2AW6A

Structure of a bacterial peptide pheromone/receptor complex and its mechanism of gene regulation
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
287
structure length
287
Chain Sequence
b'MFKIGSVLKQIRQELNYHQIDLYSGIMSKSVYIKVEADSRPISVEELSKFSERLGVNFFEILNRAGMNTKSVNETGKEKLLISKIFTNPDLFDKNFQRIEPKRLTSLQYFSIYLGYISIAHHYNIEVPTFNKTITSDLKHLYDKRTTFFGIDYEIVSNLLNVLPYEEVSSIIKPMYPIVDSFGKDYDLTIQTVLKNALTISIMNRNLKEAQYYINQFEHLKTIKNISINGYYDLEINYLKQIYQFLTDKNIDSYLNAVNIINIFKIIGKEDIHRSLVEELTKISAKE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PrgX
publication title Structure of peptide sex pheromone receptor PrgX and PrgX/pheromone complexes and regulation of conjugation in Enterococcus faecalis.
pubmed doi rcsb
source organism Enterococcus faecalis
molecule tags Transcription
total genus 103
structure length 287
sequence length 287
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01381 HTH_3 Helix-turn-helix
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 2aw6A01
1.25.40.400 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2aw6A02
4FBIA 1POUA 2LYPA 1ZPQA 3EUSA 4I6TA 2O49A 1RIOA 1QP7A 2PUAA 2EWTA 2R1JL 1WIZA 2LCVA 3F51A 4X4DA 1R63A 4OB4A 4IVZA 1ZS4A 3UFDA 1QQAA 1PERL 2EF8A 4JCYA 3FYAA 4PU4C 4YG7B 3LISA 3KZ3A 3PXPA 1ZZBA 1WH6A 3SCHA 1CQTA 2XJ3A 2ICPA 1AU7A 2IV1A 3RZZA 1QP4A 2CSFA 3TRBA 4I6UA 2OR1L 1UXCA 1PRUA 3KXAA 2GRMA 2R63A 2H8RA 3R1FA 3ZHIA 2O38A 4O8BA 4I8TA 4MCTA 1PRAA 3QF3A 1LMB3 4JCXA 1NEQA 2AUWA 4GHJA 4I6RA 1CJGA 1SQ8A 3G5GA 1JFTA 1HF0A 1OCTC 3SCGA 4Z5DA 3U3WA 2XI8A 4IWRA 2IU7A 5A7LA 3IVPA 3G7DA 1JH9A 4X4EA 1Y7YA 2GZUA 2IVGA 2WUSR 4YBAA 4YARA 1ADRA 2XSDC 3OQNA 1WH8A 3ZHMA 3BDNA 5K98B 3QYXA 3O9XA 1IC8A 3CLCA 1S7EA 2JCGA 4Y42A 1ZZ9A 1UTXA 4X4GA 2HSGA 1LCDA 3JXCL 3JXBC 3H5TA 2AWIA 1YSEA 4GQMA 4JQDA 1LCCA 1RPEL 2PIJA 3GN5B 3OQOA 2LYLA 3DNVB 2LYRA 3B7HA 1RZRD 1VPWA 1BDIA 2A6CA 1BDHA 2PUGA 2IVQA 2JVLA 2AXVA 1L1MA 1PNRA 1LQCA 2L49A 1EFAA 4Z5HA 1O4XA 3QWGA 4J1XA 1X2LA 3GN5A 2WIUB 2PUCA 1WETA 2PUDA 1ZUGA 1LLIA 2LYSA 4YG4A 2O4AA 2KPJA 3BS3A 2BNNA 2HINA 2MEZA 3F52A 2AXZA 2GRLA 1ZZCA 1RZRA 1JWLA 3KJXA 4X4CA 4FN3A 3L1PA 3ZKCA 1PRVA 1ZVVA 2IUOA 4YG1A 4IA8A 2BNMA 1QP0A 2PUEA 2B5AA 1JFSA 1DWKA 1X57A 1ZZ8A 1NERA 4X4FA 3BD1A 3VK0A 4X4HA 2MQKA 4J1WA 4X4IA 2BJCA 2OFYA 1DW9A 3MLFA 2D5VA 4F8DA 3QQ6A 3HZIB 1UXDA 2PPXA 4PU7A 1Y9QA 2BNOA 1RZSA 1ZZ7A 1GT0C 2EBYA 2PE5A 1R69A 2L8NA 1QQBA 2FJRA 4PU8A 2XIUA 1B0NA 3GBFA 2LYJA 2KEIA 2ICTA 1OSLA 1E3OC 3S8QA 2AW6A 4PU3C 3FMYA 2XCJA 2KZ8A 3CROL 4NDWA 1ZZ6A 4X4BA 3FYMA 2IVBA 3OQMA 2LYKA 3JXDL 2CROA 3CECA 2PUBA 3F6WA 1ZAYA 2PUFA 1QPZA 3OP9A 4Z58A 3D1NI 3OMTA 4Z5CA 2AXUA 2KEJA 3LFPA 2LYQA 4MCXA 3SCFA 1XWRA 2KEKA 4Z59A
chains in the Genus database with same CATH superfamily
3MEKA 3EUSA 3RO3A 4N2QA 2VTBA 1HG5A 4LG6A 4CGVA 3BU8A 2M63A 1ZZBA 5T3RA 3EIQC 2YBDA 1UJKA 5FT9A 3UX4A 1ELKA 3TXMA 4J8DA 4FP7A 1B89A 3EHRA 3NQPA 3EDTB 3TWSA 3TG4A 1DNPA 3BG1B 3SO8A 3EU5A 3OAWA 2ONDA 4F53A 5CCLA 2GZUA 1N4SA 5CHEE 5FZSA 1KT1A 3DEPA 4LCTA 4JA9A 4Y42A 4X4GA 1UTXA 1LCDA 1WY6A 3JXBC 4EZLA 2LSVA 3O48A 4G2VA 3T5VA 4K5BA 1EYHA 2VSOE 3C3RA 4B0ZA 3IKOB 1HE8A 5C1DA 2WXIA 3L17A 3FUFA 1H6PA 4RG6A 2VSNA 5DRYA 3LKUA 3AS5A 1PRVA 3EHNA 4MBGA 2B5AA 3FTWA 4JHKA 3T8KA 3CVNA 3FUMA 4N3CA 1YMPA 1Z6TA 4BEPA 5AIJA 3T8MA 4ACLA 1E3OC 1QZXA 4RSYA 1IHGA 3JXDL 5KBAA 2XS8A 1UG3A 4ATZD 2I9CA 3DWLG 1N95A 2VYIA 4AIFA 4G11A 5DBKA 5DSXA 1HU3A 2PUAA 3PZ4A 4EQZA 4FHJA 3HHMA 1AWCB 2R02A 3L08A 3D9MA 4PU4C 2UY1A 3SCHA 2EIKE 3FU3A 4A3TA 3PUJA 2DIWA 4BESA 3ABME 2R63A 5ARGA 4EZKA 1QBQA 2WVIA 3CK8A 2WPVA 2BF0X 5HQ8A 3ULEG 2XSDC 3ZHMA 5K98B 3CLCA 4YDOA 1H2VC 5E75A 3JXCL 2BEDA 3CIAA 4LNUD 4X8QA 2LYRA 3B7HA 1H2UA 4HXIA 3VWSA 4K03A 3QWWA 1O4XA 3E33A 4HB5A 1TNYA 1BPOA 1IXVA 4ANVA 3GYZA 2Q7FA 3U64A 2XHEA 4BSZB 4X4CA 3L9TA 4TUUA 3L1PA 1OCCE 4PS7A 3ONLA 3QC1A 3TWVA 3NOCD 3QOUA 1X57A 3APFA 1DW9A 2J4BA 2KATA 2GW1A 4DLOA 1UOHA 3R7QA 1UXDA 4NURA 3PE4A 2RFAA 4BTBA 4HLLA 2A5EA 2FJRA 3FWVA 3DXMG 4EKIA 3FU6A 1SA5A 2XZDG 4L1BA 5EKQD 3LEWA 2F37A 2JABA 3DBSA 3MV2B 3F6WA 4DX6D 1S70B 4DRXE 3FUEA 1HF8A 3I4RB 4GA0A 4JEHA 2RD0A 3LS8A 3SD5A 4J0UA 1HS6A 4FADA 4U8VD 5AQ7A 5KJMA 2IJGX 3LISA 2H6GA 2VGEA 3ZN3A 3E32A 3FFLA 1X81A 3EUVA 2CSFA 3TRBA 4UI9J 3D9KA 4AXHA 1ZBPA 4TV3A 1HFAA 2O38A 5AENA 1LMB3 4WNDA 5CBNA 5A6CA 2V4HC 1O1RA 1HF0A 1JCQA 3L16A 3SFXA 3AG3E 2ILRA 3GZDA 4G24A 2XRYA 4X4EA 3TGOA 1K3ZD 1G3NB 4JHRA 1IC8A 1V54E 2R17C 3FTUA 4BX8A 4GCOA 3KEAA 3TWQA 4LEUA 3DNVB 2WMOA 3ASNE 4BSXA 2PUGA 3Q47B 4ER6A 2LAHA 1ZB1A 2PUCA 4EK9A 3R09A 1LLIA 3BS3A 1JCRA 4ME2A 3ZIMA 2A5UA 4UWLA 3O4ZA 3V31A 2RG8A 2YINA 3TJPA 4EZIA 3ESKA 2BKKB 3MGBA 1NP7A 4UUCA 1Y9QA 1NW3A 2KEIA 1U2VG 3K9IA 3MA5A 4JA7A 3OXLA 3D3MA 5D2MC 2KZ8A 3FYMA 4I2ZA 4B93B 3DM5A 4EPZA 1AP7A 4K5AB 3OMTA 4BX9A 3JUEA 3B7SA 1N52A 4QQIA 4I6TA 2KC7A 3EU9A 4OB4A 4MRUA 3MZLB 4MLPA 2CHZA 3Q78A 5AARA 5AAOA 1EF1C 3TWTA 2MHKA 1UN8A 1KZPA 1XNFA 1OWPA 1XGWA 1JPLA 4U07A 1ELRA 4HOUA 3ZHIA 4O8BA 4G26A 3G5GA 3SFYA 3ME5A 2M4HA 3NZSA 3UWPA 4IWRA 3FTXA 3ENEA 1SZAA 4A63B 3G0TA 3IBEA 4EHMA 2GRPB 4WNFA 2YHEA 3P2BA 1OWNA 5CEAA 3RIBA 2C2LA 2A6CA 4ILHB 3PE3A 1HH8A 1MHQA 4KZCA 3HVEB 4LNBA 2O4AA 4FLHA 3JQ1A 2BNNA 2HINA 2GRLA 1ZZCA 4DPRA 2DYSE 2L6JA 4UWKA 3JCKC 2IUOA 1Y6IA 2LNMA 1Q2ZA 3UINC 5DRTA 4WWNA 1HG2A 3PRZA 3ULYA 2D5VA 3DRAA 3AG2E 4GZCA 4DI4A 5FQ8A 3E34A 3ZKJA 2J4DA 1BU9A 3S8QA 1TJCA 2XQ0A 3FTZA 3DSWA 4WNEA 3UIPC 4Y6CA 3UT4A 3D1NI 1BI8B 4Z5CA 1TR4A 2EQXA 2XXPA 4FBIA 2LYPA 4JC8A 3KS2A 1QP7A 3F51A 3Q15A 1ZS4A 5DTQA 2OEVA 4GCNA 3JQ0A 4LRZA 2FFHA 4NQ0A 2CG2A 5ITZF 4BETA 1QYMA 3UXGA 4HQDA 1UXCA 3W9GA 2HCNA 3NROA 4I8TA 3PDNA 3LVRE 4JCXA 5BXOA 2J7UA 2PNNA 1OCTC 3EHMA 1HQ1A 1NA3A 5ENTD 3IVPA 3URZA 2CFUA 1Y7YA 4BT8A 2WUSR 2FBNA 3QDNA 3AS4A 3CVWA 3I4GA 1FPPA 2P9SG 1NA0A 3H5TA 4C0EA 3FDHA 3NZUA 4U0SA 3C3OA 3TELA 2P58C 3LQXA 3QAQA 3B7BA 4I1OB 2DYRE 4Z5HA 2WIUB 3PVLA 3NF1A 4TUMA 3L13A 3PEUB 4B8CB 2WMNA 3ZXSA 2R59A 1QP0A 3BD1A 3ASGA 5CEDB 2H6IA 5JHAA 5BXUA 2KZTB 2YNQA 5GAGi 4PU8A 1BLXB 2BKGA 2XIUA 4BERA 3FUDA 3OTNA 3FMYA 4NDWA 1ZZ6A 3ZFWA 3SZ7A 1Z5SC 2PUBA 2P9NG 4V3IA 4HORA 4DX7D 3CHOA 1HX8A 3D9IA 3CKBA 3ZRHA 2LYQA 4L23A 2PQNA 1QZ2A 3SX0A 4IVZA 3R7RA 4NACA 2X6JA 2HFZA 4E6HA 1MJ0A 2WM9A 4YG7B 2BTDA 1AU7A 3RK6A 3VTXA 4CGWA 5EIDA 1VDYA 3R1FA 1D9SA 3FHEA 4MCTA 3OKZA 3ZHEB 4U0UA 2NYJA 4HI9A 3LY8A 4PDXA 3UUXA 3WG7E 3BG0B 3BUAA 3FU0A 3JUIA 4DE9A 4I6GA 4N5QA 1TNOA 2KXPC 2WXFA 2JQEA 1Z3XA 3B7TA 4N2SA 4GTOA 5D0QD 3CHRA 4GTTA 5G05J 4U96D 2X3MA 5B1BE 4A1GA 3GN5A 2OV8A 2QYUA 4C0MA 1WETA 2PUDA 4CDNA 4N39A 4HVBA 3A9ZA 3F52A 3ZYLA 4PS8A 4Q96A 1OUVA 4AEZC 5J90A 2ETCA 1D8EA 2BNMA 2PUEA 1N54A 4F1PA 2WXGA 3MKRA 4CT0A 3LJNA 3PNLB 3MLFA 1QB2A 2ETAA 3NB2A 2Y3AA 2EBYA 3T5XA 3MKQA 4BY6A 4XEIG 4EKGA 2V4LA 5CRVA 2KCLA 2PXVA 3DPYA 3R9AB 3ZVVA 3ZUVB 2IOSA 3OP9A 1QQEA 1OWLA 2V3CC 1PC2A 2XENA 2LSUA 5IY5E 4UI9C 1K1BA 1OCZE 4OVUA 3VLFA 4HRAA 3U9WA 5T4YA 2WQHA 2FI7A 2PL2A 5KJLA 2Y69E 4YDYA 3CV0A 1UW4B 2IY0C 5H7PA 3KXAA 2H8RA 3CVYA 3QWPA 2VGXA 2I2OA 2PXDA 3UM0A 5HRYA 5FQ6A 2A4ZA 4N5CA 2P9KG 1JH9A 1YA0A 4J6IA 5FQ4A 5D66A 2NXPA 4JHJA 1WH8A 5G2NA 3MX3A 4L7TA 2B6CA 5KNGA 4JQDA 5LCWJ 1LCCA 3LYAA 5J08A 1L1MA 4IULA 4U04A 1FVHA 4GYWA 3RRNB 4WWOA 4DUIA 4F7AA 1FCHA 2J08A 2LXMA 2WXHA 2PM6A 4RVBA 4OBMA 3ZKCA 3AU5A 3UT8A 3CVLA 5CERB 3R9MA 2F8YA 5LFAA 2LXLA 1ZZ8A 2LNIA 3Q73A 2MQKA 4XIFA 2I1KA 3ZEFA 4ER3A 2IONA 3TWWA 2VGYA 4BWRA 2X6IA 3NBNB 4GTSA 3QQ6A 4HOSA 2XPYA 2FO7A 2BNOA 4U7EB 3PE5A 4FJYA 3Q79A 4XE0A 3UM2A 3KEZA 2J8SD 2XZTG 3UMVA 1PY1A 4U8YD 4PU3C 3L22A 1Y8MA 1TN6A 5JJ7A 1K1AA 3C98A 2PUFA 4ANUA 3UPVA 3L54A 1S63A 2VTBB 4EZJA 1HZ4A 4GPKA 4ER5A 1N11A 4ABNA 2O49A 3QK0A 1ELWA 5BPPA 2EWTA 1LTXA 5D0OD 2QC9A 1OY3D 4WNGA 3FP3A 4GPMA 5KCMA 5ENPD 3FYAA 2FF4A 3HXDA 4GMLA 3TWUA 4Q69A 1EDUA 4OAUC 4WUYA 1L5JA 2LUHA 3IV0A 3ML8A 3CVXA 2AUWA 3B13A 3L82A 1MFQC 2XGOA 4XX5A 3HXCA 3U4TA 2XI8A 1OXJA 2J49A 2WXMA 1MQSA 3CVQA 2FEZA 5C2YA 2IQCA 3CGHA 4HRLA 3PZ3A 1RW2A 5DIZA 2HSGA 2PIJA 3CEQA 3OQOA 2QY7A 1KLXA 1BDIA 2IFUA 3FU5A 1E8XA 4F1SA 2AXVA 2JVLA 3UKUG 5LX8A 3IHVA 4J1XA 4TXQA 2CG3A 4O60A 2XPZA 1DCQA 4YG4A 1NZNA 2KCKA 2V5QC 3D9JA 3SBSA 4W9RA 1O5MA 4FN3A 3AU4A 5CRUA 5JUWA 4RG9A 2Y4UA 1JWGA 1DWKA 4JVSA 4J1WA 4YVQC 3E37A 4YDEA 5FZQA 3PNTB 2PZIA 2MRIA 3QB2A 3AG4E 1QQBA 2VJ8A 3Q49B 3UM3A 3PH0C 4MS6A 3T9KA 2ICTA 2IO2C 3FEXA 2C0MA 2EINE 3SF4A 3TXNA 3Q4AB 4C9BB 2H6FA 4AV7A 4IN3B 3RAUA 2GGFA 3IXEA 2JEKA 2UWJG 3S7BA 4X4HA 3C5RA 3HXBA 4GA2A 2UY1B 3LJ3A 3LCAA 2EF8A 5EX3A 3FY4A 3KZ3A 3FUJA 3Q7FA 4GA1A 2ICPA 3A9XA 1H2TC 3CSTA 3LDZA 1INZA 2IEJA 3CVVA 1SQ8A 1JFTA 1PAQA 2R5SA 1BI7B 2CFZA 3UTMA 4AOFA 3G7DA 2C0LA 4Q94A 5G55A 2IVGA 1WDYA 2XEHA 2OOEA 4DI3A 4J8EA 3O9XA 2WXQA 4BTAA 3X2QE 4GQMA 5EN5D 1RPEL 1E90A 1VPWA 3QKYA 3ZYQA 2QFCA 3RU0A 5HI7A 2DVWA 3ASOE 3QWGA 3ISMC 4UI9K 4H7YA 4N3BA 3G2VA 4HOTA 3EJNA 3KJXA 5EIBE 5E76A 1ZVVA 3CR3A 1TN7A 3Q5MA 1MZCA 3FUNA 1HXIA 1S0PA 1FT1A 2KCVA 4ILIA 2GRQB 4R7LA 3CVPA 3V30A 4JD2G 3RRUA 4ANWA 3VLEA 1ZAYA 4UWFA 4Z58A 5BT1A 3HIZA 4DLQA 2R05A 2KEJA 4AM9A 4MCXA 3A9YA 3GZCA 2LAIA 2HR2A 3UFDA 4KXKB 2VSXE 1V55E 2PXKA 1N4QA 1QP4A 4GZDA 4I6UA 2HO1A 4NRHB 1JWFA 3FEYA 1JUQA 2XXAA 1WAO1 3ONKA 5G04C 1OCRE 4IYPA 1NEQA 4GHJA 4G8LA 4UWHA 2ZGGA 3QJZA 4U63A 4LSZE 2PXUA 4YBAA 5G05C 3OQNA 2KBXA 3BDNA 2R2LA 3U66A 4EECA 3DXKG 1A17A 4ZHBA 3APCA 1LQCA 2PXPA 3SR4A 3ABLE 1D8DA 4XZ4A 1TYQG 3S2AA 3DSUA 3MJWA 4M3OA 4YDWA 3CLJA 1U3DA 5HKPA 3CKCA 3FH8A 4IA8A 4PH4B 3NXHA 1MX6A 1JFSA 1E8YA 4Y6WA 3SFZA 2XGMA 5EX0A 2WB2A 3MCXA 3GBFA 2X6HA 2AW6A 3AG1E 4AY6A 1OWOA 2I6HA 2IVBA 3AJIA 4G23A 3CECA 1E8ZA 3ASHA 4EQFA 3ML9A 1E7UA 2DZOA 2HE0A 3CHQA 5JJ6A 1OWMA 4CEMA 1HO8A 2EILE 1ZPQA 4FJZA 4G8KA 1PERL 5M72A 5DTRA 4J8FA 4APOA 4TRQA 4GTVA 1N94A 3Q75A 2IF4A 4CT4A 3RZZA 4CYMD 4K0RA 3UIOC 5ANLA 2GRMA 2GRRB 4A1SA 5JJTA 1PRAA 4HNAD 3GZSA 3D9LA 4H7XA 1GW6A 3NDBB 4I6RA 5AQAA 3ASFA 3HRAA 3TEPA 2WXOA 4UWGA 3IEGA 4J7WA 5LCWC 3D9HA 2WXKA 3S7FA 3OXGA 2DWZA 4GYOA 3B7UX 3S7DA 1YSEA 2OVFA 2LYLA 3I5PA 5EYPF 5BUZA 5BV0A 3CSFA 2GRNB 2J9QA 4APFA 3HXFA 3W9FA 4JW1A 5FWQA 2WXPA 2L0TB 1N4RA 3C3QA 2PXEA 1JWLA 3QARA 5G04J 5BV1A 4FLBA 4JB8P 4O6FA 4LNGA 3SY2A 4WVLA 4GMJA 2OFYA 1P5QA 3Q7AA 4OVVA 2XRZA 5BNWA 1UJJA 4G25A 3KSQA 2L8NA 3ABKE 4I9CA 4XI9A 3SQVA 1W3BA 2KM4A 5FIOA 1H6KA 3LY9A 2P9IG 3ZPXA 4DX1A 2XXQA 1IQUA 3SI5A 2AXUA 2OCCE 4M7CA 4HRMB 5ENQD 4Z59A 3LXUX 3NOGD 3LVQE 4QFVA 3KL4A 4A3VA 1SQMA 3E30A 2X6KA 3GZ2A 1QQAA 2Y4TA 3JYSA 1KZOA 4JXTA 4JZYA 1IKND 4GMRA 2IO3C 3PXPA 1BD8A 5FZRA 3FH5A 1PRUA 5JHBA 5AYWD 3KAEA 4FA6A 3PS6A 3NZLA 3VTYA 3QF3A 4GTPA 2ZXWE 2ETBA 3QOXA 1CJGA 2XCCA 5ENRD 3CHPA 2QZAA 2ZIRA 4Z5DA 5CBOA 2IU7A 5ENSD 3M9LA 2PXLA 3TWRA 3J5PA 4YARA 2RKKA 3G2UA 1N9AA 4NIKA 1N4PA 3V79K 3PZDA 4I1MA 1E7VA 1SZ9A 2Y0BG 2AWIA 2L1PA 2L0IA 1N0RA 3ZU7B 2J07A 2WXNA 5B1AE 4KZ0A 4GZ5A 1FVFA 4FULA 3FUHA 3D9NA 3MEJA 1LD8A 1SVXA 4HFGA 1RZRA 4ER7A 4XKCA 2WQ6A 2V5FA 3BEEA 4KBQA 5EDSA 4A55A 4ILGA 4WWPA 2X6FA 3DSTA 1RZSA 3TAXA 1GT0C 2VQ2A 4O1PA 4L9PA 2F8XK 1OSLA 3BQOA 2XCJA 3PEVB 4X4BA 4HRNA 3OQMA 3UT7A 3CQGB 2CROA 2LLWA 1IQRA 1DCEA 2NSZA 5EYLA 2YQ8A 3HDXA 2MYOA 2P2CP 4LUNU 2LCVA 4X4DA 4I6JA 2PQRA 1WH6A 2XJ3A 3PZ2A 5ENOD 3L6AA 2OR1L 3SNXA 4ZFHA 2BUGA 3RSEG 3AS8A 4E85A 2IU1A 4PUCA 2V0PA 2WQ7A 3HG0D 3SCGA 3U3WA 5A7LA 3VLDA 2ZISA 2CHWA 5T8IA 1S7EA 3Q9NC 5KJNA 3ASDA 3GN5B 3S7JA 4HI8A 2CHXA 4B89A 5AN8A 5AJDA 4FC8A 3TFLA 5BW8C 1EFAA 1X2LA 3Q9UC 5FQ7A 2QYJA 1H19A 4HBDA 2FULA 2AXZA 2VSYA 5JMND 3QOWA 2EIME 3FULA 3HVEA 4AJWA 2EIJE 2ZU6B 3D9OA 2J7WA 4UQXA 2ODRD 5AQ9A 2NC9A 2R03A 3MKQB 4XKBA 1MYOA 2Y1LE 4F8DA 2MXDA 2HM8A 3ZXPA 4PU7A 1ZZ7A 2E0IA 2DZNA 3ZYMA 5FJYA 3B95A 2LYJA 4KYOB 2XCBA 2I1JA 1S64A 3ULQA 2IOLA 5KNHD 2LYKA 4MKTA 3TWXA 3V2OA 4ANXA 1TEZA 2FO1E 5FINA 4I17A 5CCMA 2GROB 2P9LG 1POUA 3DPDA 4N3AA 1MX2A 4FHKA 5DTMA 3D9PA 3HXEA 2VGXB 3GUUA 4DE8A 1CQTA 1Z3YA 2IV1A 2WXJA 3F6QA 1NI1A 3CHMA 3QNKA 3RO2A 4AP2A 4URKA 1U2ZA 2X38A 3KD7A 1E96B 4B8AA 1NFIE 4J8SA 2P9UG 2LO6A 1ADRA 1FT2A 4F3VA 4KMOA 2PXBA 3UI2A 4I6EA 2PM7A 1WG0A 4DX5D 1IYGA 4K5CA 3CHSA 1BDHA 1KPSB 2IVQA 4KT6B 1N0QA 5A7DB 4RLYA 1SA4A 2L6BA 2XEEA 2XEVA 3FTVA 3ESLA 2MEZA 3I3NA 4HOQA 4JL0A 3AAAC 5ENNA 3QWVA 2J09A 1EPUA 2LLVA 4YG1A 1ZU2A 5CMWA 3UM1A 4FU3A 3VK0A 4X4IA 3RKVA 5LOZA 3IHYA 3NAWA 4CCAA 2HYZA 4UQZA 2B0OE 1IHBA 2KZTA 5CMYA 3B7RL 3G2TA 2ZGDA 2XPIA 1A5EA 2JLBA 5FTPA 4EBAG 1OCOE 4I1AA 5HS0A 1E8WA 3GW4A 3LFPA 1TNUA 3CK7A 1UN9A 3ZYKA 3UQ3A 4G1TA 3N71A 4TXPA 4CRWA 4YVOA 4KVMA 3J5QB 5LP0A 3KSLA 4PS3A 1TJFA 4KVOA 4DK5A 3G2SA 1OT8A 4CDRA 2DBAA 4P29A 5ANRA 1K8KG 4YNDA 5GAHi 4JPSA 3ZNGA 3FUIA 1TNBA 4GAAA 3TG5A 2PXTA 4U95D 2WXLA 4IRUA 3DSXA 4J8YA 3ZHEA 4CDMA 4F6RD 1NL4A 3JXJA 1LF8A 1RZRD 1SW6A 3P1UA 1PNRA 3OXFA 4L2YA 3ZW3A 2P9PG 3JXIA 1DULA 1WM5A 5EILA 2DCPA 4Z68A 1TNZA 3GZ1A 1H0AA 4DJAA 3ZGQA 3DEOA 4GTRA 1NERA 4X4FA 2BJCA 3MV3B 3ZPJA 4GYYA 3PREA 5AJLA 3SGHA 4GU5A 2YHCA 3HZIB 2OVBA 2E2EA 4ER0A 3E4BA 4GZ6A 2PE5A 4I43A 2AJAA 1B0NA 4RQIA 3CROL 3FTYA 4Q2JA 3RRMB 1QPZA 5ARFA 3TL5A 2AVPA 4L2LA 2H6HA 4WAFA 1XWRA 2XGSA 2F0YA 3EIJA 3CQCB 3FH7A 1RIOA 3HYMB 2R1JL 1WIZA 5JA4D 4GZ3A 1R63A 4AY5A 3QFIA 4JCYA 4JEUA 3CVUA 5KWDA 4U0ZA 4DX2A 1KT0A 4BFRA 3WXXA 3GZDC 3FUKA 4LERA 3V2XA 5B3SE 4O1OA 3LPZA 1JCSA 3SBTB 3DSSA 4HLEA 2PXQA 1O1SA 2L9BA 3RJVA 5A23A 1O1TA 4XI0A 4AVXA 1QNFA 5KJKA 4GTQA 4ACKA 4ATGA 3LY7A 3UKRG 3QYXA 2JCGA 4I2WA 1RZ4A 1ZZ9A 3PUKA 3APDA 2XS1A 2RFMA 3EHQA 3MYVA 1TN8A 2VEOA 2V8SE 2L49A 3PZ1A 2MOWA 1ZUGA 2LYSA 2KPJA 4C48B 3C72A 3FTSA 4GTMA 2OEWA 4I9EA 1YYHA 3DSVA 4CZ2D 4B94A 2PPXA 3SHFA 2PXFA 5AQBA 1X5BA 1R69A 5DT2A 1MX4A 1DC2A 1H6OA 4HS2A 3CK9A 4GB9A 1DVPA 2WXRA 5CECB 1YCSB 4TXRA 4OYSA 1U3CA 4D10C 4UQYA 4BT9A 4EBAA 3G2WA 4U8HA 2HCSA 3OWQA 3SCFA 1LD7A 4OAVB 2KEKA
chains in the Genus database with same CATH topology
4FBIA 3MEKA 2LYPA 4GA2A 3EUSA 2UY1B 4JC8A 4LUNU 3KS2A 1QP7A 2LCVA 3F51A 4X4DA 3LJ3A 3Q15A 3RO3A 2VTBA 1ZS4A 1HG5A 4I6JA 4N2QA 3LCAA 4GCNA 4CGVA 2EF8A 3JQ0A 4LRZA 2PQRA 5EX3A 3FY4A 2M63A 3KZ3A 1ZZBA 1WH6A 3FUJA 2CG2A 4NQ0A 5T3RA 2XJ3A 4GA1A 2ICPA 3EIQC 3L6AA 2OR1L 1UJKA 3SNXA 1UXCA 2BUGA 5FT9A 3AS8A 4E85A 4GU5A 3UX4A 1ELKA 4I8TA 1H2TC 3PDNA 4J8DA 3CSTA 2IU1A 4JCXA 3LDZA 1B89A 3LVRE 4FP7A 4PUCA 1INZA 3NQPA 3EDTB 1SQ8A 2V0PA 3CVVA 2WQ7A 3TG4A 1DNPA 1JFTA 1OCTC 3BG1B 3SCGA 3EHMA 3U3WA 1PAQA 2R5SA 1NA3A 5A7LA 2CFZA 3IVPA 3G7DA 3URZA 4AOFA 3OAWA 2C0LA 2CFUA 2ONDA 4Q94A 4F53A 1Y7YA 2GZUA 5G55A 2IVGA 2WUSR 2FBNA 3QDNA 3AS4A 4BT8A 5CCLA 3CVWA 3I4GA 3VLDA 5CHEE 5FZSA 2OOEA 4DI3A 1KT1A 4J8EA 3O9XA 2CHWA 2WXQA 1S7EA 4LCTA 5T8IA 4JA9A 4BTAA 4Y42A 4X4GA 1UTXA 1LCDA 1WY6A 3ASDA 5KJNA 3JXBC 3H5TA 4GQMA 1NA0A 4C0EA 1RPEL 3GN5B 3S7JA 1E90A 2CHXA 3FDHA 3NZUA 4U0SA 2LSVA 4EZLA 1VPWA 2P58C 3O48A 3QKYA 4G2VA 4B89A 3T5VA 3QAQA 3ZYQA 1EYHA 4I1OB 2QFCA 5AJDA 4FC8A 2VSOE 3RU0A 5BW8C 5HI7A 4B0ZA 1EFAA 3IKOB 4Z5HA 3QWGA 1X2LA 5FQ7A 2WIUB 3PVLA 3NF1A 1HE8A 5C1DA 2WXIA 3L13A 3L17A 4UI9K 4H7YA 1H19A 3G2VA 3FUFA 4N3BA 4RG6A 2VSNA 2FULA 4HOTA 2AXZA 2VSYA 3EJNA 3PEUB 4B8CB 3KJXA 2WMNA 3LKUA 3AS5A 3FULA 3HVEA 5E76A 1ZVVA 3CR3A 1PRVA 3EHNA 4AJWA 2ZU6B 3ZXSA 3D9OA 3Q5MA 2R59A 1QP0A 3FUNA 4UQXA 2B5AA 3FTWA 4JHKA 2NC9A 3BD1A 1HXIA 1S0PA 3MKQB 4XKBA 3ASGA 3CVYA 2KCVA 4F8DA 3CVNA 3FUMA 4N3CA 2HM8A 4ILIA 5JHAA 4PU7A 2KZTB 1ZZ7A 1Z6TA 2E0IA 2YNQA 4R7LA 3CVPA 3ZYMA 5FJYA 4PU8A 5AIJA 2XIUA 3T8MA 4ACLA 2LYJA 4KYOB 3FUDA 2XCBA 1E3OC 2I1JA 3OTNA 3FMYA 2IOLA 3RRUA 3ULQA 4NDWA 1ZZ6A 3ZFWA 4RSYA 3SZ7A 2LYKA 1IHGA 4MKTA 3JXDL 4ANWA 3VLEA 1UG3A 2PUBA 4V3IA 1ZAYA 4UWFA 2I9CA 4ANXA 1TEZA 4Z58A 5BT1A 4I17A 4HORA 3CHOA 3HIZA 1HX8A 3D9IA 2VYIA 3CKBA 4AIFA 2KEJA 3ZRHA 4MCXA 2LYQA 4G11A 5DBKA 4L23A 4AM9A 5CCMA 2LAIA 1POUA 2HR2A 2PQNA 3DPDA 1HU3A 4N3AA 1QZ2A 2PUAA 4FHKA 4IVZA 3R7RA 3UFDA 3ZYLA 4NACA 2X6JA 4FHJA 4E6HA 3D9PA 3HHMA 4KXKB 2VSXE 3L08A 2WM9A 3D9MA 4PU4C 2UY1A 4YG7B 3SCHA 2VGXB 2BTDA 3FU3A 4A3TA 1CQTA 3PUJA 1Z3YA 1AU7A 2IV1A 3RK6A 1QP4A 2DIWA 4GZDA 4I6UA 2HO1A 4NRHB 2WXJA 1JWFA 3VTXA 2R63A 5ARGA 4CGWA 4EZKA 3CHMA 1JUQA 1VDYA 1WAO1 3FEYA 3R1FA 3ONKA 3QNKA 3RO2A 5G04C 3FHEA 4MCTA 4AP2A 4URKA 4IYPA 1NEQA 4GHJA 2X38A 2WVIA 3CK8A 3KD7A 1E96B 2WPVA 4UWHA 3ZHEB 4U0UA 4B8AA 3UUXA 3LY8A 4PDXA 4J8SA 2BF0X 3QJZA 3BG0B 3FU0A 3JUIA 4U63A 2LO6A 4YBAA 5G05C 1ADRA 5HQ8A 2XSDC 4I6GA 3OQNA 3ZHMA 3BDNA 4F3VA 5K98B 3CLCA 3U66A 1H2VC 4KMOA 5E75A 3JXCL 2WXFA 3CIAA 4I6EA 1Z3XA 3B7TA 4EECA 4N2SA 2PM7A 2LYRA 3B7HA 1A17A 1H2UA 3CHRA 5D0QD 1IYGA 3CHSA 4HXIA 1BDHA 5G05J 2IVQA 4K03A 3APCA 4KT6B 1LQCA 5A7DB 2X3MA 3QWWA 1O4XA 4A1GA 3GN5A 2OV8A 4C0MA 1BPOA 2XEVA 1WETA 2PUDA 3FTVA 4ANVA 4CDNA 3GYZA 3ESLA 4N39A 2Q7FA 4HVBA 3F52A 4XZ4A 2MEZA 2XHEA 3S2AA 3I3NA 3U64A 4HOQA 3MJWA 4M3OA 4PS8A 4JL0A 3CLJA 4X4CA 1U3DA 4Q96A 3QWVA 5ENNA 3CKCA 3L1PA 2J09A 4PS7A 1EPUA 1OUVA 4TUUA 4AEZC 5J90A 4YG1A 1ZU2A 4IA8A 3FH8A 3ONLA 3QC1A 4PH4B 2BNMA 2PUEA 5CMWA 3QOUA 1JFSA 1N54A 4FU3A 1X57A 3VK0A 4X4IA 3APFA 1DW9A 1E8YA 2J4BA 2WXGA 3MKRA 3RKVA 2KATA 4CT0A 2GW1A 4DLOA 3PNLB 3MLFA 5LOZA 3R7QA 4Y6WA 3IHYA 1UXDA 4NURA 3SFZA 4CCAA 3PE4A 2XGMA 4BTBA 2Y3AA 5EX0A 2EBYA 2HYZA 3T5XA 3MKQA 4BY6A 2WB2A 2FJRA 3FWVA 3MCXA 4UQZA 3GBFA 2V4LA 2X6HA 2AW6A 4AY6A 2KCLA 2KZTA 5CMYA 1OWOA 3FU6A 3B7RL 3G2TA 2I6HA 2IVBA 3R9AB 2XPIA 4G23A 4L1BA 3ZVVA 3CECA 1E8ZA 3LEWA 5EKQD 3ASHA 2JLBA 3DBSA 3F6WA 3MV2B 5FTPA 4EQFA 2IOSA 4EBAG 3OP9A 3ML9A 1E7UA 1QQEA 4I1AA 1E8WA 1OWLA 3FUEA 3CHQA 5JJ6A 3GW4A 3LFPA 1OWMA 1PC2A 4CEMA 1HO8A 3CK7A 1UN9A 1HF8A 2LSUA 3ZYKA 3I4RB 4GA0A 1ZPQA 4JEHA 4FJZA 4UI9C 3UQ3A 2RD0A 3LS8A 4G1TA 3N71A 4OVUA 3SD5A 3VLFA 4CRWA 3U9WA 4J0UA 1HS6A 1PERL 4YVOA 5T4YA 5M72A 4FADA 4J8FA 2WQHA 4KVMA 4APOA 5KJMA 4TRQA 2IJGX 3LISA 2FI7A 2PL2A 5KJLA 2IF4A 3ZN3A 4CT4A 5LP0A 3FFLA 3RZZA 1TJFA 4PS3A 2CSFA 3TRBA 3G2SA 3CV0A 4KVOA 4UI9J 1UW4B 4K0RA 4DK5A 3D9KA 5ANLA 3KXAA 4AXHA 2GRMA 1ZBPA 2H8RA 4A1SA 4TV3A 4CDRA 1HFAA 2DBAA 2O38A 4P29A 3QWPA 2VGXA 5ANRA 5AENA 5JJTA 1PRAA 1LMB3 3GZSA 3D9LA 4H7XA 1GW6A 2I2OA 4JPSA 4WNDA 4YNDA 4I6RA 3ASFA 5A6CA 5FQ6A 2WXOA 3FUIA 4GAAA 4UWGA 2A4ZA 3IEGA 4N5CA 1HF0A 3TG5A 3L16A 5LCWC 2ILRA 2WXLA 1JH9A 2WXKA 1YA0A 2XRYA 4G24A 3S7FA 4J6IA 4X4EA 5FQ4A 3OXGA 4IRUA 3TGOA 2NXPA 4GYOA 4JHJA 3ZHEA 1WH8A 4JHRA 4CDMA 3B7UX 1IC8A 5G2NA 3MX3A 3S7DA 2R17C 3FTUA 4BX8A 4L7TA 4GCOA 1YSEA 4JQDA 4LEUA 5LCWJ 1LCCA 1LF8A 3LYAA 2OVFA 2LYLA 3DNVB 3I5PA 1RZRD 2WMOA 5BUZA 4BSXA 5BV0A 3CSFA 5J08A 2PUGA 3P1UA 2J9QA 3Q47B 1L1MA 4IULA 1PNRA 3OXFA 4U04A 4APFA 1FVHA 2LAHA 4L2YA 4GYWA 4JW1A 5FWQA 3ZW3A 3RRNB 4WWOA 2PUCA 2WXPA 2L0TB 4F7AA 1FCHA 1LLIA 3TXMA 2J08A 1WM5A 3BS3A 2DCPA 2WXHA 2PM6A 4ME2A 4DLQA 1JWLA 4RVBA 3ZIMA 2A5UA 4UWLA 3O4ZA 3GZ1A 3QARA 1H0AA 5G04J 4DJAA 3ZKCA 3AU5A 4FLBA 3CVLA 3UT8A 3ZGQA 5BV1A 2RG8A 2YINA 5LFAA 4O6FA 3TJPA 1ZZ8A 1NERA 4X4FA 2LNIA 2BJCA 2MQKA 4GMJA 3MV3B 4XIFA 2OFYA 2I1KA 1P5QA 3ZEFA 2IONA 3ZPJA 4GYYA 3PREA 4OVVA 3ESKA 5AJLA 3SGHA 5BNWA 4BWRA 2VGYA 2XRZA 2X6IA 3MGBA 3QQ6A 2YHCA 3HZIB 1NP7A 1UJJA 2OVBA 2XPYA 2E2EA 1Y9QA 2FO7A 4G25A 2BNOA 3E4BA 4FJYA 4GZ6A 2PE5A 4I43A 4XE0A 2L8NA 4I9CA 3KEZA 1B0NA 2KEIA 3K9IA 3MA5A 1PY1A 3UMVA 4JA7A 3OXLA 4PU3C 3D3MA 3CROL 2KZ8A 3L22A 1Y8MA 3FYMA 4I2ZA 4XI9A 1W3BA 5JJ7A 2KM4A 1H6KA 3LY9A 3C98A 2PUFA 3FTYA 3RRMB 4ANUA 1QPZA 4EPZA 5ARFA 3TL5A 3OMTA 3L54A 3UPVA 1IQUA 3SI5A 2AXUA 2AVPA 4L2LA 4BX9A 1HZ4A 4EZJA 2VTBB 4GPKA 4WAFA 1XWRA 2XGSA 4Z59A 3LXUX 3B7SA 1N52A 3LVQE 4I6TA 3EIJA 3CQCB 4QFVA 4ABNA 2O49A 3FH7A 3QK0A 1RIOA 1ELWA 2KC7A 1SQMA 3HYMB 4A3VA 2EWTA 2R1JL 1WIZA 5BPPA 2X6KA 4GZ3A 1R63A 4OB4A 1QQAA 3GZ2A 4MRUA 5D0OD 2Y4TA 3JYSA 3MZLB 4MLPA 4WNGA 2CHZA 4AY5A 3FP3A 4JXTA 5KCMA 4JCYA 4JZYA 3FYAA 2FF4A 4JEUA 3CVUA 4GMLA 3PXPA 1EF1C 4U0ZA 2MHKA 4Q69A 1EDUA 1UN8A 5FZRA 4WUYA 1L5JA 1KT0A 1OWPA 1XNFA 3FH5A 3WXXA 3FUKA 4LERA 1PRUA 1XGWA 1JPLA 4BFRA 4U07A 5JHBA 1ELRA 3IV0A 4HOUA 3ZHIA 3KAEA 5AYWD 4O8BA 4FA6A 3PS6A 3VTYA 3LPZA 3QF3A 3ML8A 3CVXA 3SBTB 4HLEA 2AUWA 4G26A 1CJGA 2XCCA 2L9BA 3G5GA 3B13A 3RJVA 2XGOA 4XX5A 3CHPA 5A23A 3NZSA 4Z5DA 3U4TA 2XI8A 4IWRA 2IU7A 2J49A 3FTXA 2WXMA 1MQSA 3CVQA 2FEZA 4XI0A 4AVXA 4YARA 1QNFA 5KJKA 5C2YA 4ACKA 3ENEA 1SZAA 3G2UA 4ATGA 2IQCA 3CGHA 3LY7A 3QYXA 3IBEA 3PZDA 4I1MA 2JCGA 4I2WA 5DIZA 1ZZ9A 3PUKA 2HSGA 1E7VA 1SZ9A 4WNFA 2AWIA 2YHEA 3APDA 2L0IA 2PIJA 3CEQA 3OQOA 2QY7A 3P2BA 1OWNA 1KLXA 1BDIA 2IFUA 3FU5A 3MYVA 2J07A 1E8XA 2C2LA 2A6CA 3RIBA 4F1SA 2WXNA 4ILHB 2JVLA 2AXVA 2V8SE 2L49A 3PE3A 4KZ0A 1HH8A 4GZ5A 1MHQA 4KZCA 1FVFA 3HVEB 3IHVA 4J1XA 5LX8A 2CG3A 2MOWA 4FULA 2XPZA 1ZUGA 3FUHA 2LYSA 4YG4A 2O4AA 2KPJA 1NZNA 2KCKA 3D9NA 2BNNA 2HINA 3JQ1A 4FLHA 2GRLA 3D9JA 3SBSA 4HFGA 1ZZCA 1RZRA 4W9RA 4DPRA 4FN3A 3AU4A 2L6JA 4UWKA 3JCKC 2IUOA 4RG9A 4XKCA 1Y6IA 2Y4UA 2WQ6A 1JWGA 2V5FA 3BEEA 4KBQA 1DWKA 5EDSA 4JVSA 4J1WA 4YVQC 3FTSA 4I9EA 4WWNA 1HG2A 3PRZA 5FZQA 4A55A 4ILGA 2D5VA 4WWPA 3PNTB 4B94A 2PZIA 2MRIA 2PPXA 3QB2A 4GZCA 3SHFA 2X6FA 1RZSA 3TAXA 1GT0C 1X5BA 2VQ2A 1R69A 1QQBA 2VJ8A 3Q49B 3PH0C 4DI4A 4MS6A 5FQ8A 2ICTA 2J4DA 1OSLA 3CK9A 3FEXA 2C0MA 3S8QA 4GB9A 1DVPA 4HS2A 2XCJA 2WXRA 3SF4A 3PEVB 4X4BA 1TJCA 2XQ0A 3FTZA 3TXNA 3Q4AB 3OQMA 4C9BB 3UT7A 4WNEA 3CQGB 2CROA 4OYSA 1U3CA 4D10C 4AV7A 4UQYA 1IQRA 4IN3B 4Y6CA 2GGFA 3UT4A 4HOSA 3D1NI 2JEKA 2UWJG 2NSZA 4BT9A 3G2WA 4EBAA 4U8HA 4Z5CA 2EQXA 2YQ8A 3SCFA 3HDXA 3S7BA 4X4HA 2KEKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FBI A;  1POU A;  2LYP A;  1ZPQ A;  3EUS A;  4I6T A;  2O49 A;  1RIO A;  1QP7 A;  2PUA A;  2EWT A;  2R1J L;  1WIZ A;  2LCV A;  3F51 A;  4X4D A;  1R63 A;  4OB4 A;  4IVZ A;  1ZS4 A;  3UFD A;  1QQA A;  1PER L;  2EF8 A;  4JCY A;  3FYA A;  4PU4 C;  4YG7 B;  3LIS A;  3KZ3 A;  3PXP A;  1ZZB A;  1WH6 A;  3SCH A;  1CQT A;  2XJ3 A;  2ICP A;  1AU7 A;  2IV1 A;  3RZZ A;  1QP4 A;  2CSF A;  3TRB A;  4I6U A;  2OR1 L;  1UXC A;  1PRU A;  3KXA A;  2GRM A;  2R63 A;  2H8R A;  3R1F A;  3ZHI A;  2O38 A;  4O8B A;  4I8T A;  4MCT A;  1PRA A;  3QF3 A;  1LMB 3;  4JCX A;  1NEQ A;  2AUW A;  4GHJ A;  4I6R A;  1CJG A;  1SQ8 A;  3G5G A;  1JFT A;  1HF0 A;  1OCT C;  3SCG A;  4Z5D A;  3U3W A;  2XI8 A;  4IWR A;  2IU7 A;  5A7L A;  3IVP A;  3G7D A;  1JH9 A;  4X4E A;  1Y7Y A;  2GZU A;  2IVG A;  2WUS R;  4YBA A;  4YAR A;  1ADR A;  2XSD C;  3OQN A;  1WH8 A;  3ZHM A;  3BDN A;  5K98 B;  3QYX A;  3O9X A;  1IC8 A;  3CLC A;  1S7E A;  2JCG A;  4Y42 A;  1ZZ9 A;  1UTX A;  4X4G A;  2HSG A;  1LCD A;  3JXC L;  3JXB C;  3H5T A;  2AWI A;  1YSE A;  4GQM A;  4JQD A;  1LCC A;  1RPE L;  2PIJ A;  3GN5 B;  3OQO A;  2LYL A;  3DNV B;  2LYR A;  3B7H A;  1RZR D;  1VPW A;  1BDI A;  2A6C A;  1BDH A;  2PUG A;  2IVQ A;  2JVL A;  2AXV A;  1L1M A;  1PNR A;  1LQC A;  2L49 A;  1EFA A;  4Z5H A;  1O4X A;  3QWG A;  4J1X A;  1X2L A;  3GN5 A;  2WIU B;  2PUC A;  1WET A;  2PUD A;  1ZUG A;  1LLI A;  2LYS A;  4YG4 A;  2O4A A;  2KPJ A;  3BS3 A;  2BNN A;  2HIN A;  2MEZ A;  3F52 A;  2AXZ A;  2GRL A;  1ZZC A;  1RZR A;  1JWL A;  3KJX A;  4X4C A;  4FN3 A;  3L1P A;  3ZKC A;  1PRV A;  1ZVV A;  2IUO A;  4YG1 A;  4IA8 A;  2BNM A;  1QP0 A;  2PUE A;  2B5A A;  1JFS A;  1DWK A;  1X57 A;  1ZZ8 A;  1NER A;  4X4F A;  3BD1 A;  3VK0 A;  4X4H A;  2MQK A;  4J1W A;  4X4I A;  2BJC A;  2OFY A;  1DW9 A;  3MLF A;  2D5V A;  4F8D A;  3QQ6 A;  3HZI B;  1UXD A;  2PPX A;  4PU7 A;  1Y9Q A;  2BNO A;  1RZS A;  1ZZ7 A;  1GT0 C;  2EBY A;  2PE5 A;  1R69 A;  2L8N A;  1QQB A;  2FJR A;  4PU8 A;  2XIU A;  1B0N A;  3GBF A;  2LYJ A;  2KEI A;  2ICT A;  1OSL A;  1E3O C;  3S8Q A;  2AW6 A;  4PU3 C;  3FMY A;  2XCJ A;  2KZ8 A;  3CRO L;  4NDW A;  1ZZ6 A;  4X4B A;  3FYM A;  2IVB A;  3OQM A;  2LYK A;  3JXD L;  2CRO A;  3CEC A;  2PUB A;  3F6W A;  1ZAY A;  2PUF A;  1QPZ A;  3OP9 A;  4Z58 A;  3D1N I;  3OMT A;  4Z5C A;  2AXU A;  2KEJ A;  3LFP A;  2LYQ A;  4MCX A;  3SCF A;  1XWR A;  2KEK A;  4Z59 A; 
#chains in the Genus database with same CATH topology
 3MEK A;  3EUS A;  3RO3 A;  4N2Q A;  2VTB A;  1HG5 A;  4LG6 A;  4CGV A;  3BU8 A;  2M63 A;  1ZZB A;  5T3R A;  3EIQ C;  2YBD A;  1UJK A;  5FT9 A;  3UX4 A;  1ELK A;  3TXM A;  4J8D A;  4FP7 A;  1B89 A;  3EHR A;  3NQP A;  3EDT B;  3TWS A;  3TG4 A;  1DNP A;  3BG1 B;  3SO8 A;  3EU5 A;  3OAW A;  2OND A;  4F53 A;  5CCL A;  2GZU A;  1N4S A;  5CHE E;  5FZS A;  1KT1 A;  3DEP A;  4LCT A;  4JA9 A;  4Y42 A;  4X4G A;  1UTX A;  1LCD A;  1WY6 A;  3JXB C;  4EZL A;  2LSV A;  3O48 A;  4G2V A;  3T5V A;  4K5B A;  1EYH A;  2VSO E;  3C3R A;  4B0Z A;  3IKO B;  1HE8 A;  5C1D A;  2WXI A;  3L17 A;  3FUF A;  1H6P A;  4RG6 A;  2VSN A;  5DRY A;  3LKU A;  3AS5 A;  1PRV A;  3EHN A;  4MBG A;  2B5A A;  3FTW A;  4JHK A;  3T8K A;  3CVN A;  3FUM A;  4N3C A;  1YMP A;  1Z6T A;  4BEP A;  5AIJ A;  3T8M A;  4ACL A;  1E3O C;  1QZX A;  4RSY A;  1IHG A;  3JXD L;  5KBA A;  2XS8 A;  1UG3 A;  4ATZ D;  2I9C A;  3DWL G;  1N95 A;  2VYI A;  4AIF A;  4G11 A;  5DBK A;  5DSX A;  1HU3 A;  2PUA A;  3PZ4 A;  4EQZ A;  4FHJ A;  3HHM A;  1AWC B;  2R02 A;  3L08 A;  3D9M A;  4PU4 C;  2UY1 A;  3SCH A;  2EIK E;  3FU3 A;  4A3T A;  3PUJ A;  2DIW A;  4BES A;  3ABM E;  2R63 A;  5ARG A;  4EZK A;  1QBQ A;  2WVI A;  3CK8 A;  2WPV A;  2BF0 X;  5HQ8 A;  3ULE G;  2XSD C;  3ZHM A;  5K98 B;  3CLC A;  4YDO A;  1H2V C;  5E75 A;  3JXC L;  2BED A;  3CIA A;  4LNU D;  4X8Q A;  2LYR A;  3B7H A;  1H2U A;  4HXI A;  3VWS A;  4K03 A;  3QWW A;  1O4X A;  3E33 A;  4HB5 A;  1TNY A;  1BPO A;  1IXV A;  4ANV A;  3GYZ A;  2Q7F A;  3U64 A;  2XHE A;  4BSZ B;  4X4C A;  3L9T A;  4TUU A;  3L1P A;  1OCC E;  4PS7 A;  3ONL A;  3QC1 A;  3TWV A;  3NOC D;  3QOU A;  1X57 A;  3APF A;  1DW9 A;  2J4B A;  2KAT A;  2GW1 A;  4DLO A;  1UOH A;  3R7Q A;  1UXD A;  4NUR A;  3PE4 A;  2RFA A;  4BTB A;  4HLL A;  2A5E A;  2FJR A;  3FWV A;  3DXM G;  4EKI A;  3FU6 A;  1SA5 A;  2XZD G;  4L1B A;  5EKQ D;  3LEW A;  2F37 A;  2JAB A;  3DBS A;  3MV2 B;  3F6W A;  4DX6 D;  1S70 B;  4DRX E;  3FUE A;  1HF8 A;  3I4R B;  4GA0 A;  4JEH A;  2RD0 A;  3LS8 A;  3SD5 A;  4J0U A;  1HS6 A;  4FAD A;  4U8V D;  5AQ7 A;  5KJM A;  2IJG X;  3LIS A;  2H6G A;  2VGE A;  3ZN3 A;  3E32 A;  3FFL A;  1X81 A;  3EUV A;  2CSF A;  3TRB A;  4UI9 J;  3D9K A;  4AXH A;  1ZBP A;  4TV3 A;  1HFA A;  2O38 A;  5AEN A;  1LMB 3;  4WND A;  5CBN A;  5A6C A;  2V4H C;  1O1R A;  1HF0 A;  1JCQ A;  3L16 A;  3SFX A;  3AG3 E;  2ILR A;  3GZD A;  4G24 A;  2XRY A;  4X4E A;  3TGO A;  1K3Z D;  1G3N B;  4JHR A;  1IC8 A;  1V54 E;  2R17 C;  3FTU A;  4BX8 A;  4GCO A;  3KEA A;  3TWQ A;  4LEU A;  3DNV B;  2WMO A;  3ASN E;  4BSX A;  2PUG A;  3Q47 B;  4ER6 A;  2LAH A;  1ZB1 A;  2PUC A;  4EK9 A;  3R09 A;  1LLI A;  3BS3 A;  1JCR A;  4ME2 A;  3ZIM A;  2A5U A;  4UWL A;  3O4Z A;  3V31 A;  2RG8 A;  2YIN A;  3TJP A;  4EZI A;  3ESK A;  2BKK B;  3MGB A;  1NP7 A;  4UUC A;  1Y9Q A;  1NW3 A;  2KEI A;  1U2V G;  3K9I A;  3MA5 A;  4JA7 A;  3OXL A;  3D3M A;  5D2M C;  2KZ8 A;  3FYM A;  4I2Z A;  4B93 B;  3DM5 A;  4EPZ A;  1AP7 A;  4K5A B;  3OMT A;  4BX9 A;  3JUE A;  3B7S A;  1N52 A;  4QQI A;  4I6T A;  2KC7 A;  3EU9 A;  4OB4 A;  4MRU A;  3MZL B;  4MLP A;  2CHZ A;  3Q78 A;  5AAR A;  5AAO A;  1EF1 C;  3TWT A;  2MHK A;  1UN8 A;  1KZP A;  1XNF A;  1OWP A;  1XGW A;  1JPL A;  4U07 A;  1ELR A;  4HOU A;  3ZHI A;  4O8B A;  4G26 A;  3G5G A;  3SFY A;  3ME5 A;  2M4H A;  3NZS A;  3UWP A;  4IWR A;  3FTX A;  3ENE A;  1SZA A;  4A63 B;  3G0T A;  3IBE A;  4EHM A;  2GRP B;  4WNF A;  2YHE A;  3P2B A;  1OWN A;  5CEA A;  3RIB A;  2C2L A;  2A6C A;  4ILH B;  3PE3 A;  1HH8 A;  1MHQ A;  4KZC A;  3HVE B;  4LNB A;  2O4A A;  4FLH A;  3JQ1 A;  2BNN A;  2HIN A;  2GRL A;  1ZZC A;  4DPR A;  2DYS E;  2L6J A;  4UWK A;  3JCK C;  2IUO A;  1Y6I A;  2LNM A;  1Q2Z A;  3UIN C;  5DRT A;  4WWN A;  1HG2 A;  3PRZ A;  3ULY A;  2D5V A;  3DRA A;  3AG2 E;  4GZC A;  4DI4 A;  5FQ8 A;  3E34 A;  3ZKJ A;  2J4D A;  1BU9 A;  3S8Q A;  1TJC A;  2XQ0 A;  3FTZ A;  3DSW A;  4WNE A;  3UIP C;  4Y6C A;  3UT4 A;  3D1N I;  1BI8 B;  4Z5C A;  1TR4 A;  2EQX A;  2XXP A;  4FBI A;  2LYP A;  4JC8 A;  3KS2 A;  1QP7 A;  3F51 A;  3Q15 A;  1ZS4 A;  5DTQ A;  2OEV A;  4GCN A;  3JQ0 A;  4LRZ A;  2FFH A;  4NQ0 A;  2CG2 A;  5ITZ F;  4BET A;  1QYM A;  3UXG A;  4HQD A;  1UXC A;  3W9G A;  2HCN A;  3NRO A;  4I8T A;  3PDN A;  3LVR E;  4JCX A;  5BXO A;  2J7U A;  2PNN A;  1OCT C;  3EHM A;  1HQ1 A;  1NA3 A;  5ENT D;  3IVP A;  3URZ A;  2CFU A;  1Y7Y A;  4BT8 A;  2WUS R;  2FBN A;  3QDN A;  3AS4 A;  3CVW A;  3I4G A;  1FPP A;  2P9S G;  1NA0 A;  3H5T A;  4C0E A;  3FDH A;  3NZU A;  4U0S A;  3C3O A;  3TEL A;  2P58 C;  3LQX A;  3QAQ A;  3B7B A;  4I1O B;  2DYR E;  4Z5H A;  2WIU B;  3PVL A;  3NF1 A;  4TUM A;  3L13 A;  3PEU B;  4B8C B;  2WMN A;  3ZXS A;  2R59 A;  1QP0 A;  3BD1 A;  3ASG A;  5CED B;  2H6I A;  5JHA A;  5BXU A;  2KZT B;  2YNQ A;  5GAG i;  4PU8 A;  1BLX B;  2BKG A;  2XIU A;  4BER A;  3FUD A;  3OTN A;  3FMY A;  4NDW A;  1ZZ6 A;  3ZFW A;  3SZ7 A;  1Z5S C;  2PUB A;  2P9N G;  4V3I A;  4HOR A;  4DX7 D;  3CHO A;  1HX8 A;  3D9I A;  3CKB A;  3ZRH A;  2LYQ A;  4L23 A;  2PQN A;  1QZ2 A;  3SX0 A;  4IVZ A;  3R7R A;  4NAC A;  2X6J A;  2HFZ A;  4E6H A;  1MJ0 A;  2WM9 A;  4YG7 B;  2BTD A;  1AU7 A;  3RK6 A;  3VTX A;  4CGW A;  5EID A;  1VDY A;  3R1F A;  1D9S A;  3FHE A;  4MCT A;  3OKZ A;  3ZHE B;  4U0U A;  2NYJ A;  4HI9 A;  3LY8 A;  4PDX A;  3UUX A;  3WG7 E;  3BG0 B;  3BUA A;  3FU0 A;  3JUI A;  4DE9 A;  4I6G A;  4N5Q A;  1TNO A;  2KXP C;  2WXF A;  2JQE A;  1Z3X A;  3B7T A;  4N2S A;  4GTO A;  5D0Q D;  3CHR A;  4GTT A;  5G05 J;  4U96 D;  2X3M A;  5B1B E;  4A1G A;  3GN5 A;  2OV8 A;  2QYU A;  4C0M A;  1WET A;  2PUD A;  4CDN A;  4N39 A;  4HVB A;  3A9Z A;  3F52 A;  3ZYL A;  4PS8 A;  4Q96 A;  1OUV A;  4AEZ C;  5J90 A;  2ETC A;  1D8E A;  2BNM A;  2PUE A;  1N54 A;  4F1P A;  2WXG A;  3MKR A;  4CT0 A;  3LJN A;  3PNL B;  3MLF A;  1QB2 A;  2ETA A;  3NB2 A;  2Y3A A;  2EBY A;  3T5X A;  3MKQ A;  4BY6 A;  4XEI G;  4EKG A;  2V4L A;  5CRV A;  2KCL A;  2PXV A;  3DPY A;  3R9A B;  3ZVV A;  3ZUV B;  2IOS A;  3OP9 A;  1QQE A;  1OWL A;  2V3C C;  1PC2 A;  2XEN A;  2LSU A;  5IY5 E;  4UI9 C;  1K1B A;  1OCZ E;  4OVU A;  3VLF A;  4HRA A;  3U9W A;  5T4Y A;  2WQH A;  2FI7 A;  2PL2 A;  5KJL A;  2Y69 E;  4YDY A;  3CV0 A;  1UW4 B;  2IY0 C;  5H7P A;  3KXA A;  2H8R A;  3CVY A;  3QWP A;  2VGX A;  2I2O A;  2PXD A;  3UM0 A;  5HRY A;  5FQ6 A;  2A4Z A;  4N5C A;  2P9K G;  1JH9 A;  1YA0 A;  4J6I A;  5FQ4 A;  5D66 A;  2NXP A;  4JHJ A;  1WH8 A;  5G2N A;  3MX3 A;  4L7T A;  2B6C A;  5KNG A;  4JQD A;  5LCW J;  1LCC A;  3LYA A;  5J08 A;  1L1M A;  4IUL A;  4U04 A;  1FVH A;  4GYW A;  3RRN B;  4WWO A;  4DUI A;  4F7A A;  1FCH A;  2J08 A;  2LXM A;  2WXH A;  2PM6 A;  4RVB A;  4OBM A;  3ZKC A;  3AU5 A;  3UT8 A;  3CVL A;  5CER B;  3R9M A;  2F8Y A;  5LFA A;  2LXL A;  1ZZ8 A;  2LNI A;  3Q73 A;  2MQK A;  4XIF A;  2I1K A;  3ZEF A;  4ER3 A;  2ION A;  3TWW A;  2VGY A;  4BWR A;  2X6I A;  3NBN B;  4GTS A;  3QQ6 A;  4HOS A;  2XPY A;  2FO7 A;  2BNO A;  4U7E B;  3PE5 A;  4FJY A;  3Q79 A;  4XE0 A;  3UM2 A;  3KEZ A;  2J8S D;  2XZT G;  3UMV A;  1PY1 A;  4U8Y D;  4PU3 C;  3L22 A;  1Y8M A;  1TN6 A;  5JJ7 A;  1K1A A;  3C98 A;  2PUF A;  4ANU A;  3UPV A;  3L54 A;  1S63 A;  2VTB B;  4EZJ A;  1HZ4 A;  4GPK A;  4ER5 A;  1N11 A;  4ABN A;  2O49 A;  3QK0 A;  1ELW A;  5BPP A;  2EWT A;  1LTX A;  5D0O D;  2QC9 A;  1OY3 D;  4WNG A;  3FP3 A;  4GPM A;  5KCM A;  5ENP D;  3FYA A;  2FF4 A;  3HXD A;  4GML A;  3TWU A;  4Q69 A;  1EDU A;  4OAU C;  4WUY A;  1L5J A;  2LUH A;  3IV0 A;  3ML8 A;  3CVX A;  2AUW A;  3B13 A;  3L82 A;  1MFQ C;  2XGO A;  4XX5 A;  3HXC A;  3U4T A;  2XI8 A;  1OXJ A;  2J49 A;  2WXM A;  1MQS A;  3CVQ A;  2FEZ A;  5C2Y A;  2IQC A;  3CGH A;  4HRL A;  3PZ3 A;  1RW2 A;  5DIZ A;  2HSG A;  2PIJ A;  3CEQ A;  3OQO A;  2QY7 A;  1KLX A;  1BDI A;  2IFU A;  3FU5 A;  1E8X A;  4F1S A;  2AXV A;  2JVL A;  3UKU G;  5LX8 A;  3IHV A;  4J1X A;  4TXQ A;  2CG3 A;  4O60 A;  2XPZ A;  1DCQ A;  4YG4 A;  1NZN A;  2KCK A;  2V5Q C;  3D9J A;  3SBS A;  4W9R A;  1O5M A;  4FN3 A;  3AU4 A;  5CRU A;  5JUW A;  4RG9 A;  2Y4U A;  1JWG A;  1DWK A;  4JVS A;  4J1W A;  4YVQ C;  3E37 A;  4YDE A;  5FZQ A;  3PNT B;  2PZI A;  2MRI A;  3QB2 A;  3AG4 E;  1QQB A;  2VJ8 A;  3Q49 B;  3UM3 A;  3PH0 C;  4MS6 A;  3T9K A;  2ICT A;  2IO2 C;  3FEX A;  2C0M A;  2EIN E;  3SF4 A;  3TXN A;  3Q4A B;  4C9B B;  2H6F A;  4AV7 A;  4IN3 B;  3RAU A;  2GGF A;  3IXE A;  2JEK A;  2UWJ G;  3S7B A;  4X4H A;  3C5R A;  3HXB A;  4GA2 A;  2UY1 B;  3LJ3 A;  3LCA A;  2EF8 A;  5EX3 A;  3FY4 A;  3KZ3 A;  3FUJ A;  3Q7F A;  4GA1 A;  2ICP A;  3A9X A;  1H2T C;  3CST A;  3LDZ A;  1INZ A;  2IEJ A;  3CVV A;  1SQ8 A;  1JFT A;  1PAQ A;  2R5S A;  1BI7 B;  2CFZ A;  3UTM A;  4AOF A;  3G7D A;  2C0L A;  4Q94 A;  5G55 A;  2IVG A;  1WDY A;  2XEH A;  2OOE A;  4DI3 A;  4J8E A;  3O9X A;  2WXQ A;  4BTA A;  3X2Q E;  4GQM A;  5EN5 D;  1RPE L;  1E90 A;  1VPW A;  3QKY A;  3ZYQ A;  2QFC A;  3RU0 A;  5HI7 A;  2DVW A;  3ASO E;  3QWG A;  3ISM C;  4UI9 K;  4H7Y A;  4N3B A;  3G2V A;  4HOT A;  3EJN A;  3KJX A;  5EIB E;  5E76 A;  1ZVV A;  3CR3 A;  1TN7 A;  3Q5M A;  1MZC A;  3FUN A;  1HXI A;  1S0P A;  1FT1 A;  2KCV A;  4ILI A;  2GRQ B;  4R7L A;  3CVP A;  3V30 A;  4JD2 G;  3RRU A;  4ANW A;  3VLE A;  1ZAY A;  4UWF A;  4Z58 A;  5BT1 A;  3HIZ A;  4DLQ A;  2R05 A;  2KEJ A;  4AM9 A;  4MCX A;  3A9Y A;  3GZC A;  2LAI A;  2HR2 A;  3UFD A;  4KXK B;  2VSX E;  1V55 E;  2PXK A;  1N4Q A;  1QP4 A;  4GZD A;  4I6U A;  2HO1 A;  4NRH B;  1JWF A;  3FEY A;  1JUQ A;  2XXA A;  1WAO 1;  3ONK A;  5G04 C;  1OCR E;  4IYP A;  1NEQ A;  4GHJ A;  4G8L A;  4UWH A;  2ZGG A;  3QJZ A;  4U63 A;  4LSZ E;  2PXU A;  4YBA A;  5G05 C;  3OQN A;  2KBX A;  3BDN A;  2R2L A;  3U66 A;  4EEC A;  3DXK G;  1A17 A;  4ZHB A;  3APC A;  1LQC A;  2PXP A;  3SR4 A;  3ABL E;  1D8D A;  4XZ4 A;  1TYQ G;  3S2A A;  3DSU A;  3MJW A;  4M3O A;  4YDW A;  3CLJ A;  1U3D A;  5HKP A;  3CKC A;  3FH8 A;  4IA8 A;  4PH4 B;  3NXH A;  1MX6 A;  1JFS A;  1E8Y A;  4Y6W A;  3SFZ A;  2XGM A;  5EX0 A;  2WB2 A;  3MCX A;  3GBF A;  2X6H A;  2AW6 A;  3AG1 E;  4AY6 A;  1OWO A;  2I6H A;  2IVB A;  3AJI A;  4G23 A;  3CEC A;  1E8Z A;  3ASH A;  4EQF A;  3ML9 A;  1E7U A;  2DZO A;  2HE0 A;  3CHQ A;  5JJ6 A;  1OWM A;  4CEM A;  1HO8 A;  2EIL E;  1ZPQ A;  4FJZ A;  4G8K A;  1PER L;  5M72 A;  5DTR A;  4J8F A;  4APO A;  4TRQ A;  4GTV A;  1N94 A;  3Q75 A;  2IF4 A;  4CT4 A;  3RZZ A;  4CYM D;  4K0R A;  3UIO C;  5ANL A;  2GRM A;  2GRR B;  4A1S A;  5JJT A;  1PRA A;  4HNA D;  3GZS A;  3D9L A;  4H7X A;  1GW6 A;  3NDB B;  4I6R A;  5AQA A;  3ASF A;  3HRA A;  3TEP A;  2WXO A;  4UWG A;  3IEG A;  4J7W A;  5LCW C;  3D9H A;  2WXK A;  3S7F A;  3OXG A;  2DWZ A;  4GYO A;  3B7U X;  3S7D A;  1YSE A;  2OVF A;  2LYL A;  3I5P A;  5EYP F;  5BUZ A;  5BV0 A;  3CSF A;  2GRN B;  2J9Q A;  4APF A;  3HXF A;  3W9F A;  4JW1 A;  5FWQ A;  2WXP A;  2L0T B;  1N4R A;  3C3Q A;  2PXE A;  1JWL A;  3QAR A;  5G04 J;  5BV1 A;  4FLB A;  4JB8 P;  4O6F A;  4LNG A;  3SY2 A;  4WVL A;  4GMJ A;  2OFY A;  1P5Q A;  3Q7A A;  4OVV A;  2XRZ A;  5BNW A;  1UJJ A;  4G25 A;  3KSQ A;  2L8N A;  3ABK E;  4I9C A;  4XI9 A;  3SQV A;  1W3B A;  2KM4 A;  5FIO A;  1H6K A;  3LY9 A;  2P9I G;  3ZPX A;  4DX1 A;  2XXQ A;  1IQU A;  3SI5 A;  2AXU A;  2OCC E;  4M7C A;  4HRM B;  5ENQ D;  4Z59 A;  3LXU X;  3NOG D;  3LVQ E;  4QFV A;  3KL4 A;  4A3V A;  1SQM A;  3E30 A;  2X6K A;  3GZ2 A;  1QQA A;  2Y4T A;  3JYS A;  1KZO A;  4JXT A;  4JZY A;  1IKN D;  4GMR A;  2IO3 C;  3PXP A;  1BD8 A;  5FZR A;  3FH5 A;  1PRU A;  5JHB A;  5AYW D;  3KAE A;  4FA6 A;  3PS6 A;  3NZL A;  3VTY A;  3QF3 A;  4GTP A;  2ZXW E;  2ETB A;  3QOX A;  1CJG A;  2XCC A;  5ENR D;  3CHP A;  2QZA A;  2ZIR A;  4Z5D A;  5CBO A;  2IU7 A;  5ENS D;  3M9L A;  2PXL A;  3TWR A;  3J5P A;  4YAR A;  2RKK A;  3G2U A;  1N9A A;  4NIK A;  1N4P A;  3V79 K;  3PZD A;  4I1M A;  1E7V A;  1SZ9 A;  2Y0B G;  2AWI A;  2L1P A;  2L0I A;  1N0R A;  3ZU7 B;  2J07 A;  2WXN A;  5B1A E;  4KZ0 A;  4GZ5 A;  1FVF A;  4FUL A;  3FUH A;  3D9N A;  3MEJ A;  1LD8 A;  1SVX A;  4HFG A;  1RZR A;  4ER7 A;  4XKC A;  2WQ6 A;  2V5F A;  3BEE A;  4KBQ A;  5EDS A;  4A55 A;  4ILG A;  4WWP A;  2X6F A;  3DST A;  1RZS A;  3TAX A;  1GT0 C;  2VQ2 A;  4O1P A;  4L9P A;  2F8X K;  1OSL A;  3BQO A;  2XCJ A;  3PEV B;  4X4B A;  4HRN A;  3OQM A;  3UT7 A;  3CQG B;  2CRO A;  2LLW A;  1IQR A;  1DCE A;  2NSZ A;  5EYL A;  2YQ8 A;  3HDX A;  2MYO A;  2P2C P;  4LUN U;  2LCV A;  4X4D A;  4I6J A;  2PQR A;  1WH6 A;  2XJ3 A;  3PZ2 A;  5ENO D;  3L6A A;  2OR1 L;  3SNX A;  4ZFH A;  2BUG A;  3RSE G;  3AS8 A;  4E85 A;  2IU1 A;  4PUC A;  2V0P A;  2WQ7 A;  3HG0 D;  3SCG A;  3U3W A;  5A7L A;  3VLD A;  2ZIS A;  2CHW A;  5T8I A;  1S7E A;  3Q9N C;  5KJN A;  3ASD A;  3GN5 B;  3S7J A;  4HI8 A;  2CHX A;  4B89 A;  5AN8 A;  5AJD A;  4FC8 A;  3TFL A;  5BW8 C;  1EFA A;  1X2L A;  3Q9U C;  5FQ7 A;  2QYJ A;  1H19 A;  4HBD A;  2FUL A;  2AXZ A;  2VSY A;  5JMN D;  3QOW A;  2EIM E;  3FUL A;  3HVE A;  4AJW A;  2EIJ E;  2ZU6 B;  3D9O A;  2J7W A;  4UQX A;  2ODR D;  5AQ9 A;  2NC9 A;  2R03 A;  3MKQ B;  4XKB A;  1MYO A;  2Y1L E;  4F8D A;  2MXD A;  2HM8 A;  3ZXP A;  4PU7 A;  1ZZ7 A;  2E0I A;  2DZN A;  3ZYM A;  5FJY A;  3B95 A;  2LYJ A;  4KYO B;  2XCB A;  2I1J A;  1S64 A;  3ULQ A;  2IOL A;  5KNH D;  2LYK A;  4MKT A;  3TWX A;  3V2O A;  4ANX A;  1TEZ A;  2FO1 E;  5FIN A;  4I17 A;  5CCM A;  2GRO B;  2P9L G;  1POU A;  3DPD A;  4N3A A;  1MX2 A;  4FHK A;  5DTM A;  3D9P A;  3HXE A;  2VGX B;  3GUU A;  4DE8 A;  1CQT A;  1Z3Y A;  2IV1 A;  2WXJ A;  3F6Q A;  1NI1 A;  3CHM A;  3QNK A;  3RO2 A;  4AP2 A;  4URK A;  1U2Z A;  2X38 A;  3KD7 A;  1E96 B;  4B8A A;  1NFI E;  4J8S A;  2P9U G;  2LO6 A;  1ADR A;  1FT2 A;  4F3V A;  4KMO A;  2PXB A;  3UI2 A;  4I6E A;  2PM7 A;  1WG0 A;  4DX5 D;  1IYG A;  4K5C A;  3CHS A;  1BDH A;  1KPS B;  2IVQ A;  4KT6 B;  1N0Q A;  5A7D B;  4RLY A;  1SA4 A;  2L6B A;  2XEE A;  2XEV A;  3FTV A;  3ESL A;  2MEZ A;  3I3N A;  4HOQ A;  4JL0 A;  3AAA C;  5ENN A;  3QWV A;  2J09 A;  1EPU A;  2LLV A;  4YG1 A;  1ZU2 A;  5CMW A;  3UM1 A;  4FU3 A;  3VK0 A;  4X4I A;  3RKV A;  5LOZ A;  3IHY A;  3NAW A;  4CCA A;  2HYZ A;  4UQZ A;  2B0O E;  1IHB A;  2KZT A;  5CMY A;  3B7R L;  3G2T A;  2ZGD A;  2XPI A;  1A5E A;  2JLB A;  5FTP A;  4EBA G;  1OCO E;  4I1A A;  5HS0 A;  1E8W A;  3GW4 A;  3LFP A;  1TNU A;  3CK7 A;  1UN9 A;  3ZYK A;  3UQ3 A;  4G1T A;  3N71 A;  4TXP A;  4CRW A;  4YVO A;  4KVM A;  3J5Q B;  5LP0 A;  3KSL A;  4PS3 A;  1TJF A;  4KVO A;  4DK5 A;  3G2S A;  1OT8 A;  4CDR A;  2DBA A;  4P29 A;  5ANR A;  1K8K G;  4YND A;  5GAH i;  4JPS A;  3ZNG A;  3FUI A;  1TNB A;  4GAA A;  3TG5 A;  2PXT A;  4U95 D;  2WXL A;  4IRU A;  3DSX A;  4J8Y A;  3ZHE A;  4CDM A;  4F6R D;  1NL4 A;  3JXJ A;  1LF8 A;  1RZR D;  1SW6 A;  3P1U A;  1PNR A;  3OXF A;  4L2Y A;  3ZW3 A;  2P9P G;  3JXI A;  1DUL A;  1WM5 A;  5EIL A;  2DCP A;  4Z68 A;  1TNZ A;  3GZ1 A;  1H0A A;  4DJA A;  3ZGQ A;  3DEO A;  4GTR A;  1NER A;  4X4F A;  2BJC A;  3MV3 B;  3ZPJ A;  4GYY A;  3PRE A;  5AJL A;  3SGH A;  4GU5 A;  2YHC A;  3HZI B;  2OVB A;  2E2E A;  4ER0 A;  3E4B A;  4GZ6 A;  2PE5 A;  4I43 A;  2AJA A;  1B0N A;  4RQI A;  3CRO L;  3FTY A;  4Q2J A;  3RRM B;  1QPZ A;  5ARF A;  3TL5 A;  2AVP A;  4L2L A;  2H6H A;  4WAF A;  1XWR A;  2XGS A;  2F0Y A;  3EIJ A;  3CQC B;  3FH7 A;  1RIO A;  3HYM B;  2R1J L;  1WIZ A;  5JA4 D;  4GZ3 A;  1R63 A;  4AY5 A;  3QFI A;  4JCY A;  4JEU A;  3CVU A;  5KWD A;  4U0Z A;  4DX2 A;  1KT0 A;  4BFR A;  3WXX A;  3GZD C;  3FUK A;  4LER A;  3V2X A;  5B3S E;  4O1O A;  3LPZ A;  1JCS A;  3SBT B;  3DSS A;  4HLE A;  2PXQ A;  1O1S A;  2L9B A;  3RJV A;  5A23 A;  1O1T A;  4XI0 A;  4AVX A;  1QNF A;  5KJK A;  4GTQ A;  4ACK A;  4ATG A;  3LY7 A;  3UKR G;  3QYX A;  2JCG A;  4I2W A;  1RZ4 A;  1ZZ9 A;  3PUK A;  3APD A;  2XS1 A;  2RFM A;  3EHQ A;  3MYV A;  1TN8 A;  2VEO A;  2V8S E;  2L49 A;  3PZ1 A;  2MOW A;  1ZUG A;  2LYS A;  2KPJ A;  4C48 B;  3C72 A;  3FTS A;  4GTM A;  2OEW A;  4I9E A;  1YYH A;  3DSV A;  4CZ2 D;  4B94 A;  2PPX A;  3SHF A;  2PXF A;  5AQB A;  1X5B A;  1R69 A;  5DT2 A;  1MX4 A;  1DC2 A;  1H6O A;  4HS2 A;  3CK9 A;  4GB9 A;  1DVP A;  2WXR A;  5CEC B;  1YCS B;  4TXR A;  4OYS A;  1U3C A;  4D10 C;  4UQY A;  4BT9 A;  4EBA A;  3G2W A;  4U8H A;  2HCS A;  3OWQ A;  3SCF A;  1LD7 A;  4OAV B;  2KEK A; 
#chains in the Genus database with same CATH homology
 4FBI A;  3MEK A;  2LYP A;  4GA2 A;  3EUS A;  2UY1 B;  4JC8 A;  4LUN U;  3KS2 A;  1QP7 A;  2LCV A;  3F51 A;  4X4D A;  3LJ3 A;  3Q15 A;  3RO3 A;  2VTB A;  1ZS4 A;  1HG5 A;  4I6J A;  4N2Q A;  3LCA A;  4GCN A;  4CGV A;  2EF8 A;  3JQ0 A;  4LRZ A;  2PQR A;  5EX3 A;  3FY4 A;  2M63 A;  3KZ3 A;  1ZZB A;  1WH6 A;  3FUJ A;  2CG2 A;  4NQ0 A;  5T3R A;  2XJ3 A;  4GA1 A;  2ICP A;  3EIQ C;  3L6A A;  2OR1 L;  1UJK A;  3SNX A;  1UXC A;  2BUG A;  5FT9 A;  3AS8 A;  4E85 A;  4GU5 A;  3UX4 A;  1ELK A;  4I8T A;  1H2T C;  3PDN A;  4J8D A;  3CST A;  2IU1 A;  4JCX A;  3LDZ A;  1B89 A;  3LVR E;  4FP7 A;  4PUC A;  1INZ A;  3NQP A;  3EDT B;  1SQ8 A;  2V0P A;  3CVV A;  2WQ7 A;  3TG4 A;  1DNP A;  1JFT A;  1OCT C;  3BG1 B;  3SCG A;  3EHM A;  3U3W A;  1PAQ A;  2R5S A;  1NA3 A;  5A7L A;  2CFZ A;  3IVP A;  3G7D A;  3URZ A;  4AOF A;  3OAW A;  2C0L A;  2CFU A;  2OND A;  4Q94 A;  4F53 A;  1Y7Y A;  2GZU A;  5G55 A;  2IVG A;  2WUS R;  2FBN A;  3QDN A;  3AS4 A;  4BT8 A;  5CCL A;  3CVW A;  3I4G A;  3VLD A;  5CHE E;  5FZS A;  2OOE A;  4DI3 A;  1KT1 A;  4J8E A;  3O9X A;  2CHW A;  2WXQ A;  1S7E A;  4LCT A;  5T8I A;  4JA9 A;  4BTA A;  4Y42 A;  4X4G A;  1UTX A;  1LCD A;  1WY6 A;  3ASD A;  5KJN A;  3JXB C;  3H5T A;  4GQM A;  1NA0 A;  4C0E A;  1RPE L;  3GN5 B;  3S7J A;  1E90 A;  2CHX A;  3FDH A;  3NZU A;  4U0S A;  2LSV A;  4EZL A;  1VPW A;  2P58 C;  3O48 A;  3QKY A;  4G2V A;  4B89 A;  3T5V A;  3QAQ A;  3ZYQ A;  1EYH A;  4I1O B;  2QFC A;  5AJD A;  4FC8 A;  2VSO E;  3RU0 A;  5BW8 C;  5HI7 A;  4B0Z A;  1EFA A;  3IKO B;  4Z5H A;  3QWG A;  1X2L A;  5FQ7 A;  2WIU B;  3PVL A;  3NF1 A;  1HE8 A;  5C1D A;  2WXI A;  3L13 A;  3L17 A;  4UI9 K;  4H7Y A;  1H19 A;  3G2V A;  3FUF A;  4N3B A;  4RG6 A;  2VSN A;  2FUL A;  4HOT A;  2AXZ A;  2VSY A;  3EJN A;  3PEU B;  4B8C B;  3KJX A;  2WMN A;  3LKU A;  3AS5 A;  3FUL A;  3HVE A;  5E76 A;  1ZVV A;  3CR3 A;  1PRV A;  3EHN A;  4AJW A;  2ZU6 B;  3ZXS A;  3D9O A;  3Q5M A;  2R59 A;  1QP0 A;  3FUN A;  4UQX A;  2B5A A;  3FTW A;  4JHK A;  2NC9 A;  3BD1 A;  1HXI A;  1S0P A;  3MKQ B;  4XKB A;  3ASG A;  3CVY A;  2KCV A;  4F8D A;  3CVN A;  3FUM A;  4N3C A;  2HM8 A;  4ILI A;  5JHA A;  4PU7 A;  2KZT B;  1ZZ7 A;  1Z6T A;  2E0I A;  2YNQ A;  4R7L A;  3CVP A;  3ZYM A;  5FJY A;  4PU8 A;  5AIJ A;  2XIU A;  3T8M A;  4ACL A;  2LYJ A;  4KYO B;  3FUD A;  2XCB A;  1E3O C;  2I1J A;  3OTN A;  3FMY A;  2IOL A;  3RRU A;  3ULQ A;  4NDW A;  1ZZ6 A;  3ZFW A;  4RSY A;  3SZ7 A;  2LYK A;  1IHG A;  4MKT A;  3JXD L;  4ANW A;  3VLE A;  1UG3 A;  2PUB A;  4V3I A;  1ZAY A;  4UWF A;  2I9C A;  4ANX A;  1TEZ A;  4Z58 A;  5BT1 A;  4I17 A;  4HOR A;  3CHO A;  3HIZ A;  1HX8 A;  3D9I A;  2VYI A;  3CKB A;  4AIF A;  2KEJ A;  3ZRH A;  4MCX A;  2LYQ A;  4G11 A;  5DBK A;  4L23 A;  4AM9 A;  5CCM A;  2LAI A;  1POU A;  2HR2 A;  2PQN A;  3DPD A;  1HU3 A;  4N3A A;  1QZ2 A;  2PUA A;  4FHK A;  4IVZ A;  3R7R A;  3UFD A;  3ZYL A;  4NAC A;  2X6J A;  4FHJ A;  4E6H A;  3D9P A;  3HHM A;  4KXK B;  2VSX E;  3L08 A;  2WM9 A;  3D9M A;  4PU4 C;  2UY1 A;  4YG7 B;  3SCH A;  2VGX B;  2BTD A;  3FU3 A;  4A3T A;  1CQT A;  3PUJ A;  1Z3Y A;  1AU7 A;  2IV1 A;  3RK6 A;  1QP4 A;  2DIW A;  4GZD A;  4I6U A;  2HO1 A;  4NRH B;  2WXJ A;  1JWF A;  3VTX A;  2R63 A;  5ARG A;  4CGW A;  4EZK A;  3CHM A;  1JUQ A;  1VDY A;  1WAO 1;  3FEY A;  3R1F A;  3ONK A;  3QNK A;  3RO2 A;  5G04 C;  3FHE A;  4MCT A;  4AP2 A;  4URK A;  4IYP A;  1NEQ A;  4GHJ A;  2X38 A;  2WVI A;  3CK8 A;  3KD7 A;  1E96 B;  2WPV A;  4UWH A;  3ZHE B;  4U0U A;  4B8A A;  3UUX A;  3LY8 A;  4PDX A;  4J8S A;  2BF0 X;  3QJZ A;  3BG0 B;  3FU0 A;  3JUI A;  4U63 A;  2LO6 A;  4YBA A;  5G05 C;  1ADR A;  5HQ8 A;  2XSD C;  4I6G A;  3OQN A;  3ZHM A;  3BDN A;  4F3V A;  5K98 B;  3CLC A;  3U66 A;  1H2V C;  4KMO A;  5E75 A;  3JXC L;  2WXF A;  3CIA A;  4I6E A;  1Z3X A;  3B7T A;  4EEC A;  4N2S A;  2PM7 A;  2LYR A;  3B7H A;  1A17 A;  1H2U A;  3CHR A;  5D0Q D;  1IYG A;  3CHS A;  4HXI A;  1BDH A;  5G05 J;  2IVQ A;  4K03 A;  3APC A;  4KT6 B;  1LQC A;  5A7D B;  2X3M A;  3QWW A;  1O4X A;  4A1G A;  3GN5 A;  2OV8 A;  4C0M A;  1BPO A;  2XEV A;  1WET A;  2PUD A;  3FTV A;  4ANV A;  4CDN A;  3GYZ A;  3ESL A;  4N39 A;  2Q7F A;  4HVB A;  3F52 A;  4XZ4 A;  2MEZ A;  2XHE A;  3S2A A;  3I3N A;  3U64 A;  4HOQ A;  3MJW A;  4M3O A;  4PS8 A;  4JL0 A;  3CLJ A;  4X4C A;  1U3D A;  4Q96 A;  3QWV A;  5ENN A;  3CKC A;  3L1P A;  2J09 A;  4PS7 A;  1EPU A;  1OUV A;  4TUU A;  4AEZ C;  5J90 A;  4YG1 A;  1ZU2 A;  4IA8 A;  3FH8 A;  3ONL A;  3QC1 A;  4PH4 B;  2BNM A;  2PUE A;  5CMW A;  3QOU A;  1JFS A;  1N54 A;  4FU3 A;  1X57 A;  3VK0 A;  4X4I A;  3APF A;  1DW9 A;  1E8Y A;  2J4B A;  2WXG A;  3MKR A;  3RKV A;  2KAT A;  4CT0 A;  2GW1 A;  4DLO A;  3PNL B;  3MLF A;  5LOZ A;  3R7Q A;  4Y6W A;  3IHY A;  1UXD A;  4NUR A;  3SFZ A;  4CCA A;  3PE4 A;  2XGM A;  4BTB A;  2Y3A A;  5EX0 A;  2EBY A;  2HYZ A;  3T5X A;  3MKQ A;  4BY6 A;  2WB2 A;  2FJR A;  3FWV A;  3MCX A;  4UQZ A;  3GBF A;  2V4L A;  2X6H A;  2AW6 A;  4AY6 A;  2KCL A;  2KZT A;  5CMY A;  1OWO A;  3FU6 A;  3B7R L;  3G2T A;  2I6H A;  2IVB A;  3R9A B;  2XPI A;  4G23 A;  4L1B A;  3ZVV A;  3CEC A;  1E8Z A;  3LEW A;  5EKQ D;  3ASH A;  2JLB A;  3DBS A;  3F6W A;  3MV2 B;  5FTP A;  4EQF A;  2IOS A;  4EBA G;  3OP9 A;  3ML9 A;  1E7U A;  1QQE A;  4I1A A;  1E8W A;  1OWL A;  3FUE A;  3CHQ A;  5JJ6 A;  3GW4 A;  3LFP A;  1OWM A;  1PC2 A;  4CEM A;  1HO8 A;  3CK7 A;  1UN9 A;  1HF8 A;  2LSU A;  3ZYK A;  3I4R B;  4GA0 A;  1ZPQ A;  4JEH A;  4FJZ A;  4UI9 C;  3UQ3 A;  2RD0 A;  3LS8 A;  4G1T A;  3N71 A;  4OVU A;  3SD5 A;  3VLF A;  4CRW A;  3U9W A;  4J0U A;  1HS6 A;  1PER L;  4YVO A;  5T4Y A;  5M72 A;  4FAD A;  4J8F A;  2WQH A;  4KVM A;  4APO A;  5KJM A;  4TRQ A;  2IJG X;  3LIS A;  2FI7 A;  2PL2 A;  5KJL A;  2IF4 A;  3ZN3 A;  4CT4 A;  5LP0 A;  3FFL A;  3RZZ A;  1TJF A;  4PS3 A;  2CSF A;  3TRB A;  3G2S A;  3CV0 A;  4KVO A;  4UI9 J;  1UW4 B;  4K0R A;  4DK5 A;  3D9K A;  5ANL A;  3KXA A;  4AXH A;  2GRM A;  1ZBP A;  2H8R A;  4A1S A;  4TV3 A;  4CDR A;  1HFA A;  2DBA A;  2O38 A;  4P29 A;  3QWP A;  2VGX A;  5ANR A;  5AEN A;  5JJT A;  1PRA A;  1LMB 3;  3GZS A;  3D9L A;  4H7X A;  1GW6 A;  2I2O A;  4JPS A;  4WND A;  4YND A;  4I6R A;  3ASF A;  5A6C A;  5FQ6 A;  2WXO A;  3FUI A;  4GAA A;  4UWG A;  2A4Z A;  3IEG A;  4N5C A;  1HF0 A;  3TG5 A;  3L16 A;  5LCW C;  2ILR A;  2WXL A;  1JH9 A;  2WXK A;  1YA0 A;  2XRY A;  4G24 A;  3S7F A;  4J6I A;  4X4E A;  5FQ4 A;  3OXG A;  4IRU A;  3TGO A;  2NXP A;  4GYO A;  4JHJ A;  3ZHE A;  1WH8 A;  4JHR A;  4CDM A;  3B7U X;  1IC8 A;  5G2N A;  3MX3 A;  3S7D A;  2R17 C;  3FTU A;  4BX8 A;  4L7T A;  4GCO A;  1YSE A;  4JQD A;  4LEU A;  5LCW J;  1LCC A;  1LF8 A;  3LYA A;  2OVF A;  2LYL A;  3DNV B;  3I5P A;  1RZR D;  2WMO A;  5BUZ A;  4BSX A;  5BV0 A;  3CSF A;  5J08 A;  2PUG A;  3P1U A;  2J9Q A;  3Q47 B;  1L1M A;  4IUL A;  1PNR A;  3OXF A;  4U04 A;  4APF A;  1FVH A;  2LAH A;  4L2Y A;  4GYW A;  4JW1 A;  5FWQ A;  3ZW3 A;  3RRN B;  4WWO A;  2PUC A;  2WXP A;  2L0T B;  4F7A A;  1FCH A;  1LLI A;  3TXM A;  2J08 A;  1WM5 A;  3BS3 A;  2DCP A;  2WXH A;  2PM6 A;  4ME2 A;  4DLQ A;  1JWL A;  4RVB A;  3ZIM A;  2A5U A;  4UWL A;  3O4Z A;  3GZ1 A;  3QAR A;  1H0A A;  5G04 J;  4DJA A;  3ZKC A;  3AU5 A;  4FLB A;  3CVL A;  3UT8 A;  3ZGQ A;  5BV1 A;  2RG8 A;  2YIN A;  5LFA A;  4O6F A;  3TJP A;  1ZZ8 A;  1NER A;  4X4F A;  2LNI A;  2BJC A;  2MQK A;  4GMJ A;  3MV3 B;  4XIF A;  2OFY A;  2I1K A;  1P5Q A;  3ZEF A;  2ION A;  3ZPJ A;  4GYY A;  3PRE A;  4OVV A;  3ESK A;  5AJL A;  3SGH A;  5BNW A;  4BWR A;  2VGY A;  2XRZ A;  2X6I A;  3MGB A;  3QQ6 A;  2YHC A;  3HZI B;  1NP7 A;  1UJJ A;  2OVB A;  2XPY A;  2E2E A;  1Y9Q A;  2FO7 A;  4G25 A;  2BNO A;  3E4B A;  4FJY A;  4GZ6 A;  2PE5 A;  4I43 A;  4XE0 A;  2L8N A;  4I9C A;  3KEZ A;  1B0N A;  2KEI A;  3K9I A;  3MA5 A;  1PY1 A;  3UMV A;  4JA7 A;  3OXL A;  4PU3 C;  3D3M A;  3CRO L;  2KZ8 A;  3L22 A;  1Y8M A;  3FYM A;  4I2Z A;  4XI9 A;  1W3B A;  5JJ7 A;  2KM4 A;  1H6K A;  3LY9 A;  3C98 A;  2PUF A;  3FTY A;  3RRM B;  4ANU A;  1QPZ A;  4EPZ A;  5ARF A;  3TL5 A;  3OMT A;  3L54 A;  3UPV A;  1IQU A;  3SI5 A;  2AXU A;  2AVP A;  4L2L A;  4BX9 A;  1HZ4 A;  4EZJ A;  2VTB B;  4GPK A;  4WAF A;  1XWR A;  2XGS A;  4Z59 A;  3LXU X;  3B7S A;  1N52 A;  3LVQ E;  4I6T A;  3EIJ A;  3CQC B;  4QFV A;  4ABN A;  2O49 A;  3FH7 A;  3QK0 A;  1RIO A;  1ELW A;  2KC7 A;  1SQM A;  3HYM B;  4A3V A;  2EWT A;  2R1J L;  1WIZ A;  5BPP A;  2X6K A;  4GZ3 A;  1R63 A;  4OB4 A;  1QQA A;  3GZ2 A;  4MRU A;  5D0O D;  2Y4T A;  3JYS A;  3MZL B;  4MLP A;  4WNG A;  2CHZ A;  4AY5 A;  3FP3 A;  4JXT A;  5KCM A;  4JCY A;  4JZY A;  3FYA A;  2FF4 A;  4JEU A;  3CVU A;  4GML A;  3PXP A;  1EF1 C;  4U0Z A;  2MHK A;  4Q69 A;  1EDU A;  1UN8 A;  5FZR A;  4WUY A;  1L5J A;  1KT0 A;  1OWP A;  1XNF A;  3FH5 A;  3WXX A;  3FUK A;  4LER A;  1PRU A;  1XGW A;  1JPL A;  4BFR A;  4U07 A;  5JHB A;  1ELR A;  3IV0 A;  4HOU A;  3ZHI A;  3KAE A;  5AYW D;  4O8B A;  4FA6 A;  3PS6 A;  3VTY A;  3LPZ A;  3QF3 A;  3ML8 A;  3CVX A;  3SBT B;  4HLE A;  2AUW A;  4G26 A;  1CJG A;  2XCC A;  2L9B A;  3G5G A;  3B13 A;  3RJV A;  2XGO A;  4XX5 A;  3CHP A;  5A23 A;  3NZS A;  4Z5D A;  3U4T A;  2XI8 A;  4IWR A;  2IU7 A;  2J49 A;  3FTX A;  2WXM A;  1MQS A;  3CVQ A;  2FEZ A;  4XI0 A;  4AVX A;  4YAR A;  1QNF A;  5KJK A;  5C2Y A;  4ACK A;  3ENE A;  1SZA A;  3G2U A;  4ATG A;  2IQC A;  3CGH A;  3LY7 A;  3QYX A;  3IBE A;  3PZD A;  4I1M A;  2JCG A;  4I2W A;  5DIZ A;  1ZZ9 A;  3PUK A;  2HSG A;  1E7V A;  1SZ9 A;  4WNF A;  2AWI A;  2YHE A;  3APD A;  2L0I A;  2PIJ A;  3CEQ A;  3OQO A;  2QY7 A;  3P2B A;  1OWN A;  1KLX A;  1BDI A;  2IFU A;  3FU5 A;  3MYV A;  2J07 A;  1E8X A;  2C2L A;  2A6C A;  3RIB A;  4F1S A;  2WXN A;  4ILH B;  2JVL A;  2AXV A;  2V8S E;  2L49 A;  3PE3 A;  4KZ0 A;  1HH8 A;  4GZ5 A;  1MHQ A;  4KZC A;  1FVF A;  3HVE B;  3IHV A;  4J1X A;  5LX8 A;  2CG3 A;  2MOW A;  4FUL A;  2XPZ A;  1ZUG A;  3FUH A;  2LYS A;  4YG4 A;  2O4A A;  2KPJ A;  1NZN A;  2KCK A;  3D9N A;  2BNN A;  2HIN A;  3JQ1 A;  4FLH A;  2GRL A;  3D9J A;  3SBS A;  4HFG A;  1ZZC A;  1RZR A;  4W9R A;  4DPR A;  4FN3 A;  3AU4 A;  2L6J A;  4UWK A;  3JCK C;  2IUO A;  4RG9 A;  4XKC A;  1Y6I A;  2Y4U A;  2WQ6 A;  1JWG A;  2V5F A;  3BEE A;  4KBQ A;  1DWK A;  5EDS A;  4JVS A;  4J1W A;  4YVQ C;  3FTS A;  4I9E A;  4WWN A;  1HG2 A;  3PRZ A;  5FZQ A;  4A55 A;  4ILG A;  2D5V A;  4WWP A;  3PNT B;  4B94 A;  2PZI A;  2MRI A;  2PPX A;  3QB2 A;  4GZC A;  3SHF A;  2X6F A;  1RZS A;  3TAX A;  1GT0 C;  1X5B A;  2VQ2 A;  1R69 A;  1QQB A;  2VJ8 A;  3Q49 B;  3PH0 C;  4DI4 A;  4MS6 A;  5FQ8 A;  2ICT A;  2J4D A;  1OSL A;  3CK9 A;  3FEX A;  2C0M A;  3S8Q A;  4GB9 A;  1DVP A;  4HS2 A;  2XCJ A;  2WXR A;  3SF4 A;  3PEV B;  4X4B A;  1TJC A;  2XQ0 A;  3FTZ A;  3TXN A;  3Q4A B;  3OQM A;  4C9B B;  3UT7 A;  4WNE A;  3CQG B;  2CRO A;  4OYS A;  1U3C A;  4D10 C;  4AV7 A;  4UQY A;  1IQR A;  4IN3 B;  4Y6C A;  2GGF A;  3UT4 A;  4HOS A;  3D1N I;  2JEK A;  2UWJ G;  2NSZ A;  4BT9 A;  3G2W A;  4EBA A;  4U8H A;  4Z5C A;  2EQX A;  2YQ8 A;  3SCF A;  3HDX A;  3S7B A;  4X4H A;  2KEK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...