2AW5A

Crystal structure of a human malic enzyme
Total Genus 191
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
191
sequence length
537
structure length
531
Chain Sequence
GYLLTRNPHLNKDLAFTLEERQQLNIHGLLPPSFNSQEIQVLRVVKNFEHLNSDFDRYLLLMDLQDRNEKLFYRVLTSIEKFMPIVYTPTVGLACQQYSLVFRKPRGLFITIHDRGHIASVLNAWPEDVIKAIVVTDGERILGLGDLGCNGMGIPVGKLALYTACGGMNPQECLPVILDVGTENEELLKDPLYIGLRQRRVRGSEYDDFLDEFMEAVSSKYGMNCLIQFEDFANVNAFRLLNKYRNQYCTFNDDIQGTASVAVAGLLAALRITKNKLSDQTILFQGAGEAALGIAHLIVMALEKEGLPKEKAIKKIWLVDSKGLIVKGQEKEKFAHEHEEMKNLEAIVQEIKPTALIGVAAIGGAFSEQILKDMAAFNERPIIFALSNPTSKAECSAEQCYKITKGRAIFASGSPFDPVTLPNGQTLYPGQGNNSYVFPGVALGVVACGLRQITDNIFLTTAEVIAQQVSDKHLEEGRLYPPLNTIRDVSLKIAEKIVKDAYQEKTATVYPEPQNKEAFVRSQMYSTDYDQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of a human malic enzyme
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords NADP-dependent malic enzyme
total genus 191
structure length 531
sequence length 537
chains with identical sequence B, C
ec nomenclature ec 1.1.1.40: Malate dehydrogenase (oxaloacetate-decarboxylating) (NADP(+)).
pdb deposition date 2005-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00390 malic Malic enzyme, N-terminal domain
A PF03949 Malic_M Malic enzyme, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2aw5A02
3.40.50.10380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Malic enzyme, N-terminal domain 2aw5A01
3RBXA 5AXDA 4BO6A 4E4YA 1Y81A 3D5QA 3V2HA 3ZWMA 3AJRA 2C2YA 2D0IA 4ZQBA 3GEDA 3B1JA 2FSVA 1N5DA 4E32A 2PV7A 1LSOA 2WMDA 2ZCVA 3D4OA 1JQBA 3PK0A 3EK2A 4MVJD 3VVCA 4BNZA 3VPXA 1PZGA 2Y93A 3UCEA 3WNQA 2V7PA 5DP2A 5F5LA 3E9MA 5J23A 4CMGA 4DA9A 4IQGA 4YTEA 4FGWA 1ENYA 4NFSA 5JBIA 2NVUB 4UUMA 5IF3A 3ZI0A 2JFHA 2WEKA 5GY7A 4E5NA 4ZICA 4QSMA 2BELA 1WAMA 2VT2A 3WGHA 1JKFA 3WYBA 1E1MA 4NJOA 4DRYA 4ND4A 4J9VA 2CSUA 3L77A 5KWEA 1LUAA 4QO7A 3OHSX 1N7HA 2NV6A 3KV3O 3WQRA 4UREA 3U5TA 4E21A 1RM0A 1B7GO 3GG2A 3HDQA 2YV3A 1I3MA 2LDBA 4OOEA 3VAZA 4CM9D 4RJTA 2ZTVA 4XIJA 4CMBA 1DIRA 2VNSA 4AJLA 5KKCA 2AQHA 4R16A 1M67A 1P45A 3ONFA 4JGBA 5DBIA 5IZ4A 3FPLA 2IRWA 4OHUA 5C5IA 1KVRA 4FDAA 4IJKA 4RL6A 2E4AA 3VKVA 3QLJA 1LDMA 3ANLA 5HWSA 3S2FA 2I99A 2CNBA 3ZHYA 4FFLA 4KDEA 4L9RA 3NTRA 4MVJM 1BVUA 1O5IA 1F14A 2CDBA 1FJHA 4MIEA 1SAYA 2QZ9A 3Q2KA 3TZKA 4BV8A 2O7SA 1XSEA 2DTXA 3LC7O 5B37A 2DQ4A 1NAIA 3DOOA 1QP8A 3ZW9A 2H63A 1ZJZA 3U4DA 1O9BA 3NRCA 5I7FA 1DRVA 1PZHA 2UUOA 3RQSA 3F3SA 1CERA 3WMWA 5L7TA 5JS6A 4HNHA 4B3HA 4WKGA 4K9DA 8ADHA 2C29D 1YDWA 4JBGA 2C82A 3JD4A 5EQDA 3ZWXA 4II3A 3HN7A 4D41A 3JQ8A 3PHIA 3WQQA 3PZBA 4TZKA 1MXFA 1T26A 2WYUA 3PYXA 4QUKA 2P4QA 2Y99A 2HK8A 2IE0A 4FOSA 2EKQA 3UN1A 3E9QA 3M2TA 1I2ZA 3QWBA 4K28A 3ZWNA 3OA0A 4WOKA 1VRWA 3PWZA 1DC3A 4NFYA 1FF9A 2QRKA 4FJ2A 4Z9FA 3E6AA 3GVHA 1E92A 3P2YA 4ZRNA 3U0BA 2D2IA 4IS3A 3JQ7B 4CQMB 5JC8A 1KETA 2JD0A 3ADPA 2V6GA 1ADGA 1DB3A 3DR3A 3G3EA 2OMEA 1PEDA 5K0ZA 3D5TA 4F6CA 1GYQA 4KTVE 3I6IA 5HBRA 4IMPA 1ZKMA 4BKUA 1BW9A 4M86A 4JJGA 4NJMA 1E5QA 1T25A 3JQGA 4LK3A 3FNHA 3DEYX 2X6TA 1ZXBA 2DFDA 3AUSA 5EIOA 4BGUA 3DO5A 4YJHA 1R6DA 4QXMA 1B3BA 5FWNA 3GN2A 3RIHA 4TQGA 1TVEA 4DMLA 5KCZA 4Z9XA 4RPGA 2X5JO 5ILGA 2DTDA 2NUAA 4CR7A 2PZLA 1O8CA 4R51A 3HDYA 3D64A 3F1KA 4LMPA 4UULA 3QVTA 1UXGA 3GRKA 4UEKA 1QV7A 4RF4A 4YRBA 3I9JA 3C7DB 4FN4A 4YQYA 3VZPA 3RU7A 1SCUA 3LT4A 2OUIA 1YWGO 2FOIA 1GQYA 3PI7A 1TI7A 2QRJA 4MVJE 2JD2A 3JD1A 5F1KA 3ANNA 3OECA 3H9QA 4TROA 3JQAA 4GMFA 1H0KA 2HMUA 3DONA 4OQZA 4GX2A 3SJ7A 4OAQA 2J5KA 1WMBA 4TRMA 1E3WB 3B1FA 2X9VA 1KOLA 1W6UA 2HSDA 1NP3A 1E6WA 2C2XA 1LLDA 1Q0HA 4CLRA 3O03A 4ITUA 4NU6A 3DBVO 4IIVA 4J16A 2PTGA 1ADBA 3P19A 1V35A 5IDXA 2P9EA 3EW7A 4XYLA 4PLGA 1JN0A 4EEXA 4I1IA 4ND3A 4XQCA 4OIMA 2CF5A 3EVTA 6ADHA 5T8KA 3ZWWA 3JQ9A 3KYCA 3GR6A 1YRLA 3GVCA 4TZTA 2E82A 3FNGA 1DJNA 4XDZA 2CDCA 1KY4A 4TVBA 9LDBA 2O3RA 2VOJA 4R54A 3C24A 4YT8A 4U8GA 3K30A 5H81A 3C1TA 3IQDB 4GX0A 4CMIA 3VH1A 4F3YA 4IJWA 3GGPA 4J4BA 4JBIA 4D42A 3EYWA 5A06A 2G76A 4BNMA 1LC0A 4XA8A 3ITDA 3ZV6A 3L4BA 4HKTA 2YZ7A 3RBZA 3FR8A 2O2YA 1P1FA 1TLTA 4JX8A 5BNTA 4CUKA 2I76A 1PJQA 5EJ2A 2O3SA 1HE3A 1YBVA 4I08A 4PG6A 5BT9A 4C4OA 2IEBA 1VJTA 5JCXA 1C1DB 4HADA 1OOEA 1ONOA 2PZJA 1PJ2A 2FP4A 4NQZA 1YJQA 3EHEA 1B2LA 5DOVA 1G0NA 2PKQP 1R4NA 1UP7A 1P33A 1LC3A 2GRAA 4QFDA 3M6IA 3GZNA 1GU7A 1XEAA 2TMGA 2Q1TA 4IJUA 1X1TA 3INTA 4JP3A 4F6LA 4YB8A 2RCYA 4XYEA 3ZNOA 1LLUA 4J7XA 4YDRA 1YBAA 4XYBA 1UDBA 4CQLB 4D3DA 2IDZA 3MCVA 1NPDA 4RQUA 3NGLA 2EF1A 3FRJA 3C7CB 4DLAA 1SC6A 1W0CA 3INGA 3U09A 4L4XA 4RF3A 3TWOA 1C0PA 2WYWA 4FCCA 1RYDA 4BO4A 4P38A 5T67A 1E3JA 1RKXA 4L4RA 4ZRMA 5T5QA 4ROSA 1UZNA 3I9KA 2FPPA 4D0RA 1HL3A 4KUGA 1U8XX 4FIZA 5T6BA 4H7PA 4WLNA 1B0AA 3ZH2A 3I3OA 2VWHA 2WM3A 3PHLA 2DTEA 2SCUA 4GKBA 2D5CA 4NHEA 4HP8A 3S2EA 1FK8A 5T64A 4CM4B 4EW6A 1MV8A 1CQIA 4LCJA 1Z45A 5EL0A 3L6OO 1E0DA 3VZSA 5KNLA 4L4SA 2NU7A 1SZJG 3VKUA 1ZVMA 4IXTA 5FI3A 5TGDA 4CMKA 1LXCA 2P5UA 1E5LA 5TNXA 1CRWG 4RPHA 4XEHA 4LISA 4AL4A 4OMUA 5I8WA 4GAEA 3OBBA 3EZYA 2GERA 4KUEA 5AXBA 1H5QA 3OJ0A 4PIVA 1HLDA 5KVCA 3ZWPA 4PLVA 4FC6A 3C85A 2Q46A 2HO5A 5JCJA 2Y0EA 3A14A 4YRDA 4QTZA 2RHCA 4PLHA 3WJ7A 1HEUA 3HFGA 4CMEA 1HDGO 3L0DA 2AMFA 1UAYA 3PPIA 2O4CA 3WTBA 3LYLA 3W1VA 1HWYA 3TZQA 5CEEA 1ISMA 3RUIA 2C0CA 1PWZA 3K6JA 4Q3NA 1KS9A 5JAIA 1GV0A 2YDXA 1RYEA 3P2OA 1ISIA 1Y5MA 4BKRA 2VHVA 1GZ4A 4K1LA 4R1TA 1PGNA 1HZZA 1Y8QB 4LW8A 1Q0QA 1V8BA 4PLWA 3TFQA 3WOHA 3GNQA 1QRRA 5BSEA 2W2LD 1AHIA 1DC6A 2VRCA 2DT5A 3Q3CA 3F46A 5DT9A 1LDEA 4CM3A 2VWQA 4B4OA 2BI7A 1HZJA 2BGMA 3WICA 3DBLB 2IYOA 4DTIA 4UAGA 5THKA 1QYVA 3WLEA 4D43A 1NFQA 1PX0A 3PDJA 3IMFA 4KMSA 4TSKA 2GF2A 4HFJA 4R68A 4DC1A 4EI2A 4R69A 3OJEA 4DWVA 2WWRA 3CUKA 1XIVA 3BMOA 1NFFA 2CDAA 4XYGA 1NX6A 2NU9A 3L6EA 1GQQA 3AOEC 4IDAA 1IZ0A 1GUZA 5G4LA 2CZCA 5JW6A 1U8FO 4DBZA 2O4UX 3FPCA 2RBEA 4INAA 5IFLA 3KSDO 3EVNA 3CKYA 4JBHA 1TEHA 4KOAA 3V2GA 3DAGA 1LQUA 2X5KO 1BSVA 4OXKA 3JYOA 4OGWA 1LSSA 3BTVA 4R01A 3I9LA 1MC4A 4XGIA 5C7OO 2EIHA 3DC2A 2HU2A 4J1NA 4O0LA 5JY1A 5A02A 3L4BC 2I9PA 3LVFO 2A92A 3PQEA 1X0XA 2EERA 1QSGA 3K31A 3H9GA 4WCFA 5TIIA 3UHAA 3Q11A 2BRUA 5ER6A 3FNEA 4EITA 1PZFA 1ZH8A 2I3GA 1XLTA 3OH8A 3AU8A 3AY3A 2PD6A 3FWZA 4ZQEA 4DPMA 7ADHA 3PP8A 3HN2A 2QYSA 3ZU2A 1YS4A 4R9SA 3E5MA 1DIAA 3HWRA 4CLDA 3ETEA 4AJ4A 1P1IA 1J4AA 5TT1A 3DZBA 4YJFA 4WEOA 3JD3A 3OETA 3LZ6A 3GAFA 4PFJA 3QV1A 2G1UA 3NTOA 1EUCA 1YOVA 2ZB4A 1NQTA 4IUYA 3K5PA 3BA1A 3RC1A 5GZ1A 2YYYA 3DHNA 4UVEA 3GF4A 4WEQA 1DIHA 3KM0A 3LSYA 1NYTA 3NJ8A 4ESOA 2Y68A 3RKRA 3H9JA 4XCVA 5IG2A 3IKTA 4TVOA 5A1TA 1H94A 1Y7TA 1T2EA 4XB1A 3AY6A 4CLEA 1G0OA 3MJCA 3ZCXA 1C1XB 1X7HA 3NT5A 4AICA 4EEZA 1OAAA 3Q9NA 2GLXA 5KTKA 3ZWCA 2P9CA 3GH3A 1LBEA 4BNWA 4FS3A 3NT4A 1XR3A 2NNLD 3BHIA 5G0VA 3OJOA 5BSFA 2JFFA 3SBOA 1ZCJA 2NWQA 1VPDA 1JWBB 3OSUA 5BQFA 1H6DA 3P7MA 3ZZNA 1KVQA 1Z74A 1Q7CA 4YVFA 1MA0A 1ARZA 1LDGA 2YFHA 2P2SA 3WYCA 1I01A 3NUGA 2YUTA 1HDZA 3FBGA 2B37A 4YT5A 3GGGA 3WBBA 1E7SA 1N9GA 3JQCA 3ZWOA 4B8ZA 1AN9A 1GCOA 3C3XA 4Y6SA 4JJIA 3PFFA 3WR5A 4ALMA 1IZ9A 3LT2A 1F8GA 3WBFA 2DBVO 2W2KB 2FR8A 4R4JA 4RORA 3GVPA 3ICCA 2IEDA 3RJ5A 5DP1A 2VHXA 4AJ2A 2OGUA 3HG7A 4CMHA 3PJGA 3PGXA 3DHYA 1TT5B 4N5MA 1I33A 5KJEA 1E3SA 1HDOA 3UFXA 2VRCD 5THQA 4GWKA 2Q1SA 3MJSA 4YEDA 3BMCB 2D1YA 1VE9A 4Y67A 1UXJA 4E33A 2PWZA 3JSAA 1QG6A 4HBGA 4DQUA 4I9HA 5JNLA 1SEPA 1R0LA 3LDHA 4CV2A 2GGSA 2B4RO 1SBYA 2XXJA 4Y9DA 4M8SA 4H3VA 4OSOA 4TRRA 2DAPA 5KJ1A 1ZK0A 2RIRA 3ETDA 3QA9A 2UAGA 2C59A 4J3FA 4RVDA 1K2WA 2BFOA 1J5PA 4G2NA 3H5NA 4BL5A 2C5EA 1B3RA 2XF8A 1DIGA 3GMDA 1LRJA 1XGKA 3I5MA 4GKVA 1YGYA 1UAGA 1SOVA 3DMTA 3NDRA 4FFPA 1PJCA 4N7RA 1JAYA 1GYPA 5GMOA 4EJMA 3U62A 4NBUA 1WWKA 4I5FA 1P1JA 1F17A 4P4NA 3F5QA 1BRMA 3DMYA 1ULUA 3P5SA 3LK7A 4NBVA 4BKQA 5L40A 4PLPA 5K6AA 1GEGA 2R2GA 5DCYA 3GUYA 3DFUA 3I9OA 3QQPA 3UAGA 1U2GA 4GMGA 3JQ9C 5ILOA 3F47A 2A4KA 4LRTB 4YBZA 2NQ8A 1PGOA 4DBVO 3JQDA 4FFRA 4DLBA 4IQ8A 1ZUD1 2WSBA 2DBRA 4IJVA 4Z0PA 1YDEA 1J49A 1PWXA 2IODA 2ZB8A 4ALJA 4Q39A 1E3LA 2BMAA 2Q49A 1BTOA 3GEGA 4L0QA 4YYZA 5EERA 3WG9A 3ZU4A 1T2FA 2TMDA 2UV8A 4E5KA 4EJ6A 3GZ4A 1ZZEA 4FR5A 3GEMA 1VLLA 1AUPA 3GAZA 4GLOA 3JQFA 4KQWA 1UDCA 3RUFA 5F1OA 3OIGA 3PQDA 4A0SA 1NWCA 1ENZA 2EKLA 3WGZA 4J90A 2O48X 1K6JA 3IP3A 1HLPA 1AHHA 2Q2WA 3D3EA 3KYDA 5ES3A 3X2FA 2AQKA 4ZQGA 4M89A 3U4HA 2Y1GA 3PHHA 2DPGA 3DBHA 1AGNA 1PR3A 3UUWA 2P5YA 3F4LA 2VNAA 4RVFA 4I5DA 3IJRA 3DTTA 1U3VA 2PZMA 3ITKA 2WD7A 3FBTA 4J4TA 2AEJA 4M49A 1A9ZA 1RM3A 2HUNA 1MP0A 4DQVA 2EV9A 3JD2A 1C0LA 3KXDA 4PGFA 5JDCC 3WSWA 4AJIA 4XQGA 5HRUA 3ONEA 1E7MA 1VL8A 1A71A 4FFMA 4EUEA 4ZGWA 3GA0A 4RVGA 1IHYA 1MC5A 3JYQA 3NKLA 4YJDA 5IZCC 2X23A 3CH6A 3DFZA 2XXBA 1BVRA 3U4IA 4HXYA 2G17A 4HUJA 4IY1A 3L6DA 5CAEA 4MIOA 2OHXA 2NADA 3ETGA 1EK5A 2Q2QA 3DTYA 4U7WA 1HSZA 1E3IA 5JAQA 3C7AA 5TQVA 3IC5A 3K8ZA 4IINA 1K5HA 1QR6A 1JAXA 3E5RA 3BTOA 3I4CA 3SLKA 1Z75A 2ZQYA 2AEMA 1YXMA 2ZYAA 4A73A 2VHWA 4IZHA 1QYXA 2OOSA 1ML3A 4R1SA 3NYWA 4RQTA 4B3IA 1A72A 2O50A 1IOLA 2Q4BA 5EINA 2GZ3A 2UDPA 2BHLA 3GDFA 2HLPA 2JL1A 2BI8A 1MG5A 2C7VA 2XPCA 3LC2O 3SJUA 1MUUA 5L9AA 3I52A 1U4SA 3ASVA 3K9QO 3BZUA 5IXYA 1EVZA 1KC3A 2H9IA 2LDXA 2VRBA 3JD0A 3H5RA 1R66A 1JTVA 2Y1OA 2JAHA 3DBRA 2CY0A 4D44A 1WP4A 5TSDA 3CINA 1YL6A 1YQXA 1PS0A 2CUKA 2ZJ0A 3OMLA 2D3TA 3KYCB 4J43A 4FOOA 4NBRA 1H6BA 1ZK4A 2VZ9A 3H9EO 1I0ZA 2YY7A 3WGIA 4MVJF 3TJRA 2PLAA 4W82A 3HB4X 2DFVA 5EESA 4W7IA 1LSUA 3TOXA 1SO8A 1YL5A 3H8VA 4G81A 2EP5A 3H3JA 4F45A 2J5RA 2D5AA 4IDDA 3ZN2A 2B4TO 5L4NA 4RVUA 1Q2XA 4D45A 2QIOA 1RJWA 5FYDA 3KRTA 1GDHA 2FR0A 4NK5A 3L07A 4RLHA 1SPXA 4LVUA 4ALLA 4BMSA 4CM6A 1U9JA 3O8QA 3U4CA 4DXHA 1E7QA 1FMCA 1T2CA 3GC6A 1EBUA 4ZA2A 2HCTA 4RGBA 1R4NB 3WX0A 3LC1O 2F00A 3F5SA 1ZMOA 3BMNB 2BFPA 5G0WA 3U49A 4DYVA 3S1LA 2VTEA 4UUOA 4GSKA 4W6ZA 1B14A 4L76A 1I5RA 1ONNA 2G0TA 3HHPA 4BNNA 3S55A 3RAJA 4XZ3A 4CQLA 5KOIA 3IKVA 3GMSA 1HKUA 2B4QA 3QWIA 4DMMA 3HQ4O 2IYPA 4E30A 4CR6A 2Q4EA 1YJ8A 3FNFA 3NJ4A 5JYEA 1WXDA 3RFVA 1M76A 3BMQA 1SNYA 4H16A 4IS2A 1PS8A 4RDHA 1HDYA 1TA4A 2OZPA 3R3SA 4CL8A 2PFGA 2YJZA 2OXIA 3AI3A 4P4LA 3W6ZA 1D8AA 2O23A 1D4FA 3R6DA 5T57A 5ADHA 4IDCA 1H93A 2PH5A 3M1AA 4K6CA 5DNAA 1RWBA 3WNVA 4A03A 5TC4A 3LLSA 3GDOA 1T1RA 4D46A 5TLSA 3ADOA 2ET6A 3PRJA 2R00A 2YHIB 4S1VA 4B8WA 2JCYA 1Z82A 1GZ6A 2P9GA 2H1SA 3JV7A 1H6AA 1T1SA 2AA3A 4GX1A 3MWDB 3GLQA 4ALIA 2WYVA 3H6KA 3ZNPA 1ONPA 1P1KA 1VL6A 4BNIA 3WGTA 2B69A 4BO2A 3SX2A 1Q7BA 3BTSA 4EJ0A 1D7OA 1NPTO 2HKIA 4BNTA 4JXKA 3AW9A 3GQVA 3I83A 4WNIA 3FN4A 4R1NA 5FEUA 3RFTA 2X0JA 4Z9YA 5A9RA 2AE1A 4MPDA 1XCBA 4TKMA 1NHWA 1P1HA 5G0TA 2YHUA 4MP6A 1PQUA 4BO8A 3ZWVA 3M1LA 4ND2A 2Y0DA 1Z6ZA 4TWRA 1Y5RA 2Z1NA 5IDWA 1DC5A 5JDIC 3GY0A 5JCJD 5EPOA 5H82A 4FW8A 1VSUA 1IUKA 2RHRA 1R37A 5GZ6A 1L1FA 5A9SB 5C7IO 3R3JA 3V5NA 3RWBA 2HMTA 3HADA 3UGKA 3KBOA 5DBGA 3ROQA 3RC2A 3CIFA 4D0SA 1I3KA 1QORA 1BDMA 2FMUA 4TKLA 1JVSA 3IUPA 4E5MA 5KVVA 3PTZA 4J2OA 3DZHA 4A2CA 1HXHA 2GPTA 1UP6A 1MGOA 2QZZA 3OQ6A 1Y8QA 3PLRA 1DAPA 4E2WA 1Y9EA 4FBGA 3HJAA 1DEHA 1D1TA 1NR7A 1NM5A 3DL2A 3KTDA 4UVIA 1ID1A 1GCUA 4OJNA 1NFRA 3MEQA 1LRLA 1Q7GA 5CDSA 5G0SA 3BHMA 3H4VA 3UH1A 2GNAA 4GWGA 1NNUA 2EWMA 1HT0A 3INRA 4FB5A 1ADCA 5L3ZA 1DRUA 3KSUA 1KEPA 2VYNA 4ZQHA 5TJ9A 4YR9A 2NU8A 1DIBA 3GT0A 4PVDA 3FWNA 3UW3A 1DFIA 4Z6KA 1Q0LA 1T4DA 4AJJA 2EP7A 4HNGA 2CFCA 2NU6A 2J3KA 4CM7A 1KVSA 4LN1A 2Y66A 1D3AA 3WB9A 1ZNQO 5CG1A 1GY8A 1ZK2A 1GPDG 3I9MA 1DDOA 3ZW8A 5U1PA 4U5QA 3E1KA 4R5MA 3KYBA 2I5PO 3ZV3A 1NQ5A 5DCWA 4KQXA 4C7JA 2DKNA 4I9NA 3FI9A 3CZRA 1EE2A 1U2DA 1L7DA 2JCXA 3WWZA 3ZHZA 1QYDA 4RV9A 2CD9A 4BS9A 1Y6JA 1UZMA 1N7GA 1VSVA 2GUGA 1UH5A 4Z3DA 3DZKA 4GPD1 3GG9A 3RD5A 2PKRA 4WCFB 3FTPA 3G1TA 3DWFA 3C8MA 1HYGA 3F9IA 2GDZA 3O38A 4GGOA 1XDWA 1U3UA 1GQ2A 1CWUA 3ON5A 4TRJA 3RUDA 4W9NC 9LDTA 3TDKA 3O9ZA 5JFOA 2FRDA 2ZTMA 4EUFA 1WMAA 1IPEA 5A4DA 4JLWA 4W9NA 4BO7A 2EW8A 4J7UA 4R3WA 4IDGA 2PD4A 3MTJA 1DFGA 3DZIA 4YWJA 4DC0A 2W98A 1UXIA 5LDHA 4HWKA 3ZNQA 2ZCUA 3D3WB 1HYEA 3PIIA 4IZIA 1O0SA 3ASUA 2ZK7A 5AQ1A 1P77A 1HYHA 4MO2A 4OSPA 1WVGA 1CJCA 3WGOA 5TS3A 1Y8RA 4B4WA 4C7KA 3WS7A 3JQ8B 4RVHA 1P1RA 4AFNA 4CMAA 4R9RA 5C37A 3TL2A 2PGDA 3ZDFA 1YQDA 1U3WA 2C54A 5COBA 1U1IA 1LX6A 1B8VA 4H15A 4AG3A 1N92A 4BMVA 1PGJA 4Y98A 3GUCA 3EMKA 1EQ2A 2EEZA 3K2BA 1RPNA 2GN8A 3C1AA 3PXXA 4XIYA 1KVUA 3ST7A 1JU9A 1W4ZA 3PJDA 2WDZA 3DXFA 3PYMA 4N54A 4X54A 2UYYA 2IZ1A 5L95A 1WZIA 3UVEA 3GN1A 3JQ7A 5G2OA 5KVQA 4Q3EA 5TX7A 1YQGA 5CP8A 5JY6A 3CMMA 3CE6A 4XDYA 4BNGA 3DDNA 1BW9B 4UUPA 1X1EA 5L7YA 2NM0A 1QLHA 5ER9A 5ITVA 3ZV5A 1A4UA 1MFPA 2ZKLA 3LT0A 4MP8A 4RLSA 1SEVA 2B36A 3AOGA 2WD8A 2HK7A 3JCZA 4AVYA 4UEJA 4W99A 2W2KA 1JDJA 4G65A 2I65A 3VC7A 5I7SA 5JE8A 4FQ8A 2VT3A 4OO3A 4WLOA 3UCFA 1GAEO 1TT5A 1HE4A 3RSHA 4PVCA 2B35A 3WMXA 3V1YA 4RPLA 1I3NA 3HDJA 1GR0A 2QW8A 5JLAA 1O6ZA 3RU9A 1I24A 3RUHA 4BNHA 5LCXA 5I7EA 4YJGB 4Y8VA 4BNLA 1DBVO 5U9CA 4WJZA 1OMOA 3JQAB 4E2XA 4XJSA 3KETA 2BFAA 1T24A 3B6ZA 3S8MA 5K6AC 3AFNA 1LLQA 5TJHA 1OFGA 4E2YA 1E3WA 2DLDA 2V6BA 4CUZA 5F3RA 3PGJA 5EN4A 2AG5A 2W90A 3UOGA 1ISHA 2EHDA 3PDUA 4NFHA 4R5HA 5B4UA 4BNYA 1XU9A 3DAFA 5U4QA 3PQFA 4E31A 5HS4A 1V3TA 1EEHA 4FC7A 1FDSA 1Y1PA 1BMDA 1HDCA 4BO9A 4UVHA 3G79A 4K6FA 4RDIA 3WFIA 2DVMA 1KVTA 2X4GA 3IJPA 4B7CA 4D3FA 4DUPA 3IL2A 1JWAB 4MVJI 5HS6A 2HMSA 2AW5A 2NLOA 2C07A 5BSHA 4DIFA 4P4GA 5B4VA 3FHLA 3GDGA 4BOYA 3NX4A 4CMIB 5GZ3A 2ZTUA 1PGPA 5DBFA 1NAHA 1I2BA 1PZEA 1GUFA 3E8XA 4U0JA 3VZRA 1X0VA 1IB6A 1NQAO 4HFRA 5C3MA 1V9LA 4P8RA 1YVEI 3O26A 1YB1A 2Y1FA 3PFWO 3MJEA 3FSRA 3DQPA 4Z0HO 1ZSYA 1C14A 5TF4A 3S2IA 4LGVA 5I7VA 3GPDG 3ZV4A 2YFQA 1C0KA 2A35A 3CMCO 1DFHA 2GASA 4Q3AA 4P22A 3NTQA 3TN7A 1QMGA 3KHUA 2FY8A 2AXQA 5MDHA 3EC7A 1KYQA 3WJAA 1RM5A 2H6EA 2J3IA 4KZPA 2Q99A 4QX6A 4JN6B 1XU7A 3PYLA 2AQ8A 4PLTA 3DZJA 2EKPA 3TPCA 1UP4A 5B4TA 4YT2A 3WFJA 3HE3A 4TMFA 4UVDA 4BKPA 2X0NA 4AJOA 1P9LA 2JD1A 3UCXA 3IP1A 1PJTA 3BHJA 4J1TA 1NVGA 3L9XA 4ZN6A 2X9NA 2WTBA 2PNFA 4I5GA 4Z0TA 1NWHA 3N7UA 2WD7B 4ZHSA 4CV0A 1B8UA 3X2EA 2D8AA 2VWPA 4CM5A 2PY6A 5DF1A 2VZ0A 2PGJA 4Q3CA 2Y1CA 2PK3A 5HA5A 4O63O 2VUTA 4GI2A 3D4PA 3QVOA 1A4IA 5CDGA 1LTHR 3U9LA 2OP0A 2AQIA 2P68A 2FWMX 4PLFA 3VH3A 4IDFA 1K6IA 4DIBA 4RZIA 4XJTA 3NAQA 5ENDA 3RVDA 3ZWAA 2JAPA 1ISGA 2RAFA 5CG2A 2BGLA 2DC1A 1M6WA 1V0JA 5A3VA 1BXGB 2B5WA 4PCVA 4TRNA 4CODB 3NT2A 4CUJA 3GK3A 3KEOA 2POQX 2OFPA 3QIVA 4PN3A 5BNIA 3R1IA 3BTUA 4XGKA 3WIEA 3MJVA 5KKAA 3DZGA 5COQA 2X86A 3AUAA 1VJ1A 5G4KA 1ZSNA 3COSA 3QWHA 1BDBA 1N2SA 3EAGA 1JLLA 4AJHA 4NJMB 4CJXA 2X58A 3JQGB 4QECA 5DCUA 4XRGA 4IPTA 2G5CA 4QFCA 3G17A 4YJHB 2BLLA 4KDFA 1E1LA 3E82A 4ONEA 2CVQA 1ULSA 2X8LA 3QWFA 3DBRB 2Q1UA 3PVZA 3I6QA 4JJFA 3RI3A 3GRPA 4GQAA 4OOFA 5DOZA 5F21A 4JNKA 1KEVA 4OKNA 1HDRA 1TB4A 4OKIA 5IZCA 4XQEA 1IY8A 1DC4A 5KJFA 5A5FA 1UDAA 1WW8A 1GADO 1XG5A 1LEHA 4BHTA 1DHTA 4G5HA 2IXAA 2IZ0A 4FJ1A 3RKUA 2DBQA 4B7UA 4DLLA 4O6VA 4AJNA 2O7QA 3TQHA 1LLCA 1PU2A 3FR7A 2PKQO 2GN6A 1LSJA 2I67A 1NPYA 2FN7A 3PJEA 4LSWA 1C0IA 4DYDA 4BO5A 3JQ6A 1LRKA 1AXGA 2UUPA 4L74A 3V8BA 1EDZA 3CZMA 4A27A 4XQ9A 5JXWA 2VHZA 4MDHA 3V2UA 1DHRA 4L8VA 3O8QB 4BB6A 1U5AA 3BIOA 1RM4A 4XX0A 3QJ5A 1YONA 4YA6A 1DPGA 2NVWA 5JPIA 3EUWA 3LQFA 3KEQA 4CV3A 1PS9A 4RPKA 5A05A 1U4OA 2QQ5A 2QRLA 1M66A 3PIDA 4R1UA 2WJPA 1EFKA 3G0OA 2X22A 4OL9A 2OBYA 4RO0A 1M6HA 4WK6A 1GYRA 1VM6A 4W4TA 2VUSA 4DPLA 4KUHA 5A5EA 1DO8A 5TT0A 5JAMA 5I8ZA 4J91A 1SMKA 3Q1LA 5DN9A 5B12A 1GV1A 1OZAA 3NDJA 4EZBA 4J0EA 4GL4A 4YAGA 1E1KA 4NNJA 3Q6IA 1X14A 1O89A 3W8EA 4KWHA 3D7LA 3K92A 4JP2A 1J6UA 4DREA 1B16A 1NHGA 4RF5A 4MJLA 1BG6A 1EE9A 1JW9B 3JQAD 1KC1A 3A9WA 1A7AA 1H2HA 4HY3A 3VHRA 4YJFB 1PJ3A 4BV9A 3ULKA 1F8FA 4CLOB 4XB2A 3WGGA 3TOZA 4NH4A 3ZWYA 5MGBA 3H2ZA 4CM9A 1X15A 1GPJA 1NTOA 2YHIA 3OEYA 2NVBA 3UKOA 4GX5A 1E7RA 3GZNB 4N5LA 3W4KA 3VTFA 3RFXA 3ROKA 4YACA 4IIUA 1PJSA 2WE7A 3OICA 2DU8A 1IHXA 2EXXA 5L4SA 5IN5A 2Q3EA 2YDYA 3AY7A 5COAA 1YB5A 3B1KA 2F1KA 1MFZA 2P91A 1ADFA 4NIMA 4BNXA 1SB9A 3VH2A 2FZEA 3DOCA 2FHSA 1XA0A 3AOEA 1NBOA 3WGQA 4DQXA 1T2AA 3ZHBA 2W2LA 1ZBQA 2BKAA 3L4SO 2O3JA 1ZSVA 2GSDA 3DZFA 2D4AA 3NDIA 4JK3A 1DJQA 4HFNA 2HRZA 4E13A 3A28A 2HDHA 4HFMA 2UVDA 3N58A 4F46A 2PZKA 4U6SA 3LF1A 4CM4A 3PEFA 4L75A 4PRKA 3ENKA 1NVTA 2FR1A 5A9TA 1X7DA 2YQ4A 1JA9A 1N9GB 1OC2A 2O3UA 1DLIA 5KIAA 1IL0A 1CF2O 5CPFA 5ENVA 5TRTA 3R0IA 4CM8A 4IQ0A 3W4IA 2GN4A 4XR4A 4JROA 4RZHA 4JIGA 2VUUA 4EDFA 3ICPA 1P31A 1GZ3A 1KY5A 2JCVA 2FSSA 1KEUA 3HZZA 3QE3A 4N18A 5LC1A 3T4EA 1BXKA 4FJ0A 2Q50A 1H9AA 1EK6A 1R4MA 3D0OA 3D4NA 3ZGYA 2I66A 3RCBA 2PA3A 3RBVA 4OH1A 1I30A 3BMCA 4N5NA 4R3NA 2EGHA 4J2HA 4GVLA 3QRWA 5BR7A 3VVBA 1TT7A 2ZYGA 4CMEC 4FPXA 2Y67A 1ZMTA 3I23A 5KJ6A 1T2DA 1VKNA 3T4XA 1HSOA 3F6YA 3LLVA 3ENNA 1P0CA 3ORFA 4BQPA 4LMRA 3BYZA 3RUAA 3MOGA 5KJCA 3CEAA 3QVXA 1GL3A 4BGEA 1O95A 4BO3A 3KUXA 1ENOA 4YAIA 2HJSA 3KO8A 5JC1A 1B26A 1T4BA 2VYVD 4DIOA 1GUYA 1HTBA 5JAZA 1EUZA 3SVTA 3T7CA 4XR9A 4Q9NA 4DL9A 3PZRA 4J0FA 3AU9A 3AI2A 2Y1EA 2ILTA 1KEWA 3DMTC 4OXYA 1P3DA 2EGGA 4GGPA 5CEJA 1WDKA 3I4FA 3T7EA 3A1NA 4GSLA 2P4HX 4WOJA 1NQOA 1IULA 3DBLA 2I6TA 1HRDA 1N1GA 1WDLA 3UF0A 2JKVA 1QXSA 3WLFA 3A4VA 4CV1A 4A7PA 3WSVA 2QYTA 2V6MA 2Z1MA 3VH4A 3WXBA 2VQ3A 2NVUA 1EVYA 4YXFA 2CVOA 3AFMA 1UXKA 1EUDA 5CDUA 1NVMB 5IDYA 1BHSA 2DBZA 2ZTLA 3JQBC 4ID9A 1I10A 2GZ2A 3JYLA 1N8KA 3D3WA 1ENPA 1A9YA 3KB6A 3V1UA 5IDQA 2BD0A 1Z7BA 1K3TA 2YV1A 3JYNA 5F5NA 3GFGA 2E37A 3STHA 2RH8A 3O4RA 3MJ4A 1Y8RB 4PG4A 1LJ8A 2EG9A 3TNLA 3HNPA 2E49A 5JMPA 3RUCA 1DXYA 1E3EA 1CEQA 4D79A 4ZD6A 4UUNA 1GEEA 3PLNA 3VOSA 1PL7A 3KVOA 2O2SA 1N1EA 1QYCA 3K2EA 4LSMA 1X7GA 3OF2A 3K96A 1ZW1A 4ND5A 3VTZA 2V65A 5CDYA 5A3JA 1V6AA 3CXRA 2I3AA 2PH3A 2C7GA 4O5OA 4PG7A 3MTGA 4MVJG 3KYDB 4BIIA 2W8ZA 1YH3A 1WLYA 1D1SA 4M87A 4E2ZA 5I9MA 4CQMD 4WLEA 1M2WA 1YL7A 4BVAA 2J5QA 1YOVB 3E48A 3IUSA 5C7LO 4FSHA 4WCDA 2NQTA 4PG5A 3H2SA 2AG8A 2O3QA 2YV2A 1U7HA 3F4BA 2VZ8A 2Z5LA 3AK4A 4A5OA 4ZJUA 5FF9A 5IAAA 1A7KA 5HM8A 4GH5A 3B70A 4CR8A 4YRAA 1XQ1A 2DUUA 1V3VA 4NMHA 5L53A 1LDBA 1PL8A 2VHYA 4Q3BA 4B3JA 5CEFA 3AUTA 1XKQA 1C1XA 4NZ9A 1NASA 1L7EA 1R15A 4WGGA 2PGLA 3GHYA 4D7AA 2FPIA 2HMWA 2ZYDA 1CQJA 1S6YA 3RC9A 1CDOA 3IOYA 1KERA 1BGVA 1E6EA 1GD1O 3PJFA 2R6JA 3E03A 5IJZA 3OQ1A 3WQSB 2QX7A 4JQCA 2JHGA 4IGFA 2GR9A 2Q1WA 1P74A 4YJGA 3ZNNA 4MKXA 4CQMA 1XWFA 3HFSA 1JKJA 1U5CA 4J7CA 4WLFA 4K26A 1VI2A 5EMHA 1EQUA 5A03A 4BMNA 1PTJA 3OJFA 4KTTE 1DRWA 2FZWA 1HF3A 5CDTA 1W8DA 1EVJA 1FXSA 2Q2VA 3WGYA 3H5AA 3GOHA 4R41A 2D59A 1Z73A 2XAAA 4EBFA 1PR9A 1R0KA 4I5EA 2Y0CA 4WCFC 8LDHA 3AM5A 1CYDA 3FF4A 2AEFA 4GLLA 4IDBA 1QV6A 4EUHA 3H7AA 3I1JA 1FDVA 1W73A 2ZB3A 3DB2A 1I36A 1XELA 4IGEA 1H2BA 3W6UA 5F1PA 3IIEA 3TFOA 3QWAA 1EZ4A 4BO0A 1VKOA 3N74A 1HE5A 1K0UA 4JCOA 3RC7A 5BSGA 3EDMA 4MKZA 5ITWA 4YCAA 4OYRA 3PHGA 3QVWA 3ZWBA 5DZSA 5I9NA 2VTDA 1HETA 4GVXA 4FGSA 2VOEA 2HK9A 3QY9A 1UJMA 1YKFA 3M2PA 4WNCA 3BXXA 4Z3KA 1I2CA 3SXPA 1MXHA 4WASA 1YB4A 4J1SA 4B79A 3DOJA 4XKJA 1ISFA 3HSKA 1DAOA 3VDRA 1PJ4A 3A06A 3FTNA 2DM6A 2NTJA 4CLRB 2YW9A 2HRBA 4J4HA 1LI4A 1P0FA 2HMVA 4I8XA 4ZQFA 1PJLA 1GFSA 3RASA 3VZQA 3WTCA 4MVJP 1ZEJA 1PQWA 4RPJA 3KOUA 5JDIA 4AJEA 4NBWA 3TF5A 2PR2A 3DAPA 3L9WA 4PLYA 1A27A 5DDIP 1UUFA 2X9GA 1B8PA 1FDWA 5CHEA 3WDSA 3ABIA 2OO5A 4YPOA 3BMNA 3FD8A 4NDNE 4FD3A 4BO1A 1ZK1A 2JFGA 4MIYA 4EYEA 1EDOA 2HQ1A 2EJVA 2IZZA 1R0SA 4OXNA 3UXYA 4CM1A 3MOIA 5JSFA 3HDHA 1J0XO 2C5AA 1H6CA 1MX3A 5ICSA 4KP7A 1KBZA 3JTMA 4A10A 3EZLA 4FFOA 1NXQA 3IDSA 4NG5A 5AXAA 4CPDA 3BMQB 4ILKA 4BNKA 1E7WA 4MVJA 2QHXA 4PG8A 2HJRA 3GFBA 5B1YA 1EFLA 5K9ZA 3OA2A 1UXHA 4J6FA 4GBJA 3VPGA 4BQRA 4PZDA 2AHRA 3OIFA 1K6XA 3Q2IA 1JKIA 4U0KA 4E3ZA 2YQ5A 1P44A 1CETA 1C1DA 2BF7A 2DUWA 2OP1A 1BXZA 3JQFC 1XQ6A 4B4VA 1CIVA 4BKOA 5JYDA 1ZK3A 4NBTA 1ZJYA 4PZEA 1EMDA 2ZB7A 3RROA 4NK4A 2PD3A 3OJLA 2Y1DA 2E48A 1BXGA 3GVXA 3H9UA 3OFSA 1I32A 1Q1NA 5BNFA 3Q0EA 1PL6A 1PQPA 3TZHA 4W7HA 2VYVA 2X7HA 5JO9A 4E12A 3DHEA 4E0BA 5G4KB 3DBHB 1I8TA 1LNQA 5EQFA 5LDGA 4L73A 3H65A 3E18A 6LDHA 5L4LA 4E6PA 4IMRA 3SEFA 2BFMA 3B20A 2B83A 2OL4A 4ALKA 2CMDA 1I3LA 3VPHA 4Y6RA 5T8KC 3OP4A 1G1AA 2J6IA 2NSDA 2ZIZA 5AYVA 4OQYA 1DSSG 4BGIA 4XGNA 2C20A 5A9SA 1U7TA 2OBNA 1E6UA 1XYGA 3FCOA 1PIWA 3NV9A 5I9LA 3GNTA 4YQZA 1WPQA 3CSDA 5L51A 5KVSA 4IXWA 3SLGA 4D3SA 1SB8A 1WNTA 4RF2A 3ZHXA 3QSGA 2VCYA 3QVSA 4AJPA 3W4JA 2ZJ1A 2E6UX 5DULA 5CFZA 1U3TA 1AE1A 4MINA 4PZCA 3EY4A 2FPGA 4CL3A 4WE3A 2A9FA 2ZQZA 3GHHA 1ZEMA 3E9NA 4URFA 4I9UA 1AXEA 4CMCA 3ZU3A 3KLMX 3QP9A 5JDCA 3K73O 3AI1A 3TSCA 2IXBA 1DLJA 1F12A 4MOWA 4CMJA 4E5YA 1FDUA 5CPBA 4BUCA 2B0JA 1F06A 4YT4A 1OBFO 3OQBA 2O3TA 3RUEA 1ZIDA 3G1UA 3HB5X 4WPGA 5AOVA 1YBMA 4J1QA 5G0UA 3AUUA 3VDQA 4A26A 3IS3A 4UEOA 2J3HA 3GPIA 1ZFNA 1DOHA 3LT1A 1E7YA 4II2A 3W8DA 1IE3A 1NR1A 3PWKA 4U6QA 2GO1A 4WLUA 2H5LA 2XOXA 1YE3A 2EW2A 3QW2A 2BH9A 2R00C 3WIDA 5L45A 4MKRA 4AJKA 1MG0A 1Z7EA 4BNVA 1UR5A 3U3XA 4NU5A 1EBFA 4PLZA 3CTMA 3QHAA 1ORRA 4BGVA 4QQRA 2HAEA 5FI5A 3F1LA 1ISJA 1V3UA 4WLVA 4M55A 5JO0A 1VC2A 1QKIA 3TZCA 3HUDA 4O1MA 3LF2A 4LVCA 1IYZA 1OC4A 4B7XA 1MB4A 3PWSA 3W8FA 2QG4A 1FDTA 2Z95A 4LCEA 1R16A 1O94A 1PSDA 2Y05A 3RJ9A 2NTVA 3NGXA 3G49A 4NPCA 4J49A 2GYYA 4HV4A 3WWYA 3MWEB 4MP3A 4Q3DA 3GGOA 2X0IA 1MLDA 1LQTA 4RVSA 2GZ1A 7MDHA 3BMOB 3C1OA 4CLOA 5AVOA 5IN4A 3Q9UA 2JHFA 2AE2A 4IBOA 3MJTA 3ONDA 1S7CA 3AM3A 5L7WA 5FFFA 1ZXLA 4CLHA 1LA2A 1R12A 4IDEA 2VWGA 4NR0A 3GVIA 1IPFA 3MZ0A 3KLPX 3VPFA 2J3JA 5JMWA 4BB5A 3PHJA 2GD1O 2G82A 2WE8A 1BWSA 4EGFA 1UZLA 1GTMA 3D1LA 3EGOA 4CLXA 1ZO8A 2JJYA 3S2GA 4LRSB 4DPKA 3I9NA 3KZVA 5H83A 5IXSA 1PGQA 3WYEA 1X13A 2CVZA 4HX5A 3GNSA 5HTOA 1M75A 4FFNA 3TL3A 4WUVA 2OORA 4O59O 3ROPA 1WZEA 3NEPX 1HDXA 1JVBA 1TXGA 1XHLA 4PLCA 2VYND 2J8ZA 1LDYA 2BGKA 4QEDA 1VJ0A 1U28A 4RCVA 4J9UE 3IAHA 4QO8A 4YAEA 4ND1A 2VN8A 3AWDA 4B4UA 4DVJA 4QT0A 5AXCA 4MVJH 3TRIA 4XRRA 1SOWA 4YAJA 4WECA 4UVGA 1HE2A 4CM8B 4XYMA 1VL0A 1PJBA 2X5OA 1K89A 1WDMA 2ZATA 4PRLA 2NACA 4AJ1A 2DPHA 3BAZA 3OM9A 3KSZO 1LDNA 3CPSA 3V1TC 3ROMA 2GCGA 4XD2A 2Q45A 5A04A 2X0RA 4ZVVA 4DGSA 4YAKA 1YO6A 3JYPA 2GN9A 3OEWA 4BNUA 3ZU5A 4BNFA 3AM4A 1Y9AA 2W4QA 4KWIA 1EVIA 3UICA 4ZU3A 1R4MB 1E1NA 1A5ZA 1H9BA 4ALNA 1KIFA 1C3VA 1QLJA 4NI5A 1E77A 1G6KA 1LU9A 3SC6A 2B5VA 4E5PA 3ANMA 2CF6A 3JQEA 2EJWA 4OM8A 4XWYA 4BNJA 3OIDA 3VPSA 4IM7A 3H3FA 4S3MA 2X1HA 3LU1A 1QYWA 3SC4A 1F0YA 1OI7A 2NTNA 2V6FA 3TZ6A 4Y6PA 2A94A 5ICMA 1B15A 3JQBA 2RH4A 4M54A 4M1QA
chains in the Genus database with same CATH superfamily
4MJ3A 4LMBA 4P7JA 3RAFC 1U3FA 2QVZX 2NYVA 3DUWA 5AP9A 5JU6A 1KAEA 5CLQA 3KJHA 3LUFA 4GVPA 3K32A 4P36A 2G25A 3AJRA 5CJ2A 3VA7A 2CXNA 4ZQBA 1V41E 3EXG2 3B1JA 1K2VN 3C3JA 1N5DA 2EYQA 1TIBA 3OCCA 3D4OA 3VVCA 4MVJD 4D9CA 1FB5A 2EDCA 3DF9A 1MQAA 1PWEA 1UJ2A 4U7TB 3GAAA 3KPYA 4FZ3A 3U4AA 3UCEA 5HUQA 1QBGA 2P6UA 3OTWA 4NNPA 4UARA 5DP2A 4N9QA 3DPUA 1NYQA 4PSVA 1VE1A 1V7ZA 2VJBA 5IBRA 2H0RA 1CPYA 1VSTA 3PGVA 4O4IB 4CMGA 4IQGA 4R6XA 4LQDA 2OO3A 3EPJA 2Z4RA 2CXHA 2XMCA 4IFIA 5IF3A 3ZI0A 3O8CA 4HGYA 1DTWB 4FHDA 1KHHA 1Y6QA 5B6PA 2XQGA 4OATA 7ABPA 4HRAA 1ORDA 4NJOA 2QL6A 1ZN2A 2TECE 2YN4A 2XMPA 5C8YF 2A9RA 4UCXA 3OURA 5I4KA 5TVGA 4OY3A 3V8VA 4DDVA 3C97A 4YGYA 3RVRA 3OHSX 1XCMA 1N7HA 3PX2A 4UREA 4M88A 3J81A 3OX1A 4E21A 3G59A 3GG2A 3D6TB 4Q9HA 4EFNA 1I3MA 4FYHA 3VAZA 4OOEA 1MN6A 4RJTA 1Y48E 2ZTVA 2IUEA 2R8OA 3I92A 4BPRA 3NBFA 1I0IA 4V0NA 3A1EA 4I1SA 3PCTA 1PWHA 1FMLA 4GPIB 4DARA 4DHEA 1Z5OA 4MQ6A 1M67A 1UBTS 5ALWA 2BFEA 5KX5A 1KSJA 3ONFA 2A58A 4JGBA 3EQ9A 1IN4A 3DL0A 4A8JA 1L9KA 1K6MA 3L6BA 2ZRMA 2QEQA 4MVXA 2WWVD 4RA9A 2CXSA 4EHBA 4AN0A 2JLBA 4IJKA 4JAVC 3M6VA 3QLJA 3MT9A 1WUYA 3W9UA 1XDDA 3MSXA 1HUQA 3OUTA 3EEQA 5IEBA 3UHFA 3ERCA 3ZHYA 2EZ4A 4KDEA 1GSIA 4MVJM 4PGMA 4YMUA 1F14A 2GTIA 1FDOA 1OT3A 4WIAA 4RZXA 1NW9B 4MIEA 4DJEC 3O8RA 4F3NA 2DTXA 1ZGZA 3DGFC 1T9KA 4B6GA 5FOVA 1ZD2P 1IOWA 4OHVA 2VTBB 1M7HA 1BYUA 1DWQA 3JW8A 5GJWC 1JDBB 1EEXB 1DRVA 1PF7E 3I3SR 3N5KA 2UUOA 3GV0A 4MIKA 3UAWA 1XCGB 1YUBA 4B47A 4V2UA 4OQQA 5JS6A 3T3HA 4B3SB 1K8RA 4B3HA 3F71A 3TRDA 3OX3A 2QDXA 2VQSA 4JLOA 3CVWA 1ABEA 3H0CA 2FUNB 2C82A 4JBGA 4D80A 2A5LA 2HFJA 5A7GA 1AHPA 2R8YA 2D13A 3ZWXA 3HN7A 4D41A 1ZVQA 1H8ED 1YS1X 3PZBA 3FFXA 3KT6A 4TZKA 1T26A 3CR7A 4G3XA 4XOUA 3K0FB 3EIEA 2P2DA 3CNEA 2PIAA 1W2WB 4KR3A 1FJGB 4R1PA 2HK8A 3ZXIA 4K86A 3RYHB 2IYWA 3FDZB 3CT4A 2O8BA 4INOA 2B1JA 1D2GA 2NZ2A 4A91A 1PJAA 1EVEA 4AD8A 3BD9A 1VRWA 2XMSA 3RKSA 4ENTA 1DC3A 1ZU5A 4FJ2A 4JT2A 3K71B 1JJ7A 5KYWA 4W5TA 3OUUA 3GVHA 3UMYA 5HFNA 1QZUA 1XVTA 3JQ7B 5TPWA 4G85A 3N53A 1D07A 1F51E 1CY0A 1XTZA 3IV7A 4TT3A 3NV7A 5DTEA 2OGZA 1DB3A 3DR3A 3G3EA 4HK4A 1RPJA 1VCHA 4KLZA 4D6PA 5KTRA 3D5TA 5JSKA 1FP1D 4NCXA 3T5TA 1J56A 4BKUA 4M86A 3C5CA 4NJMA 1YZGA 2ERYA 4V3CA 3FNHA 1TTPB 4JBXA 1ZXBA 2DFDA 4JLJA 3UJ8A 1WMDA 2W6ID 2ZRFA 3DLIA 4Y9SA 1YACA 821PA 2V4MA 4W8OA 4UMEA 4ZQCB 3QUQA 3HJNA 3Q3IA 4C0HA 1TVEA 3NBZC 3ZJTA 1G8FA 1WXQA 4YAUA 3K9LA 2P69A 5GM2A 2PUCA 3VOAA 1WZNA 2H65A 3MB8A 4PYJA 1KYWA 4B3RB 1YRBA 3TNYA 3DSRA 4GOKA 5AK6A 2NUAA 3P2IA 1M6YA 1XROA 2CHFA 2PGIA 3DLPX 3PG5A 5ILQA 1QGOA 4TS1A 3F1KA 1J2TA 3I34X 3QPVA 4F5YA 3QVTA 1WETA 1G8AA 3GRKA 5LKRA 1CUXA 3QPUA 3DKRA 2AMJA 1W0KA 4YRBA 3BERA 1FXWA 4Q12A 1E4VA 3KR9A 3VZPA 2IYXA 1J2YA 1PFWA 1MOQA 1J9ZA 3LT4A 3PITA 1O95C 1YIDA 1LI7A 3GT7A 3HBNA 5IT5A 1LWOA 3PNKA 3GDWA 4QA9A 4TTIA 3W04A 1NLYA 2AUNA 3RAEC 2BUBA 1Z25A 2BFFA 3I76A 1N57A 3IV9A 4NICA 1WXHA 1H0KA 4OQZA 4ZOLB 3NFYA 1L5HA 1CDDA 1T9CA 1XLTC 2JRCA 4MVWA 2J5KA 3ZZ1A 3ET4A 1U4NA 4TRMA 3DKVA 4WW0A 2YV5A 2I2WA 3WL5A 4S2EA 1V71A 1BXRB 1Z36A 2IE8A 2JDIA 3B1FA 3TL6A 1Y1LA 4MW7A 2OTCA 5AIAA 4A8JC 1KOLA 3HM2A 5EPUA 1DVRA 2QM8A 3I42A 1M3SA 1LLDA 2AOTA 2CBXA 3O82A 2VHCA 2AXEA 3DVSX 4UBNA 2RHTA 2O14A 4IIVA 2RGRA 4R2KA 4J16A 5EKUA 4AY3A 4N8EA 4HBZA 5DNCA 2PTGA 1RXSA 2PYZA 4MUAA 1Q1EA 5FV4A 4KPYA 2X2FA 5IDXA 1YVUA 1VKHA 3RRXA 4MRAA 2ODNA 4EYSA 1DQNA 3SXUA 1N6NA 4ND3A 1FYDA 5BXYA 5MGNA 4P82A 3ZLBA 1T5DX 2CF5A 3EVTA 4H08A 3UNXA 6ADHA 3AVWA 1Q1GA 3KYCA 4DDKA 1W36C 2HY7A 3FNGA 4FN5A 1DJNA 2OHVA 3DKPA 3UJPA 1KY4A 9LDBA 4KPUA 2VOJA 2YC2C 5ALQA 5EMNA 4OHZA 4E03A 3I01M 3K30A 5EGNA 3R3HA 4RK1A 4JOSA 4IJWA 4K03A 2Q3CA 3PHCA 3FDJA 4WGFA 4YRJA 3FYTA 3O94A 2QRZA 4JEHA 1JB9A 3R24A 4XWTA 5DRTA 3E4CA 3O2QB 1LC0A 3CJRA 3CWCA 5HM6A 3DVLA 4JT9A 4JT8A 4X63A 3FR8A 3RTDA 5BSVA 1CUEA 1F9AA 4D8XA 5BQ5A 4KLRA 3C5VA 1XZFA 1VSQA 1QQBA 4E15A 2ZI9A 5FO0A 3GRVA 3PFGA 2FK7A 3TDNA 4LRXA 2IEBA 1VJTA 3FCSB 2IV3A 4C4AA 1IVSA 2FE4A 4OGFA 2PZJA 2E1RA 2FP4A 1NZFA 2PRYA 4GKAA 3GLGB 4BJ3A 4XCQA 3T06B 3MNFA 3NEJA 3D8NA 1P33A 1KJNA 1LC3A 1OI2A 2AX4A 2Q3LA 3HVIA 1TTQB 4Q66C 3GZNA 3IUYA 1EVKA 5BV0A 3S7ZA 5B7NA 1UKCA 1QE0A 2Y9MB 1DWUA 2W0MA 4CIVA 4MI1A 1XRPA 2RCYA 4XYEA 4F56A 1SXJB 2VQ6A 5DB4A 3ZNOA 1YNOA 4B0PA 3OPNA 4LC1A 3KTAB 5CBPA 2WHPB 4HWGA 3ACDA 5CH5A 1NPDA 3FRJA 4N7MA 3H5IA 1Y3IA 1ZWKA 4URUR 4E51A 3ECSA 3OZBA 5DKFA 3LVRE 3U09A 4LNAA 3IR5A 1EWRA 5DGCA 3ZK7A 4YLYA 5FEMA 1INLA 1OHHA 3OAAD 1JMVA 5EKSA 1JHUA 3GLHB 1TJ4A 1MOSA 3GJ6A 4AXXA 2EOAA 2EEPA 3EFOB 1TZKA 2VXBA 1Z29A 2XB9A 3TVTA 2GRUA 2FEMA 3HBMA 1QRTA 1MX9A 2Z1DA 1UZNA 1ODSA 2GZSA 5DWQA 1HL3A 2C4KA 1Z13A 4N82A 4N3AA 4FT4A 2LKCA 4HWOA 3BKXA 1JGTA 1SXQA 3VHLB 4WLNA 4IG4A 3CGGA 4HDKB 1WS6A 3I3OA 2VWHA 4JV5B 2EX0A 4RENA 2SCUA 1SG0A 4NHEA 4CM4B 4CKWB 1FK8A 1TJNA 1KOJA 5KYYB 4DQDA 1YULA 2RGGA 2PX8A 2SKEA 2QY9A 4X20B 3DE1X 4PCUA 3A1SA 3D2AA 1I5OA 3UK6A 3T1TA 3IEKA 1YA4A 4NULA 3FHTA 1JIJA 4OQFA 5HSGA 1ZINA 2Z2JA 2QP4A 1UOPA 2XF2A 4RA6A 3TQIA 5KNLA 4K9LA 2QRPA 2VDOB 2H1FA 5DK6A 1Q22A 2ECPA 1PN3A 3MGAA 3VKUA 1ZVMA 5IP5A 1ECPA 2C97A 1B73A 1DEOA 1I3CA 1GRCA 1OROA 1VDMA 3IQWA 4OMUA 1U0HC 5HGJA 2C2WA 2GERA 4KUEA 2WWYA 3AHEA 4KVAA 5KVCA 2Q5CA 2B8TA 3DYVA 4L57A 4FC6A 2PUFA 2BKVA 2V0CA 3MFYA 4WY5A 5LZ2A 3C87A 3A14A 4N5DA 4Z49A 3B1VA 1HEUA 3DE6X 5DTJA 4CMEA 1T6XA 4Q01A 1HDGO 2AMFA 4Q4DA 1CR0A 3G02A 1OWOA 1L6RA 4TYYA 4ZCLA 1G8JA 1HL7A 2HSEA 5ALPA 3RYFB 3QPCA 3TZQA 2Q8NA 5FBVB 5K7SA 2I54A 4JP8A 1F3LA 3B48A 3N7TA 1RTTA 1G8YA 1Z8NA 4PZPA 2PUEA 1D1QA 4M8NE 4IP0A 1GGNA 3FIJA 4MB2A 4Q3NA 3S28A 3V1LA 1DBQA 1X87A 3KKKA 4JX9A 5EE5B 2QLNA 2FTKE 4G0PA 1K7SN 1KZ1A 3DAYA 4LJ8A 4NBLA 4IIXA 4R1TA 1PGNA 4G1CA 4LRWA 4CFSA 2XUAA 3IE1A 5LA6F 4HS9A 1DG9A 5BSEA 1QHHB 1W59A 3ZD9A 5KZMB 2VRCA 1WTCA 2XYHA 4EPXA 2H7VA 2IHVA 3VZDA 5DT9A 3F46A 2P2ZA 3HBFA 4AP5A 2ZWOA 2IWRA 1ZGBA 3R6GA 2PLRA 4UBMA 4LA4A 2JIOA 1MW9X 1W25A 2BDTA 5KOYA 1OJ7A 1CQXA 5C8ZA 3VUFA 4TYNA 4HTFB 4O4LF 4QOSA 4QYIB 2APJA 2FJ0A 1NFQA 2GCOA 2H1OA 2GKSA 3N2KB 3PB3A 4PSUA 1R88A 2DCUA 2GF2A 5D1HA 3IT3A 4DC1A 3COVA 4R69A 1P3JA 5KYVA 4B71A 4C0KA 1B6SA 4C2TA 3BMOA 1KTIA 1L4EA 1E2DA 1NVAA 5FO1A 3TRKA 1NX6A 3HPQA 1PSWA 3AOEC 4IDAA 5FOSA 1HNXB 3E7XA 4JI8B 4D4MA 5G4LA 1JH8A 4EW1A 2Q4OA 5JW6A 1OQAA 3TSOA 3MELA 5AOBA 2RBEA 4Q6WA 8ABPA 4NEHB 1OB2A 4IWYA 4KOAA 5K2MA 4CBVA 2FAXA 3WOVA 3VQTA 2XB4A 3A2KA 4I9GA 1ZNZA 5IC4A 4E70A 3OLVA 4EPRA 4U3JB 2C78A 3AHHA 2BMVA 4XGIA 5FBWB 3W8DA 2EIHA 2MSKA 4QL3A 5C7OO 3NC4A 1PNTA 1RWMA 2D74A 2FPUA 2A92A 3PQEA 1X0XA 5JJKA 2EQAA 4WCFA 3H9GA 4WX2B 5TIIA 3UHAA 5FUXA 2IEGA 4EITA 1WXWA 1XK7A 3OOHA 4JBNA 4AP9A 1FMTA 3NB0A 5GIOE 1P4JA 5IMBA 4ZQEA 4FGUA 4DPMA 2EP8A 3HN2A 1I51A 2QYSA 3ZU2A 3KCNA 5JECA 3B9QA 4QEZA 5AM2A 3RVBA 1F2DA 1SOMA 2P8JA 2VHQA 1E1RD 3UMSA 4B2IA 2P7IA 5DM2A 4YY3B 4BTEA 4WEOA 1G1MA 2F90A 3JD3A 2GD2A 4ZDWA 3CZQA 1ZI6A 4WK2B 3C6BA 4BX8A 3GAFA 5ADVA 2I4TA 4H4DA 1EGAA 4E08A 3AHIA 3LQKA 5JADA 3AF5A 5JD3A 3F2VA 4FHEA 1YOVA 3NBUA 4P33A 1JWLA 3A1CA 3ASYA 3W3AH 3LI2A 1P5HA 4KNYA 2WIBA 1SVOA 1NVVQ 2HFKA 4PQRA 2X19A 3OZUA 1J0AA 3A7DA 1DIHA 1RJFA 3H5OA 4D6YA 1E58A 2ZRDA 5CLLA 2EKBA 5INTA 2R2AA 3H9JA 3TW4A 1JHDA 2DWQA 3RTGA 4LXTA 4QEKA 5A5DA 4UAVA 2WIDA 1H94A 3MAGA 1T5HX 1T9AA 1VYTA 1Y7TA 2QZJA 3G5LA 4ZKDA 2L0XA 3VKWA 2VDMB 4OK6A 2WB2A 1ST2A 1X7HA 2ONZA 1OPRA 5B7QA 4EEZA 3LRPA 1N2CE 2GLXA 5KTKA 2NSLA 2ZT6A 5KSPA 2P9CA 2OLEA 3I5AA 1RXYA 4URHA 5F64A 2MU1A 5HJ2A 4N41A 3DCNA 3NT4A 3ZQ4A 4GPAA 2IBMA 3AF2A 4TKVB 2HU7A 2R7MA 5EWLB 2I6FA 2H0AA 4JODA 1W35A 1KI9A 1A96A 1HV8A 1Z0SA 3AERB 5EE0A 3KAQA 4B4DA 4NEGA 4B43A 3ZJ4A 2E89A 3OSUA 4EIWA 1CRLA 4EMSA 3P7MA 2A0UA 1P2VA 4R83A 1Z74A 4M4SA 4RESA 4YVFA 3SYKA 3TLCA 1VXOA 2YFHA 1LDGA 2OHOA 3P4UA 2YYZA 4YECA 2SKCA 1ONSA 1NNI1 3LRTA 1KMHB 2UVPA 2W6JA 1BFDA 5AR1A 5T6MA 2HSJA 3SFTA 1YVDA 1ST3A 1CY2A 2VC2B 4UHHA 4X44A 3JQCA 4R2XA 3ZBQA 2JPDA 2FW8A 1TKRA 5AVYA 3AXTA 4WXHA 1X7XB 3VUEA 4Y6SA 3WR5A 4JJIA 3HRHA 1KKMA 1DO0A 3KEGA 3MK31 5DJ5A 3UHPA 4OQLA 3D8BA 1XTBA 4GP7A 5DGDA 3KOXA 4RORA 2A67A 4AF8A 3ICCA 1Z4OA 1ZN8A 2IEDA 1SA0B 2Q28A 2V7TA 2YWJA 4HX9A 4K9SA 1NLMA 1YDFA 4Y1RB 3G9QA 2EL7A 2RHDA 1TUIA 4AJ2A 3HXMA 4CMHA 1BKDR 3DHYA 1TT5B 4CEHA 1I33A 1E3SA 1I4LD 2RHGB 3UFXA 2BKXA 5THQA 2Q1SA 3MJSA 1PEKE 4PZUA 2ZLBA 4DSNA 4DQLA 4YEDA 1FOEB 4MQ5A 4TLDA 2D1YA 1SVLA 2WF8A 5DGXA 5C7YA 1WQ3A 4IKPA 3ZBUA 3GJZA 1QG6A 2SECE 4DQUA 2JFOA 1L1RA 2KJQA 1PYGA 3K2QA 1SEPA 1H65A 5JNLA 3U7GA 4IICA 4Y1FA 4F2DA 2C3PA 5JNWA 4U63A 2FN8A 3E7WA 5LQUA 4UE6A 3QK7A 1L8QA 4OSOA 4GI3A 3OO0A 1YB6A 2CLEB 4YRRA 5KJ1A 1MVNA 1Q16A 3EZ9A 3I9V6 5C8YA 2ZETA 3PICA 5J2UB 5IJ9A 2QNRA 3ETDA 5K0EA 3KPWA 3CO5A 4B75A 4JL5A 4RD0A 3SJZA 4HB4A 1Z2NX 2AWOA 4RVDA 1IHUA 5DHAA 4GYJA 2W37A 1JHPA 1QDEA 4BWYA 4C1BA 1C7RA 1CDZA 1ECFA 2XF8A 3WI7A 4DLSA 4Y2UA 4IKOA 4AN1A 4CCYA 1UAGA 2IU6A 4RNDB 1ITZA 2EJBA 1O94D 1RI1A 1LBTA 3NDRA 2HPZA 4EJMA 2PMCA 4KXLA 5AW3A 1SU6A 3U62A 3HS3A 4NBUA 4GM0A 3M8KA 3X2SA 2A0FA 3B9RA 4C4TA 1QGED 1F17A 4WN9B 1TD9A 2QD4A 3K9CA 5LWQA 3PD1A 4HX2A 2XRYA 1T5IA 4PYOA 1ULUA 1PR6A 3P5SA 4Q9DA 2P0YA 3A32A 1V4BA 1OCEA 3I9FA 2XOKD 4UTZA 3LNCA 5L40A 3LO5A 1GEGA 2AC2A 3ETNA 3MIZA 3UAGA 5FWYB 4PGHA 3K4QA 3T54A 1GAQA 2YJNA 2IXDA 4DBVO 1Z4PX 3QPDA 3R76A 1A9RA 4IQ8A 5L3RA 1GSAA 2ICAA 4JXXA 2WSBA 3QVGB 2DBRA 1NQVA 2FPKA 4ZANA 3WQHA 1S9DA 3UWSA 1J49A 1NOJA 3PEYA 1NRXA 1NGSA 1QWSA 3PR2B 1GPWB 4LXQA 5BW8A 1RRFA 4ITVA 5K0GA 2Q6OA 5EA2A 5H3LA 5K8LA 2FWBA 1HQKA 2M98A 3EN0A 4Q39A 3LUGA 5E3HA 3GEGA 3G7NA 1AS3A 4YRMA 2BW0A 1JG3A 4YYZA 5B1HA 1JEQA 3DLHA 3T5PA 1GZHB 2Q7OE 3U48A 3LUPA 1KH2A 2DX7A 1AGYA 2WFLA 3LCMA 2A2ZA 3LHKA 3PUWA 1T2FA 3HL0A 2UV8A 4ZVPA 2VI5A 4RD1A 5EI5A 4E5KA 5AJTA 3GEMA 1VLLA 3GAZA 1XDUA 2WTUA 1FNMA 4LDQA 3RUFA 4UHDA 1FTQA 3HWWA 3B13B 2E5FA 4LY6A 1F7VA 2AG0A 4UPEA 1SFRA 5EJ9A 4QJ5A 3C3CA 4HEA1 5JPCA 2JI7A 1R8SA 1RJ9A 5SYAA 2GKOA 1K6JA 3M5DA 4TYWA 4NAHA 1AHHA 2Q2WA 3DEJA 1L1QA 2EBUA 4XXHA 3X2FA 5I7RA 2I55A 1FP4A 1EX7A 1TCCA 2YWEA 3N9IA 2V58A 3EOZA 1I4OA 2JLXA 4TX1A 4K9MA 5J4KA 3F3YA 3T1QA 4I0WB 3FGOA 2P5YA 4RAOA 2VNAA 2IYVA 2MSNA 3ITKA 2J7PA 5K6RA 4L6IA 4I3FA 4DM4A 4J4TA 4M49A 2AEJA 1USKA 1A9ZA 3LHSA 1IN8A 1MP0A 1T35A 2EV9A 4DQVA 4ERNA 4PGFA 2Q6LA 3JAKB 4BVGA 1IM8A 2JCSA 4MYDA 2QB5A 3GA0A 2PKYX 4G97A 5IZCC 2X23A 4L5CA 5AT1A 3U4IA 2OFFA 1CVRA 2ZJFA 1FE8A 4PO3X 5I9TA 1AX9A 2QMOA 5JASA 3E7PA 4OHWA 5FORA 4IRXA 4YRKA 4TV9F 2ATVA 3O5AA 2O2HA 5ARCA 4MIOA 4CIXA 1V3QE 2NADA 2LR0A 5DO9A 5G1NA 4U7WA 2AVDA 2PVPA 2WINI 5JAQA 5TQVA 4C3UA 3KWJA 3LBHA 4BEVA 3P0IA 1ULBA 1RCTE 4IGAA 3JXEA 121PA 1K5HA 4X5OA 4X64B 1TIKA 1TQ6A 2YJTD 3BTOA 1H2AS 2YHBA 3I4CA 3NQ41 4LQ4A 4FOPA 3N2ZB 1OJLA 1Y6RA 4HNQA 1UBSB 4A0FA 4HVTA 2AEMA 2AFIB 3EEIA 3WB1A 1K3UB 4DMGA 4ER3A 1KBQA 4YDSA 2J0SA 2O1XA 2ZSEA 4MEBA 3F67A 1TEXA 2C2KA 1K27A 1XZIA 2LD4A 3NYWA 4R1SA 3GEPA 4RQTA 4O0MA 4RTQA 2Q4BA 3U7IA 4KRYA 4G1FA 2UDPA 4NF2A 3HJBA 1E1QA 3EXFA 1PEAA 3D6VA 2FDCA 2ZJOA 1JBQA 2WG2A 4QARA 2J08A 2GM5A 4N4AA 2OECA 4ZOBA 3VR0A 2K6GA 4TLLB 4XWAA 1WKCA 3H5RA 1IVNA 2CCJA 2PVSA 2QAGC 3NIDB 5AVTA 1M8FA 4D44A 3KJIA 1DUSA 3CINA 1YL6A 3IKLA 5K0BA 2P79A 4L22A 3NHPA 1KYYA 2Q6IA 3PFKA 5JH7B 2D3TA 2IYFA 4NBRA 3UPTA 5A2GA 3KBBA 3QPBA 5LXTA 1I0ZA 2DJ5A 1XZAA 3P0EA 3ZDFA 1ZUNB 3TJRA 4F11A 3DEZA 5EESA 1KZGB 2BBWA 3TOXA 1SO8A 4RYDA 2YVKA 5AWFC 1Z0FA 1CT9A 1UDRA 4G81A 1CC1S 4F5WA 4ZYUA 9MHTA 2EP5A 3H3JA 4PM4A 4DANA 1AURA 4IDDA 1QWOA 3I2GA 2CFSA 2B4TO 4O5AA 3S3TA 5L4NA 3ICVA 1B76A 3QU2A 2QE7A 2EX4A 3AP1A 4AMZA 1J8FA 4RS4A 2ZYVX 3Q7TA 4BJHB 1Z2EA 2RE8A 3P97A 3DTVB 3V4FA 1WSAA 1A98A 1JSXA 4LVUA 4HQKA 3DLBA 3RGWS 3HA3A 3SKXA 1Y4UA 4BRSA 1U9JA 1KA9H 3R5XA 1T9ZA 1XF9A 3I39X 3CX4A 2C5HA 4GM4A 4MB6A 1EBUA 4OQ4A 3GLGA 1O1YA 2VJMB 4KXMA 4RH3A 2QNIA 5FTMA 4WZAB 3I5YA 3BK1A 3FMFA 4BNDB 2CJXA 2V55B 4OPMA 4C6HA 2V5UA 3PHBE 4UMFA 3S1LA 2G9VA 5JAPA 3NP7A 3HEBA 5K3FA 3TD6A 4BBZA 1W85A 4Q1DA 4P0TA 4OK3A 1ONNA 5JRJA 3S55A 2E87A 5KOIA 3H1GA 3GMSA 3WRVA 3W8NA 3HQ4O 2FFAA 3EG5A 3EARA 1KAQA 4Y6QA 3TE6A 4MWCA 2RHMA 3NJ4A 5ABPA 2QTWB 4ZT2A 1S3IA 3T15A 5HHTA 1MJ5A 4JJ7A 3RFVA 4TTTS 4MYCA 1M76A 3VR5D 4IS2A 2VT7A 3IDAA 3O84A 3ONWA 1RI5A 2JFWA 3I9V1 4RDHA 3KQVA 3BORA 4ZEMA 3PD7A 2H3HA 2PFGA 2YJZA 2FPPB 4F3CA 1OBHA 1QVVA 4X65B 1QF6A 3ZZTA 5FKJA 2O23A 1N4AA 3FOWA 1D4FA 5LUAA 3ITNA 3CRQA 4K6CA 3MD0A 2XCRB 4EAQA 2F6RA 5CB4B 4HDSB 3A6ZA 4BRUA 3GDOA 1U9CA 3IP6A 3LBFA 4UD6A 2HJGA 2R00A 2YHIB 4KXXA 3KQYA 1RP1A 1C7QA 2C1ZA 4R0VA 1EDEA 4H1HA 2QN2A 3UJ3X 5DHTA 4E5SA 3COJA 3PC8A 4NAVA 5FAXA 5ESXA 1U1DA 2Q6TA 1T1SA 3UHOA 2K7FA 1BRTA 4GX1A 4RA6B 3MWDB 1T8WA 3GLQA 5HIIA 5K51A 2NU7B 2V97A 4ZOAA 4V0OA 2FVXA 2P77A 4GZLA 3KQNA 2Z9BA 4BNIA 2CVPA 2FSIA 4BO2A 1YZYA 2CSXA 2VNHA 3SX2A 1AK2A 1VI5A 4EJ0A 1Z35A 3TSWA 4B3DA 4M8LA 3K6SB 2VDLB 4UBIA 3EXHB 3WNDA 1J8MF 3O0TA 1QC5B 3I83A 5ERXA 3X44A 4R1NA 2YZGA 2X4IA 1GG5A 2VDQB 3FLMA 3RFTA 3K8YA 3WBKA 2QD5A 1C80A 1XCBA 2QENA 1P1HA 3EULA 5G0TA 3HYLA 3VHQA 4BUJA 4C07A 4YIHA 1G5TA 2ZDQA 2QP9X 3CZ4A 2CDRA 3WIOA 1QZZA 1FS5A 2WUEA 1DC5A 2R6HA 4W1PA 3GY0A 4N0PA 1PLLA 5KTMA 5EPOA 5I5GA 1VSUA 2RHRA 1DBWA 4FK8A 4EG5A 3UMFA 3O0DA 4V0MA 2HMTA 4KFCA 5FUYA 3E2IA 3HR7A 4RFVA 5DBGA 3QELA 4Y2RA 4HH4A 3RC2A 4UUQA 4LSGA 5E4JA 1JVSA 3G8CA 5BN4B 4E5MA 5KVVA 1LWNA 2DE0X 5TNXA 3PTZA 4B34A 5ICGA 1U2TA 2GPTA 3OP1A 3KUDA 2F7SA 2PWAA 2CXPA 2BSXA 4RH0A 1NBMD 4X3OA 4FBGA 2HO4A 1ORIA 2L69A 3ONVA 1NM5A 4OJNA 1MB3A 1LRLA 3SDZA 2IK8A 4MWSA 1GQRA 2HK6A 3BHMA 2B21A 3H4VA 5LXTF 3INRA 2EWMA 4Q1VA 4ZOCA 2REOA 3UH1A 1QCDA 1Z9BA 1TM2A 4ZVKA 4ZHQA 1VPWA 2XOKA 2Y77A 2HRCA 1NXOA 2QTTA 4YFVA 5EXXA 2PXXA 4QAJA 1KEPA 5L3ZA 4YR9A 4DCTA 1NKSA 2R97A 2W6PA 4MV6A 2HTEA 1IWPB 4PVDA 4DDUA 2TMKA 3HMQA 4IUCS 5AKGA 2HNKA 4L7QA 3FSJX 1DTWA 4UATA 1YRQA 4HNGA 2CFCA 2GBCA 2NU6A 5JIBA 1DDGA 3IAM1 3OF5A 1DE0A 4ZI5A 1ZK2A 5HOEA 5CA1A 1YQUA 4PSDA 3T8YA 4WN3A 5ADUS 4LGYA 3EW9A 1CW2B 4U5QA 1G7CA 3WMEA 3E1KA 1UJCA 3M6UA 5AKIA 1DAEA 2G67A 1NF3A 1A2KC 2ZR9A 3CB4A 3FI9A 3GJ5A 1EE2A 3GLSA 4ZODA 4NS4A 1QYDA 3IAXA 2XNSA 1N3IA 2Q5QA 1KSHA 2CD9A 2XMDA 3NFRA 4RV9A 3T7TA 1JDBC 1SG9A 4BS9A 4DV7B 4V1CI 3THSA 2OM2A 2C4WA 3AEQA 4FQ5A 3GG9A 1M5TA 3RD5A 5CFMA 3P2JA 4XW2A 3RSZA 2M2IA 4UM5A 3N6XA 4ER7A 5FWXB 2CLLB 3W90A 1MHPA 1UBEA 4M6WB 1H66A 3F9IA 2G4VA 2XJ4A 4F72A 3F3KA 3U7JA 3O8BA 4GGOA 4BX2A 4DR3B 3RUDA 1CWUA 3ON5A 3L1HA 4J07A 4RETA 3TB4A 3TK1A 1JFLA 3L0OA 3MWEA 4KE6A 1IPEA 1OXVA 5JALA 2O2ZA 3ESYA 5DHFA 4AY6A 2EW8A 1LPAB 4R3WA 4PNPA 2JGMA 5C8XA 1GAXA 4IDGA 1GPH1 2A8YA 3BFJA 1S02A 1DFGA 3BRWA 1TM3E 3EMBA 1U1GA 2FSVC 2W98A 4M7PA 3MWGA 3G5AA 1TYBE 4HWKA 3ZNQA 2ZCUA 1NT4A 1Z38A 1HYEA 3D3WB 3QKSB 4KC0A 2CXUA 4L7VA 5JCZA 3ASUA 2ZS7A 4YAWA 1BDHA 4DEYA 5GP1A 1WF3A 1OFVA 2O7RA 3DAOA 3KHTA 1P77A 3QBTA 2CK3D 1JFRA 4HJXA 1E6KA 2WAAA 2VDWB 4IVQA 4MA4A 3WGOA 2CLOB 3EHDA 2ES4A 3TD2A 2GS9A 3ROFA 3B9BA 5TS3A 4K9QA 1EIZA 3ZIDA 5IYZF 2J9RA 1AQJA 5F3DA 4CMAA 5A3RA 4R9RA 5C37A 1J8DA 2P4SA 2ZIFA 4YQFA 2AEEA 4Y7DA 1K3FA 1SKMA 2EWVA 1UFRA 2XNDA 3LW8A 4QPNA 3T0IA 4CT5A 2OD9A 4WFIA 1LX6A 4H15A 2O2GA 3WDKA 4AG3A 3DMPA 3R9WA 1M1NB 5F2OA 1YJAA 1PGJA 1W1IA 5FADA 4D6XA 4WBNA 5CITA 1WXXA 3WYDA 5DI3B 2NZJA 2EEZA 3HLYA 2CLKB 3C1AA 3K2BA 3PXXA 1C2TA 4ZKEA 4BWFB 1JU9A 1DCTA 1GDTA 2BKUA 3DXFA 2QUKA 1Q7TA 3PYMA 1FJ2A 3H2IA 4FNMA 4N54A 2WWTA 4TN1A 5DSXA 5L95A 1Z62A 4BQSA 3JQ7A 1UPAA 1E6CA 2P6MA 3FIUA 4TM8A 5G2OA 4D4KA 4QRHA 1I4DD 5B5SA 1KEEA 3U44B 4RKQA 5JD5A 2PSHA 3N75A 4OTZA 5JY6A 2RJ3A 1NUHA 4ZCQA 4BNGA 1TQDA 2GPNA 3DDNA 2I3BA 3ZJVA 3QLUC 2H8GA 1JSCA 2ZJ7A 4LJYA 3N8GA 3SYNA 1OPXA 5LBTA 4M0KA 3GLRA 4GRAA 5L7YA 1QLHA 1NJ5A 1KTVA 5ITVA 2AOXA 4ZO7A 2L17A 4Q4CA 1GNTA 2GLTA 4OQDA 4YMTA 3EA5A 1SEVA 2VPTA 2WD8A 4Q34A 4JR2A 5IYZA 4GI1A 1W49A 3IKMB 2GETA 1G41A 3TQFA 5UKDA 2W2KA 1JDJA 5IPFA 3WLTA 1Y3HA 2I65A 5FI1B 3F74A 4RIFA 2NUPB 2PT5A 2RIPA 2ODWA 2NUAB 4D4JA 1P7PA 2AJ8A 2D0DA 3F0TA 1V47A 3ZCRA 2F67A 5BWBA 4HZUA 1UT6A 1U8EA 1NXPA 1ZVVA 1HH4A 1I3NA 2X77A 2VK4A 2A3RA 3HDJA 4BLSA 5ICEA 1G8KA 1KPIA 1KXJA 1VZ2A 2BGTA 1O6ZA 3GFRA 5JLAA 5IBCA 1JHXA 5LCXA 4E14A 2K2QB 2QX4A 2QRVB 4KAXA 3QQ5A 3RTBA 3MWYW 2IZ6A 4P32A 4A6XA 4CEIB 4Z4FA 5I7EA 1MH1A 4YJGB 4Y8VA 3VR4A 1SCJA 4RPIA 3ZI4A 2N1BA 2B82A 1KI6A 1PR2A 4HZIA 2H2WA 3EIUA 3N2YA 3ZYZA 3COZA 4K6OA 1FA9A 1FMFA 4BFSA 4POOA 2W5UA 1JFFA 1LLQA 4JB0A 1RU3A 4MW5A 3U56A 3ZE8A 4WL0A 5G41A 1FFGA 4CUZA 3L8HA 4UNSA 3PGJA 5EN4A 2W90A 5ALVA 5JNRA 4Z4IA 3UOGA 1ISHA 3PGMA 3PDUA 4WA8A 1AA6A 2PQ2A 5DASA 2A14A 1PFQA 3MERA 4RM2A 3D0RA 4A8HA 2O20A 5H16A 2X5XA 2WJGA 5U4QA 4B2LA 3O92A 4OLAA 4UAUA 3DD5A 4J0GA 4FFVA 4TYPA 2GD6A 4FC7A 1FDSA 4M8KA 1A4RA 3IUNA 3LX6A 1HDCA 5DX0A 3ZEIA 2DLNA 4GPEA 4D3FA 1YI1A 2DVMA 3IPCA 2QZPA 2R9VA 3TIFA 1JWAB 5BUCA 1E9FA 5HS6A 1HYQA 4MDYA 2ZU6A 1SQ6A 1NI3A 2QTAA 3F3MA 2K87A 1UDXA 5B4VA 5B1DA 3HXQA 5CXSA 1U28C 3GDGA 5B2FA 5IRCD 2EJCA 4XCXA 1LPPA 4JU8A 5BR1A 3A2NA 2QMUA 5EWMB 3PKJA 1LGYA 1G16A 3E8XA 3HFRA 4U0JA 4JI6B 3T4PA 3D8UA 4MCAA 1X0VA 1A2OA 2QM3A 3LPCA 4L50A 3CVUA 4S0XA 1SUSA 4HFRA 3W5AA 3AXSA 3OOEA 2M1ZA 1ACLA 4H7FA 4P8RA 3O26A 4BAGA 3AIIA 4NCHA 4W5WA 2BTOA 4Z0HO 3Q8XB 3S2IA 5JS1A 4P98A 2M6KA 1H2WA 2C61A 2RG7A 3DCJA 3ZV4A 3LY8A 1L5LA 4WXPA 3M33A 2CBGA 3DVRX 4M0EA 3RHTA 4UOEA 4YPVA 3ML1A 3NTQA 2IBSA 4BP3A 3TN7A 5LD2B 3WGUA 3RRYA 5F9HA 4PNHA 2A3NA 2NUBA 1P72A 4KQEA 4DAEA 3Q98A 3CZ5A 1ORHA 3DH0A 1K4YA 3DWGA 2GAAA 1P7WA 1GNLA 1HT3A 4QX6A 1ZDMA 4JN6B 1XU7A 3PYLA 5JTUA 4LY9A 4DR7B 1N6RA 3OX4A 2E4WA 3AJAA 2EKPA 1AN0A 3L43A 4RABA 1FP4B 3F9RA 2Y27A 2X0NA 1UZAA 3B2EA 5H0IA 4AJOA 3AHCA 4E1BA 1MB9A 3PFBA 3DCIA 2JD1A 3V8QA 4JXZA 4J0IA 3TSYA 3KZNA 1MO3A 1NVGA 2OR3A 3RS3A 1RPZA 2BM9A 1JPUA 1OV6A 3I8SA 4I5GA 4QQKA 4C3ZA 3VJRA 4LHXA 5DLDA 1YDHA 1B8UA 4XTRA 4B3BA 1W44A 2H3EA 4Y9TA 4G5RA 2E4XA 4F9GA 3AR4A 3I37X 3NHLA 3S81A 2Y1CA 3F5DA 5DNEA 4CT0A 4DMRA 3QJYA 3L7MA 3KC2A 1JL3A 4GO1A 4O63O 4RSGA 4GI2A 1XMVA 2IPLA 2P68A 3WWOA 2ZITA 2YKGA 5CUQA 2FN9A 2R8ZA 2VATA 3K0FA 4S1WA 1IZYA 5DN6A 2CFTA 5HFAA 3RVDA 4CKWA 1SXPA 4PYNA 2X5NA 3ZKWB 2IP1A 4KJXA 4LOIA 3RARA 3DLCA 1E32A 3BB1A 4WKCA 4LQLA 2J6HA 5CG2A 2DC1A 3WNCA 1ODTC 1Z88A 2Q6KA 2B5OA 2KSQA 4ODIA 4CUJA 3GK3A 4O33A 5C9ZA 2POQX 1CV2A 3GBSA 3N7AA 3DAHA 4RTRA 1COWA 4J0JA 4MMYB 4HGOA 1QGUB 2OWEA 3DZGA 4EKYA 3AUAA 1XRJA 3D6NB 2X3FA 2HDWA 4W63A 5C4IA 3FRHA 1ZSNA 3F97A 2I3DA 1BDBA 2DSTA 3NWJA 4XD7D 3WL6A 3ND5A 4J0HA 3FB4A 2FJUA 4AJHA 1KK3A 5D5QA 1KAOA 2IXTA 4QECA 1XD9A 3AM1A 3GJ0A 3PFHA 2G5CA 4EELA 1B42A 2VPPA 4QFCA 1SD1A 2H29A 5TV2A 4YJHB 5FI0B 3WXMA 4EX6A 2HI0A 1I9CA 5GWXA 1JQKA 4ZEVA 1LPNA 2X8LA 4FDLA 4JFAA 1YCHA 3ZJYA 3DBRB 2V7QA 3N05A 4AI6A 4QNRA 2W70A 3RI3A 5BWNA 1E1DA 5DTIA 1MJGA 2E21A 3PQ7A 1MKYA 4F4HA 4GI7A 2AIRA 4Q4JB 4WVFA 4Y0VA 3WGKA 4DW8A 3DMHA 1HDRA 1DELA 1Q1ZA 1NN1A 4OKIA 3E81A 1W4CA 5ANRB 4N6OA 1SRRA 5LMNB 1W1UA 1CNMA 2OQRA 2PRZA 1UDAA 2WJ3A 2ZAIA 4H7IA 4OXXA 4OV6B 5A5FA 3M7IA 3UJ7A 1GADO 3G8DA 3RRBA 3GAMA 2PMDA 1XG5A 3IVGA 2YTZA 3CW8X 4BX0A 5BSKA 4G5HA 5EZYA 3U16A 5GPBA 1GO2A 2FWRA 3AL3A 1XHEA 2XD9A 2GRJA 2IX3A 3G2HA 2V7VA 2Q9BA 3D0KA 1G2OA 4QYMA 3LM8A 1SQFA 4RMHA 3TQHA 1T0BA 2GN6A 2PKQO 4Y2GA 2FW7A 3OT1A 5D84A 2A9PA 1O96A 2I67A 3RS8A 1Z5VA 3TBKA 5TDHA 3S5UA 4LOLA 4DJTA 2JAWA 1QQ5A 4DLZA 1HM5A 1C0IA 5TEVA 4RTSA 3JQ6A 4UPVA 1I9GA 2ORWA 1D5CA 1ZM9A 4UXIA 4EY4A 2GPWA 1CU1A 1UODA 2OHGA 2CLIB 5JZSA 1ECJA 4RGQA