2AVKA

Met-azido-dcrh-hr
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
133
structure length
133
Chain Sequence
DVLVKWSEDLANLPSIDTQHKRLVDYINDLYRAARRRDMDKAREVFDALKNYAVEHFGYEERLFADYAYPEATRHKEIHRRFVETVLKWEKQLAAGDPEVVMTTLRGLVDWLVNHIMKEDKKYEAYLRERGVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hemerythrin-like domain protein DcrH
publication title Structural Basis for O(2) Sensing by the Hemerythrin-like Domain of a Bacterial Chemotaxis Protein: Substrate Tunnel and Fluxional N Terminus.
pubmed doi rcsb
source organism Desulfovibrio vulgaris
molecule tags Oxygen storage/transport
total genus 59
structure length 133
sequence length 133
ec nomenclature
pdb deposition date 2005-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01814 Hemerythrin Hemerythrin HHE cation binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.50 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Hemerythrin-like 2avkA00
2AVKA 4XPWA 3WAQA 2HMQA 4XPXA 2AWCA 1HMDA 3AGUA 3AGTA 4XQ1A 1A7EA 2AWYA 1I4YA 3WHNA 1HMOA 4XPYA 2MHRA 2HMZA 1I4ZA 1A7DA
chains in the Genus database with same CATH superfamily
1TFOB 2KW3C 1D1BA 3QZCA 2H7BA 2YL7A 3W2VA 3V5YA 4AK9A 3MFNA 4N6HA 2W4BA 1TWCA 1EKYA 1UFBA 2NG1A 3AG4C 2Y3GA 1VTMP 2XLWA 4F4BA 1OCRC 2NPUA 1LM3B 3SNHA 4FAPB 2HFIA 1FMVA 2OEXA 3US6A 2A0BA 4MW3A 3UGPA 4DVZA 5JLIA 3GEIA 3H2UA 4RBNA 1FMWA 3C63A 2HKVA 1QVXA 2YRFA 1Q0FA 3L8JA 4KBLA 4RD9A 1LIHA 3ZTZA 1RCPA 1M2OA 1ST6A 3Q7LA 3F46A 4K0DA 4E7ZA 4MW8A 4MNDA 1I4ZA 2Q00A 4D4XA 1OR2A 3FOOA 4JCZA 1JMWA 4DJ9A 1C03A 2G62A 3BEHA 1GM5A 1R5ID 1NSGB 2WVNA 3ECSA 1YYJA 2EPNA 3I5PA 1MQVA 3IHUA 3UR3C 2R7RA 1TWHA 1SMYF 4NTFA 1TKNA 1LI5A 4OIQF 1OW8A 4JTCB 3M79A 4XLNF 4CS8C 1Z63A 1N1CA 3KKBA 2Q7RA 3L1MA 5IY5C 2EILC 2W9YA 3ABMC 1KU2A 1OR3A 2VB6A 2J46A 2H8AA 2VCCA 2WVQA 4YT8A 4U9DA 4JEAA 4E17A 4ZLCA 2A6EF 2D5RB 1WATA 2LQGA 4MTGA 5L0HA 2R03A 3RW0A 3H2VA 2YLDA 3JYYA 3NKDA 3RKOF 3U3BA 3TJ5A 4CJOA 1L7CA 5KYYB 4C7OA 5FZTA 3DI5A 4IGGA 2YWAA 3K1IC 2OG2A 4YL3A 4PR9A 3TJ6A 5L0JA 2XL4A 2Q3TA 3DZAA 4XTKA 3DD7A 1ORJA 5DS6A 5BQHA 1MMGA 5DS5A 2ZXPA 1JPJA 1W2WA 4O6MA 5JS5A 4JRZA 5T3WA 2LD6A 3E70C 1NU9C 3DXJF 1S7ZA 3SZRA 3C8GD 3AGTA 4C3BA 1V4AA 1VOMA 1YLMA 5B1AC 2D4UA 4NY3A 4C3DA 2A69F 3FXHA 1OCCC 1M2VA 3MYIA 2OJQA 1NFOA 4Z9JA 3LS1A 3DWWA 4OIRF 2XL6A 1LI7A 2YLIA 2P7VA 1NFNA 2PF4E 3DE9A 3M4CA 4WGYA 4CDAA 4JC7A 4IAOA 1RMVA 1G4US 1WGWA 1CPRA 2R7UA 4MVQA 4B6IA 1LVKA 5JUAA 1Z23A 2EIKC 2J9VA 3DAFA 4D4NA 2L6FA 4ULVA 1M56C 4MTOA 4JCHA 3FDQA 2Y3BA 1OKKD 2LP4A 2R7QA 2HZ8A 2VCAA 3DJNB 3BRJA 2O9XA 3JYHA 2F22A 4IRUA 1YARO 3E9VA 3K1HA 1ZVZA 1A0BA 2GAQA 1SF8A 2PBEA 2BE5F 2JPUA 1E2XA 3TOMA 3L0IA 3HTKC 4JVSA 4U5CE 5AGFA 1Y6DA 2LCHA 2XSEA 1C17M 4G7ZF 3W8IA 1FTSA 1QLEC 1OXKA 3EFOB 5L3VA 4FX5A 2YLGA 3T9OA 3ZVRA 5F5FA 4ZLDA 1WTYA 3B0UX 3AG3C 3PCVA 1J8YF 2J45A 2XS8A 3KMIA 5F5HA 2PNOA 3W2WA 3CZ6A 4U5FE 2V3CC 2R25A 1ZU4A 3FOPA 1VB5A 2R7OA 3QTHA 2ICWG 1UG7A 3OA1A 5KYWB 1B68A 3PDMP 4PJJA 3EGDB 2MWQA 1YA9A 3EPVA 3GODA 5L0DA 3LESA 2QLAA 1O3UA 5E2QA 3UMKA 3M4BA 4MS2A 1H7IA 1XZPA 2OEVA 3SP1A 1H9GA 2GWWA 4MVSA 5JRAA 4Q5SF 1E86A 1NBBA 4KNVA 2R05A 1T01A 2XRHA 3DE8A 1OCZC 3EG9A 4EIYA 4JZAA 3JSZA 1KNYA 4BEMJ 3M1CB 1IZMA 4JEBA 3W4YA 1YZAA 3OEOA 2R9RB 1XWJA 1F1MA 2QUPA 2Y69C 4CIPA 5HV9A 3B0VC 1WASA 3AQCA 1LS1A 2X51A 3K33A 4O6NA 4U5BE 2FAPB 1AEPA 1ZZPA 4CBEA 1Z5ZA 2HV7A 3SXZA 3ZDLA 4E7SA 2CCYA 2J7PA 3EH1A 4EBKA 1Z6AA 3S0XA 4EBJA 4NCQA 3GWLA 1NU7D 4DBQA 2KQ9A 2R7WA 3U2MA 3G50A 3GANA 4HFFB 4L6RA 3HNJA 4CX9A 3EH2A 4DXWA 3FAJA 4JTDB 5T1DB 3RQGA 4PJNA 3SXYA 3T6JA 2IXPA 1I5NA 4Z9HA 5B1BC 4NTAA 1OCOC 4IWBA 1ZHZA 3Q6MA 3DAGA 3JRMO 4A4AA 3POVA 2ASRA 3O6XA 4U5GA 3EHNA 4J32B 2CGEA 2DGJA 2CNWA 3JZ0A 2Y3HA 4E0IA 3B0PA 3CQZA 1QSPA 2MHRA 1NLXA 1LE4A 1V54C 3NKEA 4KNWA 1WOLA 1TWAA 3SXMA 1YAUO 2J9BA 1T6IA 5BQGA 1MNDA 1FFTC 2ETSA 4U5EE 3EG9B 5JP7A 4XPXA 3WODF 3GEEA 2W4MA 3GM1A 3TK0A 4JJGA 5EGYA 1HMDA 3GM2A 1JAFA 5JSLA 2AP3A 3QVZA 5A69A 3X1OA 2M64A 2L81A 2EPLX 3AQBA 1BZ4A 2W45A 1R4TA 2J0WA 2OKUA 4AL0A 1L3PA 3ASNC 4U5HA 1QPUA 1O87A 3KH2A 4JIOA 4Q7CA 1FFHA 2OJED 2R7TA 4YL0A 5D91A 4CSAA 3K7DA 2KC3A 3DM5A 3S90A 2HUJA 3JCUQ 4XPYA 3EFOA 5A6BA 2ZD9A 5A6BD 3EZIA 3EJNA 2XLMA 2C03A 3S29A 4BJ5A 1ZW2A 2OQMA 2P6VA 2HMZA 3RQEA 2VCBA 1TFKB 5FCLA 1VLTA 2YZSA 2NUTB 1O5HA 1BR1A 3RH3A 1Q0GA 3V5ZA 4ANJA 2KJGA 3G4XA 1MMNA 5A6JA 2P0NA 1T6UA 3IEEA 1EI7A 2I15A 3B71A 5KYWA 2XLOA 3ABKC 3LLKA 1YDIA 4E0HA 1D0XA 1VMAA 3EGDA 3U2LA 4A2NB 5B3SC 2B0JA 1M6TA 3JSEO 2KNHA 3UMIA 4CS9A 1KTMA 2VH3A 4EHPA 3B9QA 1QKRA 2XXAA 2IM8A 3RIPA 5B3IA 1AVOB 3TULA 2PX0A 3ATPA 3WHNA 4OD5A 1GQAA 4CIHA 2QY9A 4HFKB 5DLJA 2RD9A 3ITFA 1LPEA 2I8BA 2KYHA 4NTBA 3IQCA 4P9FA 2IXOA 3ZSUA 2YQYA 1Q0MA 3U3FA 2PFDA 3C7JA 1VLSA 2Q9BA 3C8ZA 2DYSC 4BEJA 2KGOA 3AG2C 4LDQA 3U5SA 3FHDA 2BC5A 2G3KA 3C62A 1PD0A 3ZWIA 3MBGA 3Q6NA 2HJ3A 4O6YA 2LFDA 4LACB 2Q4FA 3K6BA 2A68F 4Z9IA 1D0YA 1I4YA 2VASA 3S9OA 1A41A 2FGYA 5AC4A 5BQIA 3NRHA 4M63A 5DQTA 5KYXB 1FR0A 3IQ6A 2NUPB 4RDAA 3A9CA 4U9EA 3DKAA 3RFYA 4XEVA 3NDBB 5KYNA 3SYNA 4JTAB 5L0IA 2CYDA 4P9TA 4QI0A 3QVYA 4HE8D 1U6HA 2J8WA 4JKVA 3FMSA 3JTLO 1OXBA 2HSBA 3I5QA 4G78A 3U8PA 2JD3A 4JW1A 2A0UA 3ZG1A 4CS7A 1RKEA 2HV6A 2XM0A 5EK0A 1ZHXA 2LIGA 3I4UA 5COMA 2XXAB 2L6GA 4YT5A 5DVWA 1BBHA 1A7EA 2EIMC 4E18A 4CSAC 3NYLA 3HLZA 4I1MA 1YVIA 2YL3A 3Q7GA 4DBRA 4G0HA 2ZXRA 5A6AA 4LDKA 2YL1A 1AUEA 4IJJA 3N0TA 2R02A 4PJLA 4YL1A 4BJ5C 3H65A 3TD7A 2HS5A 2WZLA 4NQFA 3MYFA 3RQFA 1XZQA 4DVYP 1OW7A 3NYJA 3T6BA 2OCCC 2WZFA 4YT4A 3VYWA 4YK5A 3EZHA 2EPOA 2C04A 1PV3A 3CSKA 4LERA 4BPMA 4Q4ZF 3JT1A 4MVOA 2UUIA 4IAQA 4XPWA 4CDVA 3NMJA 3B29A 1M57C 2YVKA 3L34A 4PFPA 2J7PD 3OWTA 2VC9A 3AGUA 4CS9C 1V55C 2IXNA 4PFOA 3ABLC 3HNLA 3SEOA 3FVYA 2NUTA 4IARA 2IOQA 1WN0A 4YN0B 5E3CA 4JJFA 2Y3DA 3F47A 4MTFA 1HW1A 5T3TA 1T9KA 3V5XA 1HE9A 3LUTB 5HSWA 1D0ZA 1MMAA 4J7TA 3ASOC 4WJ0A 1LS4A 3S27A 2WB7A 2J0XA 4DRHB 1EA8A 3ZTMA 1CGNA 1VYIA 3MLGA 4N6CA 4O7GA 3UNGC 3ZIBA 3ZQYA 5BUOA 2KK1A 5K0IA 2QTVA 5GPGB 5E3AA 2YL0A 2JX0A 2M4EA 3AOUA 2CNWD 1PCXA 1RKEB 2A1DD 3AG1C 1EQ1A 3RVZA 1JR8A 3CEXA 1Z3IX 1G5ZA 4EUKB 3WAQA 1RJ9A 5L0CA 1PD1A 2WZGA 3QMKA 4BJTA 4EWCA 2WVOA 1C02A 3JRTA 4WGZA 3VM6A 4CDYA 1A7VA 1V74B 4MVUA 2J9WA 4GQHA 1RKCA 2AU5A 2AWYA 4WABA 1MMDA 1HE1A 1OQCA 3N2ZB 4H54A 4N06A 2J9UA 3PHF2 4P6IC 4KC9A 3HKKA 1CGOA 2IBFA 3IQTA 5DS4A 1T6QA 4HEAJ 5AC5A 4PJMA 2Y39A 3T6GB 2OOCA 3L8IA 2NSFA 2A6HF 2ZXOA 3EHMA 4EKWA 5COGA 5L0FA 4GEHA 3RVYA 5KYXA 2NUPA 1OW6A 2Q9AA 3GORA 1TR2A 3G4ZA 2AVKA 2PP4A 4NC3A 3CAXA 4QDLA 2HMQA 4AE4A 2CDQA 2AWCA 4OD4A 3QW1A 4JE9A 1ORSC 2BL2A 2Z15A 3U9MA 1TWGA 1E83A 4IB4A 1D1CA 4KI2A 2R7VA 1DOWA 2EPMX 3HJCA 1FAPB 3DMDA 3UMHA 1G8XA 2P1AA 3DM9B 5F28E 3FAPB 4LLEA 3K66A 4UDVA 3T4RA 2R7SA 2QNLA 4FESA 1VYKA 3KYJA 4BJ1A 4EBBA 5COFA 3LAYA 4BJ6A 1HMOA 1K40A 1QZXA 4XWJA 2OU6A 1WWPA 1JOGA 1RJ9B 4XLPF 4W8PA 5TJ5E 1J8MF 1SR2A 1ZHYA 2P61A 2CW0F 2YHSA 5KYUA 5E33A 5A6KA 4XEKA 2L9JA 1ZU5A 2PX3A 4YT2A 1LKXA 1CPQA 3IPMO 5CIVA 1Q0KA 2FFHA 3C8GA 4PK4A 1APCA 1Z7Qc 2XM4A 3EGXA 4YWQA 2ZPAA 3LNMB 2XL8A 1BR4A 3O39A 2X0CA 4OIPF 2YEVA 3R2PA 3VF0A 3UGOA 1TQGA 2V26A 2GA0A 4J7YA 1E84A 1GGQA 1NG1A 2DYRC 4DRIB 2LFFA 3U9JA 4ER9A 1ZHWA 4GYTA 4W8KA 1LE2A 2HSQA 3GWNA 2QE9A 2XLHA 2YKZA 2XLVA 3LEOA 1MNEA 1OKKA 1Q0DA 4ONSA 3TQOA 4AE4B 3VAYA 4K7BA 1ZW3A 3LEVA 2IYLD 1QQ3A 4MVZA 3RYLA 3X2QC 2XS1A 3LLIA 2L7AA 3N24A 4H4KC 1T5OA 2G3VA 4I1OB 3RF3A 3ZC4A 5KYYA 2RSEB 1BR2A 1DOVA 1ZHTA 2H7OA 3MX3A 4K1OA 4DRJB 5EHHA 5L3QA 2R7XA 3GM3A 2EINC 2ZXWC 2XLEA 2HJMA 4O79A 5CI9A 4OIOF 1NZEA 1YZCA 3LJBA 1YJGA 1H6GA 2GFHA 4XQ1A 4MVMA 4BG0A 1RXQA 2E87A 3J06A 3AJMA 2B0HA 3DJUB 3KPHA 3NMIA 4C7OB 4CS8A 3S84A 3ZQVA 5JT4A 4MVRA 1K04A 2DB4A 1BDJB 4DOZA 3PMRA 1YA7O 2TMVP 1S05A 5KYUB 5JVEA 2LK4A 3NYMA 4AX2A 2KSFA 2L6HA 4JURI 1ORYA 3C18A 1JRAA 3VRCA 1HY5A 256BA 2GDCA 4I3MA 1ZYRF 2UUHA 2LSEA 3HNKA 3C8GB 2IXMA 1K05A 3KL4A 4OINF 4LLCA 2H7VC 3EGXB 2MYSA 5L0GA 5DQZA 4J30B 3K1IA 3NG1A 4ULWA 3TOLA 4C3EA 1M2VB 4N4WA 2EIJC 4CJGA 4QI2A 3EQLF 1IW7F 2Q9CA 3IQ5A 3S28A 3HNIA 3V7OA 1CGME 3U0CA 1GS9A 1SYQA 4AL1A 1FNTc 4R32A 3LNRA 1H9TA 1HW2A 4LDRA 1D1AA 1SZIA 4BJ6C 2WL8A 2NSGA 1G4WR 3WG7C 1JPNA 3NMKA 3SXKA 4XEFA 4G7HF 3O55A 2DI3A 1U0BB 3LS0A 3O10A 4MQ9F 3A11A 4YJWA 3GEHA 3U8VA 4G7OF 1Y4CA 2XLDA 4I44A 2EPKX 5CI8A 1VK5A 5D92A 3R7CA 1E85A 3QW0A 1U89A 4X0RA 3KYIA 3W8HA 1YYXA 4PACA 4U5DE 4FWVA 1A7DA 3M15A
chains in the Genus database with same CATH topology
2AVKA 4XPWA 3WAQA 2HMQA 4XPXA 2AWCA 1HMDA 3AGUA 3AGTA 4XQ1A 1A7EA 2AWYA 1I4YA 3WHNA 1HMOA 4XPYA 2MHRA 2HMZA 1I4ZA 1A7DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AVK A;  4XPW A;  3WAQ A;  2HMQ A;  4XPX A;  2AWC A;  1HMD A;  3AGU A;  3AGT A;  4XQ1 A;  1A7E A;  2AWY A;  1I4Y A;  3WHN A;  1HMO A;  4XPY A;  2MHR A;  2HMZ A;  1I4Z A;  1A7D A; 
#chains in the Genus database with same CATH topology
 1TFO B;  2KW3 C;  1D1B A;  3QZC A;  2H7B A;  2YL7 A;  3W2V A;  3V5Y A;  4AK9 A;  3MFN A;  4N6H A;  2W4B A;  1TWC A;  1EKY A;  1UFB A;  2NG1 A;  3AG4 C;  2Y3G A;  1VTM P;  2XLW A;  4F4B A;  1OCR C;  2NPU A;  1LM3 B;  3SNH A;  4FAP B;  2HFI A;  1FMV A;  2OEX A;  3US6 A;  2A0B A;  4MW3 A;  3UGP A;  4DVZ A;  5JLI A;  3GEI A;  3H2U A;  4RBN A;  1FMW A;  3C63 A;  2HKV A;  1QVX A;  2YRF A;  1Q0F A;  3L8J A;  4KBL A;  4RD9 A;  1LIH A;  3ZTZ A;  1RCP A;  1M2O A;  1ST6 A;  3Q7L A;  3F46 A;  4K0D A;  4E7Z A;  4MW8 A;  4MND A;  1I4Z A;  2Q00 A;  4D4X A;  1OR2 A;  3FOO A;  4JCZ A;  1JMW A;  4DJ9 A;  1C03 A;  2G62 A;  3BEH A;  1GM5 A;  1R5I D;  1NSG B;  2WVN A;  3ECS A;  1YYJ A;  2EPN A;  3I5P A;  1MQV A;  3IHU A;  3UR3 C;  2R7R A;  1TWH A;  1SMY F;  4NTF A;  1TKN A;  1LI5 A;  4OIQ F;  1OW8 A;  4JTC B;  3M79 A;  4XLN F;  4CS8 C;  1Z63 A;  1N1C A;  3KKB A;  2Q7R A;  3L1M A;  5IY5 C;  2EIL C;  2W9Y A;  3ABM C;  1KU2 A;  1OR3 A;  2VB6 A;  2J46 A;  2H8A A;  2VCC A;  2WVQ A;  4YT8 A;  4U9D A;  4JEA A;  4E17 A;  4ZLC A;  2A6E F;  2D5R B;  1WAT A;  2LQG A;  4MTG A;  5L0H A;  2R03 A;  3RW0 A;  3H2V A;  2YLD A;  3JYY A;  3NKD A;  3RKO F;  3U3B A;  3TJ5 A;  4CJO A;  1L7C A;  5KYY B;  4C7O A;  5FZT A;  3DI5 A;  4IGG A;  2YWA A;  3K1I C;  2OG2 A;  4YL3 A;  4PR9 A;  3TJ6 A;  5L0J A;  2XL4 A;  2Q3T A;  3DZA A;  4XTK A;  3DD7 A;  1ORJ A;  5DS6 A;  5BQH A;  1MMG A;  5DS5 A;  2ZXP A;  1JPJ A;  1W2W A;  4O6M A;  5JS5 A;  4JRZ A;  5T3W A;  2LD6 A;  3E70 C;  1NU9 C;  3DXJ F;  1S7Z A;  3SZR A;  3C8G D;  3AGT A;  4C3B A;  1V4A A;  1VOM A;  1YLM A;  5B1A C;  2D4U A;  4NY3 A;  4C3D A;  2A69 F;  3FXH A;  1OCC C;  1M2V A;  3MYI A;  2OJQ A;  1NFO A;  4Z9J A;  3LS1 A;  3DWW A;  4OIR F;  2XL6 A;  1LI7 A;  2YLI A;  2P7V A;  1NFN A;  2PF4 E;  3DE9 A;  3M4C A;  4WGY A;  4CDA A;  4JC7 A;  4IAO A;  1RMV A;  1G4U S;  1WGW A;  1CPR A;  2R7U A;  4MVQ A;  4B6I A;  1LVK A;  5JUA A;  1Z23 A;  2EIK C;  2J9V A;  3DAF A;  4D4N A;  2L6F A;  4ULV A;  1M56 C;  4MTO A;  4JCH A;  3FDQ A;  2Y3B A;  1OKK D;  2LP4 A;  2R7Q A;  2HZ8 A;  2VCA A;  3DJN B;  3BRJ A;  2O9X A;  3JYH A;  2F22 A;  4IRU A;  1YAR O;  3E9V A;  3K1H A;  1ZVZ A;  1A0B A;  2GAQ A;  1SF8 A;  2PBE A;  2BE5 F;  2JPU A;  1E2X A;  3TOM A;  3L0I A;  3HTK C;  4JVS A;  4U5C E;  5AGF A;  1Y6D A;  2LCH A;  2XSE A;  1C17 M;  4G7Z F;  3W8I A;  1FTS A;  1QLE C;  1OXK A;  3EFO B;  5L3V A;  4FX5 A;  2YLG A;  3T9O A;  3ZVR A;  5F5F A;  4ZLD A;  1WTY A;  3B0U X;  3AG3 C;  3PCV A;  1J8Y F;  2J45 A;  2XS8 A;  3KMI A;  5F5H A;  2PNO A;  3W2W A;  3CZ6 A;  4U5F E;  2V3C C;  2R25 A;  1ZU4 A;  3FOP A;  1VB5 A;  2R7O A;  3QTH A;  2ICW G;  1UG7 A;  3OA1 A;  5KYW B;  1B68 A;  3PDM P;  4PJJ A;  3EGD B;  2MWQ A;  1YA9 A;  3EPV A;  3GOD A;  5L0D A;  3LES A;  2QLA A;  1O3U A;  5E2Q A;  3UMK A;  3M4B A;  4MS2 A;  1H7I A;  1XZP A;  2OEV A;  3SP1 A;  1H9G A;  2GWW A;  4MVS A;  5JRA A;  4Q5S F;  1E86 A;  1NBB A;  4KNV A;  2R05 A;  1T01 A;  2XRH A;  3DE8 A;  1OCZ C;  3EG9 A;  4EIY A;  4JZA A;  3JSZ A;  1KNY A;  4BEM J;  3M1C B;  1IZM A;  4JEB A;  3W4Y A;  1YZA A;  3OEO A;  2R9R B;  1XWJ A;  1F1M A;  2QUP A;  2Y69 C;  4CIP A;  5HV9 A;  3B0V C;  1WAS A;  3AQC A;  1LS1 A;  2X51 A;  3K33 A;  4O6N A;  4U5B E;  2FAP B;  1AEP A;  1ZZP A;  4CBE A;  1Z5Z A;  2HV7 A;  3SXZ A;  3ZDL A;  4E7S A;  2CCY A;  2J7P A;  3EH1 A;  4EBK A;  1Z6A A;  3S0X A;  4EBJ A;  4NCQ A;  3GWL A;  1NU7 D;  4DBQ A;  2KQ9 A;  2R7W A;  3U2M A;  3G50 A;  3GAN A;  4HFF B;  4L6R A;  3HNJ A;  4CX9 A;  3EH2 A;  4DXW A;  3FAJ A;  4JTD B;  5T1D B;  3RQG A;  4PJN A;  3SXY A;  3T6J A;  2IXP A;  1I5N A;  4Z9H A;  5B1B C;  4NTA A;  1OCO C;  4IWB A;  1ZHZ A;  3Q6M A;  3DAG A;  3JRM O;  4A4A A;  3POV A;  2ASR A;  3O6X A;  4U5G A;  3EHN A;  4J32 B;  2CGE A;  2DGJ A;  2CNW A;  3JZ0 A;  2Y3H A;  4E0I A;  3B0P A;  3CQZ A;  1QSP A;  2MHR A;  1NLX A;  1LE4 A;  1V54 C;  3NKE A;  4KNW A;  1WOL A;  1TWA A;  3SXM A;  1YAU O;  2J9B A;  1T6I A;  5BQG A;  1MND A;  1FFT C;  2ETS A;  4U5E E;  3EG9 B;  5JP7 A;  4XPX A;  3WOD F;  3GEE A;  2W4M A;  3GM1 A;  3TK0 A;  4JJG A;  5EGY A;  1HMD A;  3GM2 A;  1JAF A;  5JSL A;  2AP3 A;  3QVZ A;  5A69 A;  3X1O A;  2M64 A;  2L81 A;  2EPL X;  3AQB A;  1BZ4 A;  2W45 A;  1R4T A;  2J0W A;  2OKU A;  4AL0 A;  1L3P A;  3ASN C;  4U5H A;  1QPU A;  1O87 A;  3KH2 A;  4JIO A;  4Q7C A;  1FFH A;  2OJE D;  2R7T A;  4YL0 A;  5D91 A;  4CSA A;  3K7D A;  2KC3 A;  3DM5 A;  3S90 A;  2HUJ A;  3JCU Q;  4XPY A;  3EFO A;  5A6B A;  2ZD9 A;  5A6B D;  3EZI A;  3EJN A;  2XLM A;  2C03 A;  3S29 A;  4BJ5 A;  1ZW2 A;  2OQM A;  2P6V A;  2HMZ A;  3RQE A;  2VCB A;  1TFK B;  5FCL A;  1VLT A;  2YZS A;  2NUT B;  1O5H A;  1BR1 A;  3RH3 A;  1Q0G A;  3V5Z A;  4ANJ A;  2KJG A;  3G4X A;  1MMN A;  5A6J A;  2P0N A;  1T6U A;  3IEE A;  1EI7 A;  2I15 A;  3B71 A;  5KYW A;  2XLO A;  3ABK C;  3LLK A;  1YDI A;  4E0H A;  1D0X A;  1VMA A;  3EGD A;  3U2L A;  4A2N B;  5B3S C;  2B0J A;  1M6T A;  3JSE O;  2KNH A;  3UMI A;  4CS9 A;  1KTM A;  2VH3 A;  4EHP A;  3B9Q A;  1QKR A;  2XXA A;  2IM8 A;  3RIP A;  5B3I A;  1AVO B;  3TUL A;  2PX0 A;  3ATP A;  3WHN A;  4OD5 A;  1GQA A;  4CIH A;  2QY9 A;  4HFK B;  5DLJ A;  2RD9 A;  3ITF A;  1LPE A;  2I8B A;  2KYH A;  4NTB A;  3IQC A;  4P9F A;  2IXO A;  3ZSU A;  2YQY A;  1Q0M A;  3U3F A;  2PFD A;  3C7J A;  1VLS A;  2Q9B A;  3C8Z A;  2DYS C;  4BEJ A;  2KGO A;  3AG2 C;  4LDQ A;  3U5S A;  3FHD A;  2BC5 A;  2G3K A;  3C62 A;  1PD0 A;  3ZWI A;  3MBG A;  3Q6N A;  2HJ3 A;  4O6Y A;  2LFD A;  4LAC B;  2Q4F A;  3K6B A;  2A68 F;  4Z9I A;  1D0Y A;  1I4Y A;  2VAS A;  3S9O A;  1A41 A;  2FGY A;  5AC4 A;  5BQI A;  3NRH A;  4M63 A;  5DQT A;  5KYX B;  1FR0 A;  3IQ6 A;  2NUP B;  4RDA A;  3A9C A;  4U9E A;  3DKA A;  3RFY A;  4XEV A;  3NDB B;  5KYN A;  3SYN A;  4JTA B;  5L0I A;  2CYD A;  4P9T A;  4QI0 A;  3QVY A;  4HE8 D;  1U6H A;  2J8W A;  4JKV A;  3FMS A;  3JTL O;  1OXB A;  2HSB A;  3I5Q A;  4G78 A;  3U8P A;  2JD3 A;  4JW1 A;  2A0U A;  3ZG1 A;  4CS7 A;  1RKE A;  2HV6 A;  2XM0 A;  5EK0 A;  1ZHX A;  2LIG A;  3I4U A;  5COM A;  2XXA B;  2L6G A;  4YT5 A;  5DVW A;  1BBH A;  1A7E A;  2EIM C;  4E18 A;  4CSA C;  3NYL A;  3HLZ A;  4I1M A;  1YVI A;  2YL3 A;  3Q7G A;  4DBR A;  4G0H A;  2ZXR A;  5A6A A;  4LDK A;  2YL1 A;  1AUE A;  4IJJ A;  3N0T A;  2R02 A;  4PJL A;  4YL1 A;  4BJ5 C;  3H65 A;  3TD7 A;  2HS5 A;  2WZL A;  4NQF A;  3MYF A;  3RQF A;  1XZQ A;  4DVY P;  1OW7 A;  3NYJ A;  3T6B A;  2OCC C;  2WZF A;  4YT4 A;  3VYW A;  4YK5 A;  3EZH A;  2EPO A;  2C04 A;  1PV3 A;  3CSK A;  4LER A;  4BPM A;  4Q4Z F;  3JT1 A;  4MVO A;  2UUI A;  4IAQ A;  4XPW A;  4CDV A;  3NMJ A;  3B29 A;  1M57 C;  2YVK A;  3L34 A;  4PFP A;  2J7P D;  3OWT A;  2VC9 A;  3AGU A;  4CS9 C;  1V55 C;  2IXN A;  4PFO A;  3ABL C;  3HNL A;  3SEO A;  3FVY A;  2NUT A;  4IAR A;  2IOQ A;  1WN0 A;  4YN0 B;  5E3C A;  4JJF A;  2Y3D A;  3F47 A;  4MTF A;  1HW1 A;  5T3T A;  1T9K A;  3V5X A;  1HE9 A;  3LUT B;  5HSW A;  1D0Z A;  1MMA A;  4J7T A;  3ASO C;  4WJ0 A;  1LS4 A;  3S27 A;  2WB7 A;  2J0X A;  4DRH B;  1EA8 A;  3ZTM A;  1CGN A;  1VYI A;  3MLG A;  4N6C A;  4O7G A;  3UNG C;  3ZIB A;  3ZQY A;  5BUO A;  2KK1 A;  5K0I A;  2QTV A;  5GPG B;  5E3A A;  2YL0 A;  2JX0 A;  2M4E A;  3AOU A;  2CNW D;  1PCX A;  1RKE B;  2A1D D;  3AG1 C;  1EQ1 A;  3RVZ A;  1JR8 A;  3CEX A;  1Z3I X;  1G5Z A;  4EUK B;  3WAQ A;  1RJ9 A;  5L0C A;  1PD1 A;  2WZG A;  3QMK A;  4BJT A;  4EWC A;  2WVO A;  1C02 A;  3JRT A;  4WGZ A;  3VM6 A;  4CDY A;  1A7V A;  1V74 B;  4MVU A;  2J9W A;  4GQH A;  1RKC A;  2AU5 A;  2AWY A;  4WAB A;  1MMD A;  1HE1 A;  1OQC A;  3N2Z B;  4H54 A;  4N06 A;  2J9U A;  3PHF 2;  4P6I C;  4KC9 A;  3HKK A;  1CGO A;  2IBF A;  3IQT A;  5DS4 A;  1T6Q A;  4HEA J;  5AC5 A;  4PJM A;  2Y39 A;  3T6G B;  2OOC A;  3L8I A;  2NSF A;  2A6H F;  2ZXO A;  3EHM A;  4EKW A;  5COG A;  5L0F A;  4GEH A;  3RVY A;  5KYX A;  2NUP A;  1OW6 A;  2Q9A A;  3GOR A;  1TR2 A;  3G4Z A;  2AVK A;  2PP4 A;  4NC3 A;  3CAX A;  4QDL A;  2HMQ A;  4AE4 A;  2CDQ A;  2AWC A;  4OD4 A;  3QW1 A;  4JE9 A;  1ORS C;  2BL2 A;  2Z15 A;  3U9M A;  1TWG A;  1E83 A;  4IB4 A;  1D1C A;  4KI2 A;  2R7V A;  1DOW A;  2EPM X;  3HJC A;  1FAP B;  3DMD A;  3UMH A;  1G8X A;  2P1A A;  3DM9 B;  5F28 E;  3FAP B;  4LLE A;  3K66 A;  4UDV A;  3T4R A;  2R7S A;  2QNL A;  4FES A;  1VYK A;  3KYJ A;  4BJ1 A;  4EBB A;  5COF A;  3LAY A;  4BJ6 A;  1HMO A;  1K40 A;  1QZX A;  4XWJ A;  2OU6 A;  1WWP A;  1JOG A;  1RJ9 B;  4XLP F;  4W8P A;  5TJ5 E;  1J8M F;  1SR2 A;  1ZHY A;  2P61 A;  2CW0 F;  2YHS A;  5KYU A;  5E33 A;  5A6K A;  4XEK A;  2L9J A;  1ZU5 A;  2PX3 A;  4YT2 A;  1LKX A;  1CPQ A;  3IPM O;  5CIV A;  1Q0K A;  2FFH A;  3C8G A;  4PK4 A;  1APC A;  1Z7Q c;  2XM4 A;  3EGX A;  4YWQ A;  2ZPA A;  3LNM B;  2XL8 A;  1BR4 A;  3O39 A;  2X0C A;  4OIP F;  2YEV A;  3R2P A;  3VF0 A;  3UGO A;  1TQG A;  2V26 A;  2GA0 A;  4J7Y A;  1E84 A;  1GGQ A;  1NG1 A;  2DYR C;  4DRI B;  2LFF A;  3U9J A;  4ER9 A;  1ZHW A;  4GYT A;  4W8K A;  1LE2 A;  2HSQ A;  3GWN A;  2QE9 A;  2XLH A;  2YKZ A;  2XLV A;  3LEO A;  1MNE A;  1OKK A;  1Q0D A;  4ONS A;  3TQO A;  4AE4 B;  3VAY A;  4K7B A;  1ZW3 A;  3LEV A;  2IYL D;  1QQ3 A;  4MVZ A;  3RYL A;  3X2Q C;  2XS1 A;  3LLI A;  2L7A A;  3N24 A;  4H4K C;  1T5O A;  2G3V A;  4I1O B;  3RF3 A;  3ZC4 A;  5KYY A;  2RSE B;  1BR2 A;  1DOV A;  1ZHT A;  2H7O A;  3MX3 A;  4K1O A;  4DRJ B;  5EHH A;  5L3Q A;  2R7X A;  3GM3 A;  2EIN C;  2ZXW C;  2XLE A;  2HJM A;  4O79 A;  5CI9 A;  4OIO F;  1NZE A;  1YZC A;  3LJB A;  1YJG A;  1H6G A;  2GFH A;  4XQ1 A;  4MVM A;  4BG0 A;  1RXQ A;  2E87 A;  3J06 A;  3AJM A;  2B0H A;  3DJU B;  3KPH A;  3NMI A;  4C7O B;  4CS8 A;  3S84 A;  3ZQV A;  5JT4 A;  4MVR A;  1K04 A;  2DB4 A;  1BDJ B;  4DOZ A;  3PMR A;  1YA7 O;  2TMV P;  1S05 A;  5KYU B;  5JVE A;  2LK4 A;  3NYM A;  4AX2 A;  2KSF A;  2L6H A;  4JUR I;  1ORY A;  3C18 A;  1JRA A;  3VRC A;  1HY5 A;  256B A;  2GDC A;  4I3M A;  1ZYR F;  2UUH A;  2LSE A;  3HNK A;  3C8G B;  2IXM A;  1K05 A;  3KL4 A;  4OIN F;  4LLC A;  2H7V C;  3EGX B;  2MYS A;  5L0G A;  5DQZ A;  4J30 B;  3K1I A;  3NG1 A;  4ULW A;  3TOL A;  4C3E A;  1M2V B;  4N4W A;  2EIJ C;  4CJG A;  4QI2 A;  3EQL F;  1IW7 F;  2Q9C A;  3IQ5 A;  3S28 A;  3HNI A;  3V7O A;  1CGM E;  3U0C A;  1GS9 A;  1SYQ A;  4AL1 A;  1FNT c;  4R32 A;  3LNR A;  1H9T A;  1HW2 A;  4LDR A;  1D1A A;  1SZI A;  4BJ6 C;  2WL8 A;  2NSG A;  1G4W R;  3WG7 C;  1JPN A;  3NMK A;  3SXK A;  4XEF A;  4G7H F;  3O55 A;  2DI3 A;  1U0B B;  3LS0 A;  3O10 A;  4MQ9 F;  3A11 A;  4YJW A;  3GEH A;  3U8V A;  4G7O F;  1Y4C A;  2XLD A;  4I44 A;  2EPK X;  5CI8 A;  1VK5 A;  5D92 A;  3R7C A;  1E85 A;  3QW0 A;  1U89 A;  4X0R A;  3KYI A;  3W8H A;  1YYX A;  4PAC A;  4U5D E;  4FWV A;  1A7D A;  3M15 A; 
#chains in the Genus database with same CATH homology
 2AVK A;  4XPW A;  3WAQ A;  2HMQ A;  4XPX A;  2AWC A;  1HMD A;  3AGU A;  3AGT A;  4XQ1 A;  1A7E A;  2AWY A;  1I4Y A;  3WHN A;  1HMO A;  4XPY A;  2MHR A;  2HMZ A;  1I4Z A;  1A7D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...