2AVKA

Met-azido-dcrh-hr
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
133
structure length
133
Chain Sequence
DVLVKWSEDLANLPSIDTQHKRLVDYINDLYRAARRRDMDKAREVFDALKNYAVEHFGYEERLFADYAYPEATRHKEIHRRFVETVLKWEKQLAAGDPEVVMTTLRGLVDWLVNHIMKEDKKYEAYLRERGVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hemerythrin-like domain protein DcrH
publication title Structural Basis for O(2) Sensing by the Hemerythrin-like Domain of a Bacterial Chemotaxis Protein: Substrate Tunnel and Fluxional N Terminus.
pubmed doi rcsb
source organism Desulfovibrio vulgaris
molecule tags Oxygen storage/transport
total genus 59
structure length 133
sequence length 133
ec nomenclature
pdb deposition date 2005-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01814 Hemerythrin Hemerythrin HHE cation binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.50 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Hemerythrin-like 2avkA00
2AVKA 3WHNA 1HMOA 2HMQA 4XPXA 2AWCA 3AGUA 1I4YA 2HMZA 4XPYA 4XQ1A 1A7DA 3WAQA 1I4ZA 4XPWA 2MHRA 1HMDA 2AWYA 1A7EA 3AGTA
chains in the Genus database with same CATH superfamily
2Y3HA 2AVKA 2OJQA 1C17M 3C7JA 3AG2C 1VK5A 3F46A 4MQ9F 3FXHA 1RCPA 3U2MA 5L0GA 4CSAA 2R7OA 2HSQA 2R02A 1YA7O 3DM5A 3DMDA 2XLOA 2QUPA 1SMYF 1OW6A 3EHNA 3K1IC 4E0HA 5KYXB 4PFPA 3U3BA 2KK1A 2WL8A 3GANA 2XXAA 2OKUA 3H65A 5L0DA 1TR2A 1LVKA 2ZXRA 5B3SC 2YEVA 5AC4A 3K66A 3EQLF 4JZAA 3RVZA 1ZHZA 2A68F 3RYLA 4PFOA 3SXYA 3T4RA 1YAUO 5L0JA 5KYUB 1FNTc 3GODA 1HMDA 4DXWA 2J9WA 4OIQF 4H4KC 2R7QA 2BL2A 3AOUA 1S05A 3DJNB 3TOMA 4P6IC 2M64A 5IY5C 4LLCA 3KH2A 4Z9IA 2R7UA 3TJ5A 1UFBA 3QVYA 1T01A 2IXNA 2WVOA 4I1OB 4XLNF 5A6AA 2HS5A 2MYSA 3U2LA 1WATA 3NG1A 1AEPA 4BJ6C 1U0BB 2LFFA 2GWWA 1Q0DA 1U89A 3ECSA 5KYWA 2R7TA 2M4EA 4JKVA 1I4YA 1OCZC 1RJ9A 3C8GB 4KNWA 1A41A 3RQGA 2XL6A 5L3VA 2IM8A 2Y3BA 2KYHA 3EGDB 2Q9BA 2PF4E 1E84A 1WGWA 4JCZA 2GDCA 5JVEA 1ORSC 3GEEA 2L9JA 1JRAA 1GGQA 4GYTA 4ZLDA 5TJ5E 3JRTA 3EH2A 3LLIA 4X0RA 5COFA 1PD1A 2P0NA 4IARA 4K0DA 3OA1A 2EIKC 2OU6A 4MVUA 4JC7A 4E7ZA 5B1BC 3PCVA 3JSEO 5A6KA 1LS4A 4MTGA 2HKVA 2YLGA 5DLJA 4R32A 1YZCA 4Q7CA 1CPRA 2CW0F 5DS5A 4I1MA 3KYJA 1T6UA 3TQOA 5KYYB 2YWAA 3ABMC 3LNMB 1G8XA 4PR9A 4XLPF 4Q5SF 4DVYP 2OOCA 2YRFA 4AK9A 1PD0A 1YZAA 2NPUA 3SP1A 2AP3A 2OEXA 3F47A 3ZIBA 1Q0MA 2PNOA 2ZXOA 1B68A 3O10A 5JLIA 3A11A 1LE4A 2G62A 3EZHA 2P7VA 1JPJA 4JRZA 4IAQA 4LLEA 2P1AA 2R03A 4MVQA 4CS9C 4JEBA 4YWQA 2XRHA 5L0HA 4G7ZF 2PX0A 5EK0A 4CIHA 1VYKA 5KYXA 3DZAA 3DJUB 1G5ZA 2NSGA 4EUKB 2LFDA 3JTLO 3RF3A 4OD5A 1D1CA 2DB4A 4ZLCA 3FHDA 3NKDA 4JTAB 5F5HA 2AWCA 3Q6NA 1M2VB 1BZ4A 4PK4A 4CDAA 1BR1A 4YL3A 1XZQA 3RIPA 2WZGA 3U9JA 3I4UA 2OCCC 4XPYA 3AG1C 3MLGA 3HLZA 3FAJA 3NMIA 4IGGA 3RH3A 1VYIA 1NBBA 4Z9JA 1V4AA 4DRHB 1M57C 1EKYA 3LS1A 1NZEA 1ZHXA 4YJWA 2Y3GA 1M6TA 4DRJB 3IEEA 3X1OA 4U5EE 1O87A 1ZVZA 3C8GA 4P9TA 3UGPA 1H9TA 3FVYA 1HW1A 4JJFA 3B9QA 5CIVA 2KSFA 1OKKD 4DVZA 3DKAA 1E86A 4AX2A 5JRAA 2DYSC 3LEVA 2XLMA 4BJ1A 5A6BD 4CJOA 2R7XA 2VASA 3NMJA 3POVA 3SEOA 1WOLA 1W2WA 3I5QA 3T6GB 4EWCA 3V5ZA 4U5BE 256BA 5L0CA 5BQIA 4Q4ZF 1BR2A 1D0XA 2Y3DA 4GEHA 3DM9B 4ULVA 3AQCA 1FAPB 3SNHA 5KYYA 2HUJA 3ZC4A 2LK4A 3JSZA 4WABA 4YK5A 2G3VA 2HV7A 4IRUA 1HMOA 2VB6A 3M79A 5A69A 3W8HA 1ZW2A 2XM0A 1LS1A 1TWAA 2L6HA 2ICWG 4JCHA 2Z15A 1H9GA 5AGFA 3TK0A 2V3CC 1MQVA 1K40A 3GM1A 3N0TA 3G4XA 3ZQVA 2X51A 4DJ9A 4YT2A 4KI2A 3EG9B 1S7ZA 1Y4CA 2HJMA 1ZHTA 1CGNA 2H7OA 3AGUA 3N2ZB 3NYMA 4I3MA 3LUTB 1T9KA 2G3KA 3CQZA 4J7TA 2YZSA 1ZHYA 4PACA 3US6A 4BJ5C 5HSWA 1OXKA 2A0UA 2EILC 4W8KA 1XZPA 4NCQA 1FMVA 2W4MA 5L3QA 1YA9A 2NUPA 1A0BA 1J8YF 3L0IA 1F1MA 3NYJA 4MS2A 1AVOB 1ORJA 2MHRA 4U5HA 3EHMA 1NU9C 1WN0A 1Z6AA 2KC3A 2OG2A 2Y69C 3FOPA 4GQHA 3AGTA 3MBGA 1OR2A 3QMKA 4FWVA 1YARO 5HV9A 2KQ9A 3WHNA 3UMIA 1HY5A 4I44A 3PHF2 5D91A 3J06A 4YT5A 4CIPA 3B0UX 1K04A 2EPLX 3K33A 2VCCA 4IJJA 4CDYA 1FTSA 5B3IA 1VB5A 3TJ6A 3U9MA 2B0JA 3R7CA 2UUIA 2FAPB 3ATPA 3JYHA 1TQGA 4L6RA 3HNIA 2V26A 4U5FE 5E33A 3IQCA 3QVZA 2R7WA 2HZ8A 3ASNC 3B0VC 1D0YA 1JMWA 1U6HA 3NKEA 2XSEA 1A7DA 4D4XA 3GWNA 2W9YA 3C8ZA 4O6NA 2GA0A 4JIOA 2C04A 3EZIA 4D4NA 1H6GA 1M56C 2VCAA 2ZD9A 3FOOA 3LJBA 4XEVA 4DRIB 2XLDA 1KU2A 1FFTC 1HE1A 1T5OA 4MVOA 3ZSUA 2DGJA 4G78A 3C63A 3E70C 1VLTA 3HJCA 3SXZA 2YQYA 4C3BA 5DS4A 2R25A 3ABLC 2EPOA 3MYFA 2Q3TA 4JVSA 4K7BA 3RVYA 3MFNA 3Q6MA 5D92A 2GAQA 3GORA 1LM3B 4MNDA 4RD9A 1TWHA 4JTDB 2IBFA 4XTKA 4BEJA 3UNGC 4F4BA 5EHHA 2BE5F 4FAPB 4CSAC 2QTVA 2Q9CA 1R5ID 4EHPA 2IYLD 2VCBA 3QW1A 4JJGA 2A1DD 2Y39A 1NSGB 3SXMA 5JS5A 4ULWA 5BUOA 1Z5ZA 4KBLA 1Q0GA 5FCLA 2GFHA 1RKEB 1CGOA 1NLXA 2OQMA 1HE9A 1ST6A 2XS1A 4H54A 2Q7RA 3FDQA 1A7EA 4IAOA 1I5NA 2PBEA 2YL7A 1SZIA 2J7PA 3EG9A 3KPHA 3HNKA 5DS6A 3LS0A 2IOQA 3S84A 2XM4A 1OCCC 4G0HA 4LDQA 4W8PA 4B6IA 3AJMA 1GS9A 1WASA 3S29A 1Z7Qc 2YVKA 2HJ3A 2XL4A 3JRMO 4MVSA 2CCYA 3EH1A 4CX9A 1Z3IX 5CI9A 3RKOF 2J46A 1E85A 4C7OB 1YYXA 3ZTZA 1RXQA 3BRJA 5KYUA 1VLSA 4JTCB 4C3DA 2IXPA 4XQ1A 2CDQA 1E83A 1JPNA 1SR2A 1AUEA 1C03A 1G4WR 3ZQYA 1VMAA 1VTMP 1RMVA 1K05A 4J7YA 2EPNA 4XPWA 4AE4B 1HW2A 1D0ZA 5L0FA 1PV3A 1DOWA 3LNRA 4JURI 3LLKA 4O7GA 1JOGA 4U5DE 3V5XA 2EPKX 1M2OA 3JCUQ 1OKKA 4MVMA 1OCOC 3V7OA 3B29A 3ASOC 5EGYA 1FFHA 3CAXA 5E2QA 4YT8A 4YT4A 3TOLA 2HV6A 3C18A 3K1IA 5A6BA 1NU7D 4IWBA 2FGYA 4MTOA 2I8BA 3K6BA 3EGDA 5BQHA 2FFHA 1L7CA 4M63A 3EFOB 3U8VA 3B0PA 1O3UA 3HNLA 2R7SA 2WVQA 3SXKA 3U0CA 2QNLA 4LACB 2P6VA 3B71A 2ASRA 3H2VA 4MW3A 4G7HF 5CI8A 2CNWD 5T3WA 4JEAA 4N06A 4RDAA 2RD9A 2OEVA 1SF8A 2CYDA 2XLHA 4O6MA 3U5SA 3FAPB 4DBRA 4KNVA 2AWYA 3ITFA 5JSLA 2VC9A 2J9VA 1LPEA 2D5RB 2NUTB 2L81A 1OXBA 3G50A 3Q7GA 4BJ6A 4EBBA 4XPXA 1IW7F 3ZWIA 4ER9A 5KYNA 1PCXA 4K1OA 4E0IA 2P61A 2ZXPA 4WGZA 3QW0A 2H8AA 1KNYA 4HFFB 4HEAJ 5BQGA 3NMKA 5JT4A 2TMVP 5DQTA 1QKRA 1YLMA 3L8IA 4A4AA 3RQEA 2KW3C 4FESA 3LEOA 1BDJB 5E3AA 1RKEA 4AL1A 3GM2A 2IXOA 3M4BA 3OWTA 5K0IA 2JX0A 4HFKB 3VRCA 4HE8D 1D1BA 1NFNA 1ZZPA 4PJJA 3O6XA 3E9VA 1TFOB 4BPMA 2W45A 1ZU4A 1GQAA 3UMHA 1TWGA 2R7RA 1YYJA 4Z9HA 3AQBA 2J9UA 3O39A 3VYWA 1Z63A 2Q4FA 2LD6A 1ZHWA 4NY3A 3UGOA 3M4CA 2KNHA 2R9RB 1M2VA 4C7OA 2LP4A 2YLDA 4YN0B 2A69F 1BR4A 3HKKA 3CSKA 4U9EA 2XLVA 1V54C 4MVZA 2LQGA 2XLEA 1LIHA 3SYNA 4E18A 4DBQA 4AL0A 2WZLA 2X0CA 1Q0FA 5L0IA 1LI5A 5COGA 4PJMA 4AE4A 1T6IA 1H7IA 2HMZA 1TWCA 2YKZA 1A7VA 1V74B 3I5PA 3LESA 3MYIA 4O79A 4YL0A 4YL1A 1OQCA 4CJGA 5GPGB 4J30B 3ZVRA 2J45A 3W8IA 4NC3A 4CS9A 3EGXB 4OIPF 3DE9A 2YLIA 2EIMC 4BG0A 1I4ZA 3K7DA 5E3CA 2ETSA 1YJGA 2EIJC 2DYRC 3KMIA 4NTFA 4G7OF 2YL0A 4MW8A 3DAGA 4P9FA 1QPUA 3FMSA 5JUAA 1QVXA 3EFOA 3AG3C 2LIGA 5T1DB 5T3TA 3PDMP 1J8MF 3T9OA 1XWJA 2EPMX 3TD7A 3CEXA 3JT1A 4NTBA 2MWQA 2YL1A 3Q7LA 4OIRF 3NRHA 1TFKB 1ORYA 3V5YA 1APCA 1LI7A 3TULA 4N4WA 3RQFA 1G4US 3DI5A 1LKXA 2OJED 4U9DA 4E17A 2E87A 3S28A 3IPMO 1GM5A 2O9XA 4E7SA 1FR0A 3DAFA 2UUHA 3KKBA 2NUTA 5A6JA 2J9BA 3L1MA 3LAYA 3EJNA 3IQ6A 5COMA 2A6HF 1JR8A 1QLEC 1QZXA 3M1CB 3DE8A 3WG7C 1OCRC 3L34A 3T6JA 3EPVA 2R7VA 4XEFA 3CZ6A 1VOMA 2XL8A 4LERA 4BJTA 4QDLA 3L8JA 2QLAA 3A9CA 4JE9A 3RFYA 1D1AA 4CDVA 3M15A 1QQ3A 2L6FA 1NFOA 3DD7A 4ONSA 2CGEA 2HFIA 2H7BA 2BC5A 2YL3A 3S27A 3S90A 2JPUA 3UMKA 3W2VA 2EINC 2KGOA 1YVIA 2J0WA 2WB7A 4BEMJ 1MMNA 1RKCA 4UDVA 4MVRA 4QI0A 2LSEA 4DOZA 4MTFA 3VAYA 3GEIA 3R2PA 3JZ0A 2PX3A 3O55A 4CS8A 1V55C 2QE9A 3ZG1A 1EQ1A 2VH3A 3IQ5A 1MNEA 4N6HA 2J0XA 4C3EA 2NSFA 4FX5A 1CGME 2YHSA 2D4UA 4A2NB 3JYYA 2L7AA 3T6BA 1L3PA 1N1CA 3IQTA 3W2WA 2F22A 3WODF 2XXAB 2NUPB 1O5HA 2Q00A 2R05A 2L6GA 3ABKC 1T6QA 2I15A 4O6YA 4J32B 2J7PD 4JW1A 2HSBA 4PJLA 4BJ5A 4EBKA 1KTMA 2WZFA 4OD4A 2A0BA 4WJ0A 3QTHA 3EGXA 2PP4A 2CNWA 3AG4C 4U5GA 3HNJA 3ZTMA 4WGYA 5DQZA 3H2UA 4RBNA 1MMAA 5FZTA 1UG7A 3NDBB 1JAFA 4LDKA 1FMWA 1ZU5A 4NQFA 5F28E 4PJNA 3C62A 4EKWA 2J8WA 3WAQA 5KYWB 3BEHA 5AC5A 4U5CE 1RJ9B 2AU5A 4KC9A 1NG1A 3K1HA 3KL4A 2QY9A 2XLWA 3DWWA 3GM3A 3S9OA 3SZRA 3U3FA 4CBEA 1SYQA 3G4ZA 3UR3C 4EBJA 1OW7A 2HMQA 2LCHA 2NG1A 2ZXWC 3GEHA 2XS8A 1OW8A 1LE2A 4N6CA 4QI2A 1YDIA 1WTYA 2H7VC 3ZDLA 4ANJA 1C02A 4LDRA 1Q0KA 1MNDA 1CPQA 1ZW3A 3IHUA 3C8GD 3GWLA 4NTAA 3RW0A 3VM6A 4CS7A 3KYIA 4XEKA 4EIYA 2W4BA 2B0HA 1EA8A 3HTKC 1OR3A 2C03A 2IXMA 2ZPAA 5B1AC 1Y6DA 5JP7A 1DOVA 2A6EF 3N24A 4IB4A 4XWJA 1MMDA 3NYLA 4OINF 1Z23A 1TKNA 3OEOA 3PMRA 1ZYRF 1WWPA 2DI3A 3VF0A 3DXJF 5F5FA 2KJGA 1IZMA 3W4YA 2Q9AA 1EI7A 1QSPA 1R4TA 2JD3A 3MX3A 1E2XA 1MMGA 3U8PA 2PFDA 3X2QC 4CS8C 3S0XA 4OIOF 2RSEB 5DVWA 2WVNA 3QZCA 1BBHA
chains in the Genus database with same CATH topology
2AVKA 3WHNA 1HMOA 2HMQA 4XPXA 2AWCA 3AGUA 1I4YA 2HMZA 4XPYA 4XQ1A 1A7DA 3WAQA 1I4ZA 4XPWA 2MHRA 1HMDA 2AWYA 1A7EA 3AGTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AVK A;  3WHN A;  1HMO A;  2HMQ A;  4XPX A;  2AWC A;  3AGU A;  1I4Y A;  2HMZ A;  4XPY A;  4XQ1 A;  1A7D A;  3WAQ A;  1I4Z A;  4XPW A;  2MHR A;  1HMD A;  2AWY A;  1A7E A;  3AGT A; 
#chains in the Genus database with same CATH topology
 2Y3H A;  2AVK A;  2OJQ A;  1C17 M;  3C7J A;  3AG2 C;  1VK5 A;  3F46 A;  4MQ9 F;  3FXH A;  1RCP A;  3U2M A;  5L0G A;  4CSA A;  2R7O A;  2HSQ A;  2R02 A;  1YA7 O;  3DM5 A;  3DMD A;  2XLO A;  2QUP A;  1SMY F;  1OW6 A;  3EHN A;  3K1I C;  4E0H A;  5KYX B;  4PFP A;  3U3B A;  2KK1 A;  2WL8 A;  3GAN A;  2XXA A;  2OKU A;  3H65 A;  5L0D A;  1TR2 A;  1LVK A;  2ZXR A;  5B3S C;  2YEV A;  5AC4 A;  3K66 A;  3EQL F;  4JZA A;  3RVZ A;  1ZHZ A;  2A68 F;  3RYL A;  4PFO A;  3SXY A;  3T4R A;  1YAU O;  5L0J A;  5KYU B;  1FNT c;  3GOD A;  1HMD A;  4DXW A;  2J9W A;  4OIQ F;  4H4K C;  2R7Q A;  2BL2 A;  3AOU A;  1S05 A;  3DJN B;  3TOM A;  4P6I C;  2M64 A;  5IY5 C;  4LLC A;  3KH2 A;  4Z9I A;  2R7U A;  3TJ5 A;  1UFB A;  3QVY A;  1T01 A;  2IXN A;  2WVO A;  4I1O B;  4XLN F;  5A6A A;  2HS5 A;  2MYS A;  3U2L A;  1WAT A;  3NG1 A;  1AEP A;  4BJ6 C;  1U0B B;  2LFF A;  2GWW A;  1Q0D A;  1U89 A;  3ECS A;  5KYW A;  2R7T A;  2M4E A;  4JKV A;  1I4Y A;  1OCZ C;  1RJ9 A;  3C8G B;  4KNW A;  1A41 A;  3RQG A;  2XL6 A;  5L3V A;  2IM8 A;  2Y3B A;  2KYH A;  3EGD B;  2Q9B A;  2PF4 E;  1E84 A;  1WGW A;  4JCZ A;  2GDC A;  5JVE A;  1ORS C;  3GEE A;  2L9J A;  1JRA A;  1GGQ A;  4GYT A;  4ZLD A;  5TJ5 E;  3JRT A;  3EH2 A;  3LLI A;  4X0R A;  5COF A;  1PD1 A;  2P0N A;  4IAR A;  4K0D A;  3OA1 A;  2EIK C;  2OU6 A;  4MVU A;  4JC7 A;  4E7Z A;  5B1B C;  3PCV A;  3JSE O;  5A6K A;  1LS4 A;  4MTG A;  2HKV A;  2YLG A;  5DLJ A;  4R32 A;  1YZC A;  4Q7C A;  1CPR A;  2CW0 F;  5DS5 A;  4I1M A;  3KYJ A;  1T6U A;  3TQO A;  5KYY B;  2YWA A;  3ABM C;  3LNM B;  1G8X A;  4PR9 A;  4XLP F;  4Q5S F;  4DVY P;  2OOC A;  2YRF A;  4AK9 A;  1PD0 A;  1YZA A;  2NPU A;  3SP1 A;  2AP3 A;  2OEX A;  3F47 A;  3ZIB A;  1Q0M A;  2PNO A;  2ZXO A;  1B68 A;  3O10 A;  5JLI A;  3A11 A;  1LE4 A;  2G62 A;  3EZH A;  2P7V A;  1JPJ A;  4JRZ A;  4IAQ A;  4LLE A;  2P1A A;  2R03 A;  4MVQ A;  4CS9 C;  4JEB A;  4YWQ A;  2XRH A;  5L0H A;  4G7Z F;  2PX0 A;  5EK0 A;  4CIH A;  1VYK A;  5KYX A;  3DZA A;  3DJU B;  1G5Z A;  2NSG A;  4EUK B;  2LFD A;  3JTL O;  3RF3 A;  4OD5 A;  1D1C A;  2DB4 A;  4ZLC A;  3FHD A;  3NKD A;  4JTA B;  5F5H A;  2AWC A;  3Q6N A;  1M2V B;  1BZ4 A;  4PK4 A;  4CDA A;  1BR1 A;  4YL3 A;  1XZQ A;  3RIP A;  2WZG A;  3U9J A;  3I4U A;  2OCC C;  4XPY A;  3AG1 C;  3MLG A;  3HLZ A;  3FAJ A;  3NMI A;  4IGG A;  3RH3 A;  1VYI A;  1NBB A;  4Z9J A;  1V4A A;  4DRH B;  1M57 C;  1EKY A;  3LS1 A;  1NZE A;  1ZHX A;  4YJW A;  2Y3G A;  1M6T A;  4DRJ B;  3IEE A;  3X1O A;  4U5E E;  1O87 A;  1ZVZ A;  3C8G A;  4P9T A;  3UGP A;  1H9T A;  3FVY A;  1HW1 A;  4JJF A;  3B9Q A;  5CIV A;  2KSF A;  1OKK D;  4DVZ A;  3DKA A;  1E86 A;  4AX2 A;  5JRA A;  2DYS C;  3LEV A;  2XLM A;  4BJ1 A;  5A6B D;  4CJO A;  2R7X A;  2VAS A;  3NMJ A;  3POV A;  3SEO A;  1WOL A;  1W2W A;  3I5Q A;  3T6G B;  4EWC A;  3V5Z A;  4U5B E;  256B A;  5L0C A;  5BQI A;  4Q4Z F;  1BR2 A;  1D0X A;  2Y3D A;  4GEH A;  3DM9 B;  4ULV A;  3AQC A;  1FAP B;  3SNH A;  5KYY A;  2HUJ A;  3ZC4 A;  2LK4 A;  3JSZ A;  4WAB A;  4YK5 A;  2G3V A;  2HV7 A;  4IRU A;  1HMO A;  2VB6 A;  3M79 A;  5A69 A;  3W8H A;  1ZW2 A;  2XM0 A;  1LS1 A;  1TWA A;  2L6H A;  2ICW G;  4JCH A;  2Z15 A;  1H9G A;  5AGF A;  3TK0 A;  2V3C C;  1MQV A;  1K40 A;  3GM1 A;  3N0T A;  3G4X A;  3ZQV A;  2X51 A;  4DJ9 A;  4YT2 A;  4KI2 A;  3EG9 B;  1S7Z A;  1Y4C A;  2HJM A;  1ZHT A;  1CGN A;  2H7O A;  3AGU A;  3N2Z B;  3NYM A;  4I3M A;  3LUT B;  1T9K A;  2G3K A;  3CQZ A;  4J7T A;  2YZS A;  1ZHY A;  4PAC A;  3US6 A;  4BJ5 C;  5HSW A;  1OXK A;  2A0U A;  2EIL C;  4W8K A;  1XZP A;  4NCQ A;  1FMV A;  2W4M A;  5L3Q A;  1YA9 A;  2NUP A;  1A0B A;  1J8Y F;  3L0I A;  1F1M A;  3NYJ A;  4MS2 A;  1AVO B;  1ORJ A;  2MHR A;  4U5H A;  3EHM A;  1NU9 C;  1WN0 A;  1Z6A A;  2KC3 A;  2OG2 A;  2Y69 C;  3FOP A;  4GQH A;  3AGT A;  3MBG A;  1OR2 A;  3QMK A;  4FWV A;  1YAR O;  5HV9 A;  2KQ9 A;  3WHN A;  3UMI A;  1HY5 A;  4I44 A;  3PHF 2;  5D91 A;  3J06 A;  4YT5 A;  4CIP A;  3B0U X;  1K04 A;  2EPL X;  3K33 A;  2VCC A;  4IJJ A;  4CDY A;  1FTS A;  5B3I A;  1VB5 A;  3TJ6 A;  3U9M A;  2B0J A;  3R7C A;  2UUI A;  2FAP B;  3ATP A;  3JYH A;  1TQG A;  4L6R A;  3HNI A;  2V26 A;  4U5F E;  5E33 A;  3IQC A;  3QVZ A;  2R7W A;  2HZ8 A;  3ASN C;  3B0V C;  1D0Y A;  1JMW A;  1U6H A;  3NKE A;  2XSE A;  1A7D A;  4D4X A;  3GWN A;  2W9Y A;  3C8Z A;  4O6N A;  2GA0 A;  4JIO A;  2C04 A;  3EZI A;  4D4N A;  1H6G A;  1M56 C;  2VCA A;  2ZD9 A;  3FOO A;  3LJB A;  4XEV A;  4DRI B;  2XLD A;  1KU2 A;  1FFT C;  1HE1 A;  1T5O A;  4MVO A;  3ZSU A;  2DGJ A;  4G78 A;  3C63 A;  3E70 C;  1VLT A;  3HJC A;  3SXZ A;  2YQY A;  4C3B A;  5DS4 A;  2R25 A;  3ABL C;  2EPO A;  3MYF A;  2Q3T A;  4JVS A;  4K7B A;  3RVY A;  3MFN A;  3Q6M A;  5D92 A;  2GAQ A;  3GOR A;  1LM3 B;  4MND A;  4RD9 A;  1TWH A;  4JTD B;  2IBF A;  4XTK A;  4BEJ A;  3UNG C;  4F4B A;  5EHH A;  2BE5 F;  4FAP B;  4CSA C;  2QTV A;  2Q9C A;  1R5I D;  4EHP A;  2IYL D;  2VCB A;  3QW1 A;  4JJG A;  2A1D D;  2Y39 A;  1NSG B;  3SXM A;  5JS5 A;  4ULW A;  5BUO A;  1Z5Z A;  4KBL A;  1Q0G A;  5FCL A;  2GFH A;  1RKE B;  1CGO A;  1NLX A;  2OQM A;  1HE9 A;  1ST6 A;  2XS1 A;  4H54 A;  2Q7R A;  3FDQ A;  1A7E A;  4IAO A;  1I5N A;  2PBE A;  2YL7 A;  1SZI A;  2J7P A;  3EG9 A;  3KPH A;  3HNK A;  5DS6 A;  3LS0 A;  2IOQ A;  3S84 A;  2XM4 A;  1OCC C;  4G0H A;  4LDQ A;  4W8P A;  4B6I A;  3AJM A;  1GS9 A;  1WAS A;  3S29 A;  1Z7Q c;  2YVK A;  2HJ3 A;  2XL4 A;  3JRM O;  4MVS A;  2CCY A;  3EH1 A;  4CX9 A;  1Z3I X;  5CI9 A;  3RKO F;  2J46 A;  1E85 A;  4C7O B;  1YYX A;  3ZTZ A;  1RXQ A;  3BRJ A;  5KYU A;  1VLS A;  4JTC B;  4C3D A;  2IXP A;  4XQ1 A;  2CDQ A;  1E83 A;  1JPN A;  1SR2 A;  1AUE A;  1C03 A;  1G4W R;  3ZQY A;  1VMA A;  1VTM P;  1RMV A;  1K05 A;  4J7Y A;  2EPN A;  4XPW A;  4AE4 B;  1HW2 A;  1D0Z A;  5L0F A;  1PV3 A;  1DOW A;  3LNR A;  4JUR I;  3LLK A;  4O7G A;  1JOG A;  4U5D E;  3V5X A;  2EPK X;  1M2O A;  3JCU Q;  1OKK A;  4MVM A;  1OCO C;  3V7O A;  3B29 A;  3ASO C;  5EGY A;  1FFH A;  3CAX A;  5E2Q A;  4YT8 A;  4YT4 A;  3TOL A;  2HV6 A;  3C18 A;  3K1I A;  5A6B A;  1NU7 D;  4IWB A;  2FGY A;  4MTO A;  2I8B A;  3K6B A;  3EGD A;  5BQH A;  2FFH A;  1L7C A;  4M63 A;  3EFO B;  3U8V A;  3B0P A;  1O3U A;  3HNL A;  2R7S A;  2WVQ A;  3SXK A;  3U0C A;  2QNL A;  4LAC B;  2P6V A;  3B71 A;  2ASR A;  3H2V A;  4MW3 A;  4G7H F;  5CI8 A;  2CNW D;  5T3W A;  4JEA A;  4N06 A;  4RDA A;  2RD9 A;  2OEV A;  1SF8 A;  2CYD A;  2XLH A;  4O6M A;  3U5S A;  3FAP B;  4DBR A;  4KNV A;  2AWY A;  3ITF A;  5JSL A;  2VC9 A;  2J9V A;  1LPE A;  2D5R B;  2NUT B;  2L81 A;  1OXB A;  3G50 A;  3Q7G A;  4BJ6 A;  4EBB A;  4XPX A;  1IW7 F;  3ZWI A;  4ER9 A;  5KYN A;  1PCX A;  4K1O A;  4E0I A;  2P61 A;  2ZXP A;  4WGZ A;  3QW0 A;  2H8A A;  1KNY A;  4HFF B;  4HEA J;  5BQG A;  3NMK A;  5JT4 A;  2TMV P;  5DQT A;  1QKR A;  1YLM A;  3L8I A;  4A4A A;  3RQE A;  2KW3 C;  4FES A;  3LEO A;  1BDJ B;  5E3A A;  1RKE A;  4AL1 A;  3GM2 A;  2IXO A;  3M4B A;  3OWT A;  5K0I A;  2JX0 A;  4HFK B;  3VRC A;  4HE8 D;  1D1B A;  1NFN A;  1ZZP A;  4PJJ A;  3O6X A;  3E9V A;  1TFO B;  4BPM A;  2W45 A;  1ZU4 A;  1GQA A;  3UMH A;  1TWG A;  2R7R A;  1YYJ A;  4Z9H A;  3AQB A;  2J9U A;  3O39 A;  3VYW A;  1Z63 A;  2Q4F A;  2LD6 A;  1ZHW A;  4NY3 A;  3UGO A;  3M4C A;  2KNH A;  2R9R B;  1M2V A;  4C7O A;  2LP4 A;  2YLD A;  4YN0 B;  2A69 F;  1BR4 A;  3HKK A;  3CSK A;  4U9E A;  2XLV A;  1V54 C;  4MVZ A;  2LQG A;  2XLE A;  1LIH A;  3SYN A;  4E18 A;  4DBQ A;  4AL0 A;  2WZL A;  2X0C A;  1Q0F A;  5L0I A;  1LI5 A;  5COG A;  4PJM A;  4AE4 A;  1T6I A;  1H7I A;  2HMZ A;  1TWC A;  2YKZ A;  1A7V A;  1V74 B;  3I5P A;  3LES A;  3MYI A;  4O79 A;  4YL0 A;  4YL1 A;  1OQC A;  4CJG A;  5GPG B;  4J30 B;  3ZVR A;  2J45 A;  3W8I A;  4NC3 A;  4CS9 A;  3EGX B;  4OIP F;  3DE9 A;  2YLI A;  2EIM C;  4BG0 A;  1I4Z A;  3K7D A;  5E3C A;  2ETS A;  1YJG A;  2EIJ C;  2DYR C;  3KMI A;  4NTF A;  4G7O F;  2YL0 A;  4MW8 A;  3DAG A;  4P9F A;  1QPU A;  3FMS A;  5JUA A;  1QVX A;  3EFO A;  3AG3 C;  2LIG A;  5T1D B;  5T3T A;  3PDM P;  1J8M F;  3T9O A;  1XWJ A;  2EPM X;  3TD7 A;  3CEX A;  3JT1 A;  4NTB A;  2MWQ A;  2YL1 A;  3Q7L A;  4OIR F;  3NRH A;  1TFK B;  1ORY A;  3V5Y A;  1APC A;  1LI7 A;  3TUL A;  4N4W A;  3RQF A;  1G4U S;  3DI5 A;  1LKX A;  2OJE D;  4U9D A;  4E17 A;  2E87 A;  3S28 A;  3IPM O;  1GM5 A;  2O9X A;  4E7S A;  1FR0 A;  3DAF A;  2UUH A;  3KKB A;  2NUT A;  5A6J A;  2J9B A;  3L1M A;  3LAY A;  3EJN A;  3IQ6 A;  5COM A;  2A6H F;  1JR8 A;  1QLE C;  1QZX A;  3M1C B;  3DE8 A;  3WG7 C;  1OCR C;  3L34 A;  3T6J A;  3EPV A;  2R7V A;  4XEF A;  3CZ6 A;  1VOM A;  2XL8 A;  4LER A;  4BJT A;  4QDL A;  3L8J A;  2QLA A;  3A9C A;  4JE9 A;  3RFY A;  1D1A A;  4CDV A;  3M15 A;  1QQ3 A;  2L6F A;  1NFO A;  3DD7 A;  4ONS A;  2CGE A;  2HFI A;  2H7B A;  2BC5 A;  2YL3 A;  3S27 A;  3S90 A;  2JPU A;  3UMK A;  3W2V A;  2EIN C;  2KGO A;  1YVI A;  2J0W A;  2WB7 A;  4BEM J;  1MMN A;  1RKC A;  4UDV A;  4MVR A;  4QI0 A;  2LSE A;  4DOZ A;  4MTF A;  3VAY A;  3GEI A;  3R2P A;  3JZ0 A;  2PX3 A;  3O55 A;  4CS8 A;  1V55 C;  2QE9 A;  3ZG1 A;  1EQ1 A;  2VH3 A;  3IQ5 A;  1MNE A;  4N6H A;  2J0X A;  4C3E A;  2NSF A;  4FX5 A;  1CGM E;  2YHS A;  2D4U A;  4A2N B;  3JYY A;  2L7A A;  3T6B A;  1L3P A;  1N1C A;  3IQT A;  3W2W A;  2F22 A;  3WOD F;  2XXA B;  2NUP B;  1O5H A;  2Q00 A;  2R05 A;  2L6G A;  3ABK C;  1T6Q A;  2I15 A;  4O6Y A;  4J32 B;  2J7P D;  4JW1 A;  2HSB A;  4PJL A;  4BJ5 A;  4EBK A;  1KTM A;  2WZF A;  4OD4 A;  2A0B A;  4WJ0 A;  3QTH A;  3EGX A;  2PP4 A;  2CNW A;  3AG4 C;  4U5G A;  3HNJ A;  3ZTM A;  4WGY A;  5DQZ A;  3H2U A;  4RBN A;  1MMA A;  5FZT A;  1UG7 A;  3NDB B;  1JAF A;  4LDK A;  1FMW A;  1ZU5 A;  4NQF A;  5F28 E;  4PJN A;  3C62 A;  4EKW A;  2J8W A;  3WAQ A;  5KYW B;  3BEH A;  5AC5 A;  4U5C E;  1RJ9 B;  2AU5 A;  4KC9 A;  1NG1 A;  3K1H A;  3KL4 A;  2QY9 A;  2XLW A;  3DWW A;  3GM3 A;  3S9O A;  3SZR A;  3U3F A;  4CBE A;  1SYQ A;  3G4Z A;  3UR3 C;  4EBJ A;  1OW7 A;  2HMQ A;  2LCH A;  2NG1 A;  2ZXW C;  3GEH A;  2XS8 A;  1OW8 A;  1LE2 A;  4N6C A;  4QI2 A;  1YDI A;  1WTY A;  2H7V C;  3ZDL A;  4ANJ A;  1C02 A;  4LDR A;  1Q0K A;  1MND A;  1CPQ A;  1ZW3 A;  3IHU A;  3C8G D;  3GWL A;  4NTA A;  3RW0 A;  3VM6 A;  4CS7 A;  3KYI A;  4XEK A;  4EIY A;  2W4B A;  2B0H A;  1EA8 A;  3HTK C;  1OR3 A;  2C03 A;  2IXM A;  2ZPA A;  5B1A C;  1Y6D A;  5JP7 A;  1DOV A;  2A6E F;  3N24 A;  4IB4 A;  4XWJ A;  1MMD A;  3NYL A;  4OIN F;  1Z23 A;  1TKN A;  3OEO A;  3PMR A;  1ZYR F;  1WWP A;  2DI3 A;  3VF0 A;  3DXJ F;  5F5F A;  2KJG A;  1IZM A;  3W4Y A;  2Q9A A;  1EI7 A;  1QSP A;  1R4T A;  2JD3 A;  3MX3 A;  1E2X A;  1MMG A;  3U8P A;  2PFD A;  3X2Q C;  4CS8 C;  3S0X A;  4OIO F;  2RSE B;  5DVW A;  2WVN A;  3QZC A;  1BBH A; 
#chains in the Genus database with same CATH homology
 2AVK A;  3WHN A;  1HMO A;  2HMQ A;  4XPX A;  2AWC A;  3AGU A;  1I4Y A;  2HMZ A;  4XPY A;  4XQ1 A;  1A7D A;  3WAQ A;  1I4Z A;  4XPW A;  2MHR A;  1HMD A;  2AWY A;  1A7E A;  3AGT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...