 4XILA 4CDUA 2D6LX 2WZR3 1UX6A 4LHKA 3WNLA 4E4ZA 3H3LA 2JG8A 3POYA 1IS3A 4KGQA 4M01A 2JDUA 3OY8B 4NUBA 4RS5C 4QQ2A 3VD7A 4PF5A 4M0HA 1UNBA 4DB5A 1PIV1 1YI7A 3AX4A 5BNNC 1SFPA 3OGSA 3IB3A 4MGZE 5FLIA 3ACGA 1FOD2 2RJLA 4FT8A 4H3WA 3TEXA 1CGPA 4UF0A 3SKVA 1QXJA 4E8DA 5JZGC 4Y33A 4TZDA 3DPRB 1C5IA 4DFSA 5JOXA 3S7EA 4B1MA 1UYZA 4W8JA 2BEOA 5HXMA 2ZAHA 4CCMA 5IVJA 5J98B 3PVNA 4YZ4A 4QD2A 1IS6A 3SC7X 1LOEA 3OCPA 2WDBA 3LPFA 4AWDA 5LK7B 4CXXA 2PHTA 4JGYB 4O9GA 4FVVA 1OD3A 1G7YA 2MPFA 4CDXC 4RGAA 5LEJA 4M3CF 1EY2A 4R9BA 2WABA 3O1UA 4Q1PA 4WVVA 3W58A 1RXGA 1ZBE2 3ZXDA 1GZ9A 1HV0A 4B1LA 4IXLA 2VW2A 2ZKNA 2R041 2CAVA 2VE1A 3EYPA 1VB4A 4U2AA 2VCAA 4CCLA 3MO4A 5F3CA 1LHNA 4X8NA 4EYUA 1NUKA 1CX4A 3VLBB 1CAWA 4AGRA 1AR91 3JD71 2H6CA 3R0RA 4JTOA 1QXRA 3W5NA 3RZZA 4QXHA 5FYYA 2YBSA 3M70A 1S0JA 1UY2A 1UMZA 3D0SA 4LBMA 3SQOA 3RGBA 1PM4A 3NNLA 1OVPA 1OXCA 4OMDA 5F8PA 3HD8B 1XRUA 1KDKA 3VD5A 4HSLA 2AZ5A 4J6GA 4LT5A 1CAXA 1D0HA 3ACHA 1IOAA 1QJX2 2XDVA 2DVFA 5ERLA 1ZVFA 2OVUA 5ABJC 4LE4A 3ACIA 3ZDVA 1RUI3 1G8WA 3LA3A 1OA3A 1J83A 1VAMA 2QQJA 3M2MA 3B00A 1L7QA 2TBVA 4MGIE 3U1XA 5D1IA 1AR82 5LRSA 3D8CA 3SHRA 4GAZA 1HRI1 2OX0A 2R073 2YBPA 3H9AA 5L7OB 3IAQA 5FMCA 3SCHA 1BVVA 3AYDA 5DUUA 3NRUA 2E32A 1J1LA 2BNOA 1K5MB 3C7GA 1W6PA 2B5HA 2CDPA 3LD8A 4BK4A 1DQ2A 1OKQA 3CZJA 4META 2YG0A 2JKBA 4Z2WA 4ARXA 2BJSA 2E9QA 4HK9A 5ANNA 2ZMLA 1H4HA 2W39A 5A7QA 4H7MA 4WVMA 4ATFA 4AR2A 2Q30A 3W21A 3ZLIA 4P9IA 5JXHA 1JZ6A 3OEAA 4LJHA 3WQ0A 5DQ0A 3GHNA 4XFGA 4EV0A 2AC1A 3PIJA 4Y26A 4B29A 2JD9A 2YC2A 4NVPA 5A6ZA 2ARXA 5HBAA 2MEV2
chains in the Genus database with same CATH topology
2R6QA 1OMIA 1FNZA 4XMIA 3VZMA 1UIJA 2R49A 2WJSA 4XZPA 3ZIXA 2BNMA 2DCKA 4Q26A 1IQAA 4KGGA 2YDEA 1NOVA 4YGBA 3ZYRA 4HSJA 5JLVA 2BVBA 4WVWA 4GH4B 3GBFA 5GJ6A 3ZMOA 2ZMKA 1ZRFA 4JV4A 3MLKA 2XLFA 3KGLA 4AQ2A 2R1BA 4AFDA 1W6QA 2VNRA 4LBQB 1RUE3 5JMCA 2R061 3NV3A 4AVCA 4INDA 2UYAA 4AQTA 3ATGA 1KQRA 3WUDA 2HWB3 1C8M3 3ZSMA 2ZGKA 1MQTB 1X33A 3E5UA 4IEXA 4Q4V1 1POV1 3VBFC 1AYM2 4XFBA 1RGSA 3WR0A 2XKOA 3ZPYA 3MIDA 1BBT2 1RHI3 4BH9A 4C91A 4JGZA 2FZ2A 3DV8A 4P9GA 4Y1VA 5DDJ3 3APBA 2YV8A 1IKQA 5KHJA 3VBUA 3U10A 1OQEA 4G3YC 4MXWA 4ASLA 3GALA 4B4QA 2ATFA 4I09A 4Y1UA 1RUG1 4C1WA 1A78A 2YY1A 3OTFA 4QQHA 4IV1B 2X5IA 2UWAA 1AL21 2D6NA 4COWA 4IETA 3OY8A 2XBO3 4RQPB 1JUHA 2DFCA 4GWNA 4XFIA 2I74A 2BGCA 1RUOA 1RVF2 3ZYGA 3THTA 2XH6A 4AFMA 4AI0A 4GALA 1UZZA 1QWRA 2CWMA 5IT6A 2RS52 1OD5A 3DPRA 3JBG1 1LRHA 1IS4A 1BQPA 2YYOA 4ZXKA 2QUOA 2ZCWA 2RS31 3LA2A 2QZ3A 2ZGTA 5C9AB 3WCSA 3KB5A 4OHZA 3OD0A 2IC1A 4GWMA 2BPA2 2GU9A 4JGYA 4QX5A 4L92A 1RUNA 3VBSB 1ZNPA 2DTWA 3TWIA 1DQ0A 4F7ZA 2HKXA 2OZ6A 2ZS6B 4YLZA 1W6MB 3J8F2 1S0GA 1LGNA 4XIOA 1QNWA 2IXLA 2PAKA 2W52A 3CNAA 3NL1A 2VNGA 4ZU7A 4YW3A 2PYTA 3ZIWA 5HCBA 1R1ZA 3NKTA 1WUVA 5GZGA 1VBC3 1RUD2 3BODA 3WHTA 3WCRA 2GMEA 4N9HA 4BWOA 1XE7A 4XJWA 4P9JA 3RSJA 4AEKA 1CR7A 2ZAAA 3DKWA 1FOD1 4IV3C 1UD1A 4Y22B 1TNFA 2EIGA 4PLMA 3HMYA 1NXMA 5ACA3 4KBBA 3S0MA 4COVA 4JRLA 3OJBA 3O0VA 1EV12 3LCPA 5L7OA 4HK8A 1YYNA 5I8YA 2DFBA 3MFAA 1ENRA 1K5MA 1PGW2 2UY8A 1D2SA 2PHXA 4M3CE 5BNPB 3G7DA 4N9IA 1AR62 3ES4A 3H3UA 2PLV3 4R9DA 1ZBE1 4EWEA 5T52A 1V6NA 2VW0A 1LEDA 5KC5A 1VBE1 2QKDA 4XW3A 5JI7A 3JB8A 1O3QA 4MGYE 1YCIA 3ZFEC 3PVBB 2HWF3 1ZRDA 4XPVA 4Q0PA 1KS5A 5BY5A 1JHNA 4JCKA 2Z69A 4IEZA 3AMMA 3NAPC 3EHKA 1IS5A 4OI2A 1W6NB 5A32B 1ZYBA 4JVAA 3FZ3A 1HQWA 4OFGA 2DWRA 4FPLA 1U12A 4YFWA 4H55A 1LOGA 1GFF2 2XL7A 3FE5A 4L97A 2ZACA 4YVWB 4GH4A 2EXKA 1CPNA 3RMYA 3ZFFB 3OGJA 2VMHA 2ZZJA 4LE3A 1WCSA 3BCWA 1AR81 4LBQA 5TSWA 3SMHA 4LEJA 3THPA 4FSJA 2AR6A 4TYSA 2R0FA 3SITA 1LHVA 1A8DA 4AGVA 3NV1A 5A33B 3ZX7A 1MQTA 3VBOC 1ASJ3 2RMU2 1PGSA 4YG6A 3UV9A 4Q4Y3 4RGGA 4W6YA 1J3QA 4F3JA 1FATA 4B8EA 1C1FA 4K9SA 1TME1 1SLLA 1HRV3 3ENRA 4YM0A 1O4ZA 2ZGLA 5K0UC 1PIV2 1DGRA 1Z78A 4KG8A 4AEMA 5AVPA 4DMIA 2MEV1 4XBLA 4QM9A 1OOPB 3ZSKA 1AUYA 4CDWB 3U4XA 4Z82A 4LLFA 5T55A 3POWA 4IV1A 3CF6E 2WNVB 2Z5WA 3R4UA 4ZU5A 1VBB1 2QDNA 3ZVXA 1VIWB 4RQPA 2DVDA 4AHWA 1V6LA 3T1LA 1G9FA 2MHFA 1ENQA 2EF6A 4RR3C 4CEWC 3IDCB 2GNTA 2TNFA 4YGCA 1VR3A 3WP4A 2B9UA 2DURA 4AEDB 1D2QA 4CDUC 4YW4A 4Y24A 3AMHA 5E89A 1Y7BA 2JG8C 1RITA 2R042 3MYXA 3MPBA 1AYM1 1UAIA 3WHUA 4HANA 4B4RA 1WLTA 1FXZA 2NLRA 4LLOA 1FYUA 4WV8A 2D3RA 4YM1A 3H1WA 2PTMA 5C9AA 1XNBA 5KHHA 1WD4A 1Z7S3 1AR92 4AK3A 2TUNA 3LSEA 3VBSA 3ZYPA 5T5OA 3UJOA 4EROA 4JAAA 2K2SA 1LOAA 1NE6A 1A3KA 1VAKA 1W6MA 2ZGRA 4Y5Z0 2I45A 3KQRA 1LOFA 1GBGA 2UU8A 4IEQA 2UYBA 1FMD3 4QGLA 4I2OA 2A6ZA 2CGNA 5BNOB 4AGGA 1X82A 4KL1A 1GSLA 5DXDA 4XF3A 5H9SA 1J58A 5FTTC 1HRI2 2PHWA 2JG9B 4DPNA 5JIUA 1UKRA 5KHIA 3ZXLA 1R1A3 2LTNA 3O7OA 3KCXA 3PJYA 3AKPA 3PVOA 1QXPA 2I07B 2Y26A 1PO13 1N47A 4FPGA 4Y22A 4ZU4A 5SV5A 5GALA 1ZZ7A 5BYNA 2A3WA 2FQPA 2D93A 3G6JB 4LULA 2C1FA 1CJPA 4MV2A 3JU9A 2OIIA 5EYYA 1V9U1 1WBFA 2QJVA 3IN9A 4IEPA 3S7IA 4LO4B 3WG2A 3QLQA 4Q0SA 3AZZA 1WD3A 3HAGA 2O8OA 2Q1MA 1QNYA 1CD3G 1H2KA 4LHLA 5IK8A 1RUE2 3QOPA 2BVVA 4OHXA 3AP9A 3HR9A 4S2DA 3S30A 4AVAA 3AZVA 1KS4A 4PDWC 3UKNA 1PO21 2HWB2 1YIPA 5JAXA 4Q4X3 3WG1A 1V6JA 4AE2A 1ZZBA 2HWD3 1AXYA 3B94A 1CONA 4YRDA 2X53S 2DTYA 4XQWA 3MW2A 4FP3A 1ZZ9A 2XPJA 4RFT0 2JD4A 1RUD1 4MSVA 2VUAA 4HVQA 4I3GA 1DQ6A 4IL7A 1WCDJ 4WM7B 2F4PA 5H9RA 2R062 1W6NA 5K9YA 1C1LA 3VBHC 5A32A 5KHKA 3ZFGB 1S0FA 3R4SA 2DUQA 1UN1A 3VBHB 4QGNA 4Z8BA 1ULFA 3UL2A 2ZZQA 3PMSA 2D3SA 3I59B 1QY4A 2IXJA 2K9ZA 4YVWA 3ZFFA 1FX5A 2Q5TA 3LZZA 2HEYF 4B7EA 2YROA 1AXZA 4HVOA 4QHBA 3AZYA 1YFYA 4XTMA 1NQDA 2QZ2A 2EXIA 3ILRA 2OA2A 4XJ9A 4EN7B 1MACA 4HBNA 2EA7A 4H14A 2O1QA 2F6BA 4LO5B 1KRIA 1VBA3 4OUSA 2FMYA 1LJ7A 1NYWA 2DUOA 2VOVA 4PIZA 5B2GB 3ILNA 1SLBA 2VW1A 2PA7A 1C3HA 2LALA 4FXKB 4H7LA 2XJSA 3AP5A 3USSA 4C0BA 5AC91 2XKPA 2H0BA 3LAGA 3D0JA 3UK9A 4IESA 5BPXA 2WT0A 1Y3TA 2RS11 4FQ4A 5DG1A 4XHXA 4OZXA 4QM8A 4V1PA 5C8CB 4PBPA 4QMAA 1OOPA 3P3NA 1TMF1 1NZCA 5HCAA 5K8SA 1DDLA 1FPN3 4CDWA 4ZKTB 1PVXA 2E7TA 2ET1A 2WNVA 4XXAA 4BYYA 1ND3C 2Y0IA 1NQJA 1XNKA 4I01A 3BPZA 3FFQA 1RB8G 3PNAA 5JVVA 1U5XA 3D4KA 2WZR1 3L9JT 1H0BA 1N1YA 2UWBA 1ND3B 3BIWE 1VBC2 1UPSA 3VBUC 4IERA 4NN0A 1WW4A 5AC93 2QFEA 3FUQA 1ZRRA 3VKNA 4BM8A 5HCFA 3ZSJA 1LHWA 2DVGA 2P3KA 1PVC3 1V70A 2Q1ZB 2A70A 3WV6A 4MLOA 4WZFA 3VZLA 4AEDA 4ES8A 2X5IC 3KCCA 4CEWA 1TMF3 5C33A 1CVNA 5D8AB 4OVEA 3V0BB 1MEC3 4RHV3 3QD6A 4LBOA 1GR3A 1IHMA 1S0BA 3SH3A 1EP0A 5ACA2 2WZPP 3EJKA 1ZBA1 4CP1A 4HETA 3GZAA 1LTEA 1JN2P 4CDQB 1N3PA 3AM2A 2ETEA 4JDOA 2V09A 4BLIA 3DPRC 2PLV2 1VRH3 2ZGQA 1BJQA 2TEPA 2P34A 5C6CA 2WT2A 3CL1A 4D69A 3DUIA 3O14A 5BNOA 5BV6A 2WQ4A 4ORFA 2C5DA 2DV9A 3LB9A 3MFCA 4JGYC 3DGTA 2YHJA 2ZX0A 5IK4A 4P9WA 3QBQA 1OPOA 1ZBA3 2JG9A 2VMIA 5EFUA 5I93A 1S0EA 2E63A 1WMFA 1OFSA 1AYN3 2GZWA 2AUYA 3KM5A 1J1TA 5CFDB 3GNEA 1VBE2 2WS93 1Q3EA 2DUPA 2QE3A 1GV9A 3ZO0B 3GZTB 1RUI1 3POSA 3LOBA 3WOGA 4P14A 1DGRN 1SLAA 2OUHA 1QGLA 1GKBA 4LUKA 1ZZCA 2R071 2ZGNA 4COUA 1CAUA 3TB0A 4CEYB 3FFZA 3M3OA 3FJSA 3ES1A 4E2QA 4OHYA 5SV8A 2B45X 3JCIA 1DZRA 4FTSA 3PMEA 2UWCA 1ASJ2 3VBRB 3H3ZA 4PDWA 1ONAA 1BK1A 1XYPA 4XHBA 5J96B 2A7AA 4P9LA 2A71A 4Z92B 3HQXA 3M3IA 5FPZA 1AF9A 5KWRA 5E16A 5CG9A 5L7OC 2GNMA 1HRV2 4LNVA 2NQYA 1S0CA 3UKVA 1K5MC 2VVEA 2D5HA 3SISA 1QKQA 3ZYIB 2WQZC 1SLIA 2GDFA 4GMP3 2D6PA 3UKTA 1X8EA 3ZFGA 4FXGB 4EN6B 3WW1A 3OBTA 4QPGB 5GZFA 3VBHA 1RINA 1MZFA 2Q4SA 3I59A 2Q0AA 2RE9A 2G9GA 4ISRA 2EXJA 3ZXGA 4X6RB 1MS5A 2BYVE 1A8MA 1TME2 4RL7A 3WT3A 4K8FA 5T5JA 3URFA 3MIFA 1U5IA 2NPIA 1RUH3 1JOJA 1RUE1 4L99A 5EZWA 2B42B 3OYWA 4Q0QA 4XETA 4AI3A 3MZHA 2HWB1 3WDUA 1C8M1 1G9CA 3T2TA 4JC1A 4GH4C 2ILMA 1V00A 2Z79A 1FV2A 4NR1A 3ASIA 1UKGA 1RUC3 1GANA 1VBB2 1YUDA 1RHI1 3SLIA 3ZXJA 2RM23 5FLJA 4AVBA 2A6WA 1DQ4A 5DDJ1 3KCYA 1O91A 4MUVA 3WUCA 3C3VA 1HIXA 5FCCA 3KT7A 1TEIA 1HXS1 3AYAA 2CL2A 3L2YA 4R9AA 1MQTC 1GNHA 4KH9A 4DQAA 3K51A 2DYCA 2VULA 3U11A 3ECQA 3EO6A 4NOTA 3WINE 1ND2B 4CRQA 1FV3A 3RI8A 1DFQA 3H1YA 1ND3A 4CYDA 3I8TA 4FOVA 2EVXA 2XBO1 4W65A 4WVZA 1AX2A 4FPYA 1R093 2ZABA 3FC0A 1HX6A 1VB2A 1W6OB 2DF7A 1UU4A 1HXS3 1LU2A 3RJ2X 1A6CA 4FPEA 4AF9A 4IV1C 1PO12 1RL3A 4JDNA 4MZUA 3VDDB 5D8AA 2W08A 2ZHNA 3AMNA 3AP6A 1FI2A 4OHWA 3V0BA 4KU7A 1I3HA 4RQPC 3AKRA 5T50A 1MS8A 3ZDSA 4YVSB 2WFF3 2R0HA 4Q8KA 2AENA 1EPWA 1IGOA 4Z1VA 4UBHA 4CDQA 1DGLA 3KS7A 2VNOA 1NLRA 1MZ5A 1BCXA 3H7YA 5FQ0B 4MXVA 1IPKA 1XU2A 3MICA 4MVTA 3VHRA 5GKAC 3D82A 1JTZX 3WQ1A 1G9AA 2XUMA 4Q4X2 5DG2A 2VOKA 4KQ7A 3V56A 2HWD2 5C9AC 1Q8VA 1V9U2 3CJIB 3X29B 3E6BA 1VAVA 2E51A 1VBC1 1O4TA 2DVAA 4FPFA 3VBSC 1WBLA 3M1HA 3WQ7A 1ZZ8A 4MGKE 2CWSA 4GB33 5A3MA 3OD4A 1AR73 1H9PA 2CTVA 3AP4A 3MLLA 2JECA 1Q56A 1LOFC 3VHOA 4RA0A 1PK6B 3O0WA 4MX3A 1URXA 2VOWA 5I8TA 1PO22 5CFDA 3V0AB 1SBFA 4LBQD 4NO4A 2E53A 2DCTA 3M4FA 3WP6A 4C1XA 1SEFA 2XB6C 1ZREA 3WZ1A 4XTPA 1UU6A 4BMEA 2ERFA 1EAH3 2ZJCA 1GQGA 4ATEA 5ACA1 3LSDA 5J48A 3RG0A 3VUOA 1IKPA 3QCWA 2BTVC 4GQ7A 3SH5A 4QU2A 3MW3A 4CEYA 3AK0A 1S55A 4QQLA 4FO9A 1GYKA 1QJZA 4GKXA 1N3QA 3DF0A 4LO7A 1RUJ1 2PLV1 1NCRB 2GAUA 1OFNA 3VBRA 4MYEA 2BUKA 3AXDA 3MIBA 2EALA 5KXCA 4AFBA 2R1DA 2WWSA 2HWF1 5CVRA 4DY3A 4IEOA 2HWC3 2YZ4A 4OUMA 1DLLA 4LBJA 5BNPC 2D40A 5AFBA 1FT9A 3AMPA 3E97A 4UW5A 5T54A 1TNRA 2A3YA 4PCRA 1N1VA 1D4M3 2IFWA 3ZXAC 3W59A 3IM0A 1RUJ3 2D3PA 2VXRA 5BNQA 4QPGA 1B09A 4N7IA 1FPN2 5JSPA 2WFPA 1EYBA 4GIQA 5JIAA 4FPCA 5CBLA 4YFZA 1RJ8A 4N43C 2BQPA 3ZN5A 4AVSA 2V5YA 3FUOA 2XJRA 3AFKA 5AC92 4PQ9A 4N43B