2AW6A

Structure of a bacterial peptide pheromone/receptor complex and its mechanism of gene regulation
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
287
structure length
287
Chain Sequence
MFKIGSVLKQIRQELNYHQIDLYSGIMSKSVYIKVEADSRPISVEELSKFSERLGVNFFEILNRAGMNTKSVNETGKEKLLISKIFTNPDLFDKNFQRIEPKRLTSLQYFSIYLGYISIAHHYNIEVPTFNKTITSDLKHLYDKRTTFFGIDYEIVSNLLNVLPYEEVSSIIKPMYPIVDSFGKDYDLTIQTVLKNALTISIMNRNLKEAQYYINQFEHLKTIKNISINGYYDLEINYLKQIYQFLTDKNIDSYLNAVNIINIFKIIGKEDIHRSLVEELTKISAKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of peptide sex pheromone receptor PrgX and PrgX/pheromone complexes and regulation of conjugation in Enterococcus faecalis.
pubmed doi rcsb
source organism Enterococcus faecalis
molecule tags Transcription
molecule keywords PrgX
total genus 103
structure length 287
sequence length 287
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01381 HTH_3 Helix-turn-helix
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 2aw6A01
1.25.40.400 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2aw6A02
2OR1L 2LYLA 2H8RA 1JFTA 1LQCA 2EF8A 4J1XA 4X4DA 1WH6A 1ZZ6A 2A6CA 1AU7A 2KEIA 3CROL 4X4HA 2IV1A 2LYQA 3F6WA 1BDIA 3SCGA 3ZKCA 1LLIA 1QPZA 3OQNA 3OP9A 4F8DA 4PU3C 1WH8A 4MCTA 1ZZBA 4PU7A 3BDNA 1R63A 4Z59A 3CECA 4JQDA 1QP7A 2KPJA 2PUGA 3UFDA 1SQ8A 3F51A 4FBIA 3JXBC 2XSDC 4GQMA 3IVPA 1ZZ8A 4NDWA 1ZZ9A 1CQTA 1WIZA 1UTXA 2IUOA 1R69A 1RZRA 1LMB3 2XCJA 3BD1A 3FMYA 1PNRA 4OB4A 4X4FA 4Z5HA 2LYSA 2PPXA 4X4CA 4IWRA 4MCXA 4FN3A 2O49A 2CROA 4J1WA 4Z5CA 3VK0A 2HINA 2KEKA 1OSLA 3QYXA 2AXUA 1RZSA 1PERL 1ZAYA 2LYKA 4Z5DA 1ZZ7A 1CJGA 1B0NA 1L1MA 2R1JL 1ZS4A 2IVGA 2D5VA 2AUWA 2PIJA 2XI8A 3GBFA 1HF0A 2XJ3A 1RZRD 1BDHA 1X2LA 3OMTA 2WIUB 3BS3A 1DWKA 4X4BA 2IU7A 3KXAA 1RIOA 4I6RA 4PU4C 4YG1A 2LYJA 2KEJA 1ZZCA 2LYRA 2AW6A 2ICTA 3B7HA 2PUEA 1PRVA 1NEQA 2GRMA 3F52A 2BJCA 4I8TA 2IVQA 3KJXA 2BNOA 3OQOA 1POUA 1PRAA 1XWRA 2WUSR 1QP4A 3RZZA 3PXPA 2PUBA 4JCXA 1VPWA 1LCCA 3QQ6A 3SCHA 1IC8A 3DNVB 1YSEA 2BNNA 2EBYA 3TRBA 3FYAA 2OFYA 4PU8A 1S7EA 4O8BA 4YARA 3JXCL 2AWIA 2MEZA 1DW9A 3SCFA 1X57A 4Z58A 1E3OC 1JWLA 1QP0A 4YG7B 2LCVA 2KZ8A 3O9XA 3G5GA 3ZHIA 4X4GA 2PUFA 3LFPA 1UXDA 2ICPA 2L8NA 3GN5A 1OCTC 4JCYA 1ADRA 2B5AA 3S8QA 4YG4A 1Y9QA 2PUDA 3L1PA 1UXCA 1ZUGA 2EWTA 2PUAA 2AXVA 3LISA 2PE5A 4YBAA 3QF3A 3MLFA 1QQBA 3U3WA 3HZIB 5A7LA 2R63A 3EUSA 4GHJA 2JCGA 4I6TA 3ZHMA 2L49A 4IA8A 1JFSA 2IVBA 3R1FA 2HSGA 4I6UA 4X4IA 3D1NI 3KZ3A 3OQMA 3CLCA 3FYMA 2FJRA 3GN5B 1O4XA 2BNMA 2GRLA 2MQKA 4IVZA 5K98B 3JXDL 1EFAA 2CSFA 3H5TA 1WETA 2PUCA 1PRUA 2AXZA 2O4AA 3QWGA 3G7DA 4X4EA 4Y42A 1LCDA 1RPEL 2XIUA 1GT0C 2LYPA 2JVLA 1NERA 1Y7YA 2O38A 1QQAA 1ZVVA 1ZPQA 1JH9A 2GZUA
chains in the Genus database with same CATH superfamily
3RSEG 1JFTA 1UW4B 4J1XA 4PS8A 1U2ZA 4U96D 2WQ7A 1N4SA 5CECB 3CLJA 4X4HA 2WXJA 2VGXA 3OQNA 1FT1A 2IO2C 4U04A 4Z59A 2GRRB 3KEZA 1QP7A 4I2ZA 4CZ2D 2XHEA 3DBSA 5EX0A 2WB2A 3QNKA 3TG5A 4AIFA 3DSSA 4EZJA 4OVVA 2LYSA 4TXPA 3GUUA 5EIDA 3VK0A 1D9SA 3MGBA 3KEAA 4DX5D 5G55A 3NQPA 5HQ8A 1HF0A 4K0RA 2XJ3A 3S7DA 4Q69A 3KXAA 3FUKA 2OV8A 4ANUA 1QNFA 2I9CA 4YG1A 2JLBA 3HHMA 2LYRA 5BXUA 2LLWA 4ZFHA 4GPKA 4OVUA 5KNHD 3B95A 3CVNA 2VGXB 3FY4A 1H2VC 3QDNA 3LXUX 2WUSR 1TN7A 3AAAC 5HRYA 2LNIA 3QC1A 2WVIA 3E4BA 3HG0D 2V5QC 3TFLA 3AS4A 2NC9A 3IHVA 4CT4A 1IXVA 1UXDA 3GN5A 2B5AA 3PUKA 3SF4A 4PUCA 1NA3A 2C0MA 2VGYA 3MV3B 3SX0A 3B7RL 3CHOA 2WXLA 3LKUA 3ML9A 4APOA 4Q2JA 1NZNA 3TWUA 1IHGA 4EKGA 5T4YA 2R2LA 4X4DA 2R02A 3R7RA 1N4QA 1PC2A 4FLHA 2I1KA 1LLIA 2YQ8A 2PQRA 2B0OE 3TWRA 2LXMA 5FTPA 4OYSA 1QZXA 3JXBC 4U95D 3SZ7A 4J8EA 3Q49B 1O1RA 3KL4A 4DX7D 4GTOA 3OAWA 4X4CA 4CCAA 2FULA 3FULA 1OSLA 3CQGB 2IVGA 2PIJA 2WXRA 3URZA 4CDRA 2P58C 3TGOA 2LSUA 3BG0B 4F3VA 2VGEA 3DWLG 5J90A 4WNEA 1IQUA 5J08A 4YDOA 4U0ZA 4G24A 1H6PA 5FJYA 5KCMA 2EBYA 2A5UA 3GZSA 4N2SA 2KCLA 4FJYA 3OXFA 4JEUA 1OCTC 3UTMA 3SD5A 3AS5A 2UWJG 2X6KA 3L1PA 2XQ0A 3CK7A 3HIZA 4K5BA 5CMWA 4RG6A 2Y69E 3MYVA 3PUJA 1HH8A 2WXQA 3BU8A 5AAOA 5FZRA 4HOSA 4C9BB 1QQAA 4KBQA 4HB5A 2WQHA 1EPUA 4EQZA 4RLYA 4UI9K 4H7XA 4O1OA 3C3OA 4GA1A 5LCWC 3RKVA 2H6GA 3ZUVB 4F8DA 1RZ4A 4WAFA 3FUEA 3OXGA 4CRWA 1UJJA 2XEEA 3Q15A 3CVUA 4AM9A 3IVPA 2J9QA 2OVBA 1CQTA 1MJ0A 1UTXA 1NFIE 3RK6A 2XCJA 2H6HA 4MCXA 5AJDA 4J1WA 1N4PA 2HINA 1IKND 1E90A 2F0YA 4BETA 4Z5DA 2HYZA 2X38A 1L1MA 3UKUG 3Q4AB 3PRZA 3LY7A 1UJKA 3CVPA 4K5CA 3CHQA 3C98A 4UI9J 4V3IA 4DI4A 3MX3A 2WMOA 1V55E 4U63A 4G2VA 3Q75A 3NBNB 2XXAA 1Z5SC 4XEIG 2XEHA 1LCCA 4HRLA 4BTAA 5DT2A 1JCRA 4AEZC 3DNVB 3VTYA 4GTMA 1QP0A 2J07A 3LVQE 2LCVA 3O9XA 2LAIA 3S8QA 2XCBA 3VLDA 4YG4A 2X6IA 3UI2A 1ZUGA 4DLQA 3LISA 2PE5A 2J4BA 3IEGA 5AARA 4TV3A 3SQVA 4IA8A 2L6JA 3FYMA 4AOFA 5K98B 1MFQC 2C0LA 5G05J 1LCDA 2HCNA 4Y42A 1ZBPA 2XIUA 3PDNA 2MHKA 1TEZA 3QJZA 1UN8A 1OXJA 4A1GA 4EZLA 1AU7A 3LQXA 5BXOA 5EIBE 4MCTA 4TUUA 4UUCA 2XGMA 2OEWA 4E6HA 3MA5A 3UUXA 2ODRD 4GQMA 3ZIMA 2A5EA 2EIME 3BD1A 4KVOA 4GCNA 3ZYQA 4ATGA 4WWNA 1QYMA 4CGWA 2R1JL 3SFXA 2IFUA 4LCTA 4RVBA 4I9EA 1QQEA 2FBNA 5EX3A 2LYJA 2E0IA 2CHZA 4FC8A 3SR4A 4I2WA 5G2NA 2XGOA 4GTVA 2BJCA 1EYHA 5KJMA 4JC8A 1OWNA 3NDBB 5T8IA 5JMND 5DSXA 4YARA 5LCWJ 3JXCL 3PZDA 2QZAA 1Z6TA 3W9GA 4HXIA 1N95A 2L0IA 4JZYA 4J8SA 3ASFA 2EINE 4BSZB 3ZN3A 1HO8A 1TYQG 5KNGA 2L6BA 1MZCA 4YBAA 3NOGD 3QF3A 4EECA 3TXNA 4L1BA 1JFSA 1BLXB 5C2YA 5A7DB 4FA6A 2MQKA 4DE8A 2AXZA 4LNUD 3B7TA 2A4ZA 2KCVA 1EF1C 2OOEA 2I1JA 1LQCA 5ENTD 3BQOA 5ENNA 5BT1A 2GRPB 2A6CA 2PXUA 1SZAA 1WAO1 2LYQA 3E34A 3D3MA 4BSXA 4DX1A 2Y3AA 4GA2A 3FTWA 3UFDA 2P9SG 2YINA 3FTXA 2IUOA 3DXMG 3ASNE 4MS6A 4MRUA 3FTZA 3D9PA 3CVXA 3E33A 4B89A 3QK0A 3L08A 4G8KA 4Z5CA 3KD7A 2NXPA 1B0NA 3CEQA 3TJPA 1X2LA 3PE5A 4DUIA 2QFCA 4A63B 4PU4C 1ZU2A 3RRMB 4HLEA 2F37A 3FUIA 1SQMA 3G2WA 3RAUA 2XXQA 4I8TA 4GPMA 4LUNU 3UM3A 4J8FA 5GAHi 3B7SA 3PREA 5AQ7A 4CEMA 1HS6A 5BV1A 4O8BA 2VYIA 3E32A 1O1TA 1NI1A 1N0RA 4G1TA 4JCYA 3CQCB 3PH0C 4KZCA 1UXCA 4U0UA 2KC7A 1TJCA 3ZHEA 3LEWA 3NXHA 4BX8A 1A5EA 2R63A 2JCGA 3I5PA 1K8KG 3FWVA 4PS7A 3R1FA 5C1DA 4C0MA 1E8ZA 4JL0A 3RO3A 4MLPA 3DM5A 3PE3A 2WXFA 3T5VA 5FZSA 3F6WA 2KATA 2GZUA 3GZCA 1SZ9A 3FU6A 1MX4A 4CDMA 3QWPA 2PXVA 4ATZD 4J0UA 1X81A 4PU3C 1VDYA 4K5AB 2LNMA 1E7VA 4Q96A 2KPJA 2ETBA 4FBIA 3MEKA 3UWPA 2WQ6A 4JD2G 4GZ3A 4BT9A 3UXGA 3D9LA 4OB4A 2XPZA 4Z5HA 2PPXA 4FN3A 2PXLA 2XZDG 2QYUA 2YHCA 3V2XA 3UIOC 2AUWA 3QOWA 3PNTB 1FCHA 4Q94A 1DWKA 3ASOE 4LERA 4HFGA 3UM0A 2IQCA 3NAWA 4XE0A 1H6KA 2HE0A 3L82A 3ZYKA 4F6RD 1DCQA 4N5CA 2GRMA 1TN6A 2BUGA 3ULEG 3VTXA 3PXPA 3ZEFA 2X6HA 3TELA 1TJFA 1KT1A 2OFYA 4GZCA 1L5JA 1DW9A 1XGWA 1LF8A 2JEKA 4OBMA 3QARA 4X4GA 2ZXWE 3NF1A 4YDEA 4GYYA 1YA0A 3S7FA 4KXKB 3TL5A 4MKTA 5E75A 4FP7A 3RU0A 3SBTB 2WXKA 4X4IA 3OQMA 3DPYA 2GRLA 2PUCA 2IF4A 4L2LA 1ZVVA 4A3VA 1MX6A 3V30A 4TXQA 4JEHA 1WG0A 3HXDA 3ESKA 3PZ2A 4ER7A 4G26A 1Z3YA 3FTUA 2IV1A 4YVQC 4DK5A 3G0TA 4KT6B 1HF8A 4JHJA 1UOHA 3EHRA 2DYSE 3CHRA 5KBAA 3ULQA 1JPLA 5DBKA 2PXEA 3PE4A 4HVBA 3Q79A 3JXIA 1FT2A 4LSZE 3IHYA 4EBAG 4IWRA 2J08A 2X6FA 3JQ0A 2O49A 2GGFA 1PERL 3NROA 2AXUA 3Q47B 4EQFA 4I43A 3MZLB 2D5VA 4M3OA 3KSQA 2VSXE 5D0OD 4G11A 2OEVA 4I6RA 5AJLA 2VSYA 3UT4A 3CV0A 2AW6A 3APDA 1PY1A 5AQAA 3C5RA 1TNUA 2AVPA 1OT8A 4NRHB 1AWCB 4N2QA 4NURA 2P9KG 3JXJA 1NW3A 1H6OA 3G2TA 4FHJA 5HS0A 4ER5A 4PU8A 2HM8A 1JWLA 1K3ZD 4YG7B 3G5GA 3FTYA 4A55A 1ADRA 3FUMA 5ENOD 1SA5A 2M63A 3CKBA 3CHPA 3GZDC 4GU5A 2Y4UA 2PNNA 3JUIA 4HI8A 3DSVA 3JCKC 3ZNGA 3ZKJA 4BY6A 1K1BA 3MKQB 2R5SA 1NL4A 4PS3A 1DULA 3ME5A 1AP7A 2KEIA 2ZU6B 2J09A 5D66A 1ELWA 1DC2A 5ENQD 2YHEA 1INZA 2J7UA 2HFZA 3HXFA 3ZPJA 3OTNA 1LMB3 1JUQA 2V8SE 3I4RB 3ZYLA 1HU3A 4I1MA 4GTPA 3TWVA 4JHRA 4J8YA 4DI3A 3UQ3A 4GYOA 4KZ0A 1ZAYA 3FEXA 1ZB1A 4ILHB 2VEOA 2IO3C 2IOSA 2LSVA 2KEJA 5FT9A 4BERA 1ZZCA 5BPPA 5KJKA 3LY8A 4B93B 1A17A 3X2QE 1S63A 4HRAA 1WM5A 1ELKA 1N54A 3V79K 1YCSB 2PM6A 5A6CA 4O1PA 4O6FA 2AWIA 3HYMB 3UM1A 3VLEA 3B13A 3N71A 5JUWA 5FWQA 1JWGA 3ZHIA 3ZXPA 4U8YD 2CHXA 2OVFA 2Y0BG 2P2CP 4WVLA 4JW1A 5CEDB 3EHMA 3VWSA 3JQ1A 2AXVA 3DEPA 2P9PG 2R05A 4L9PA 4J7WA 3U3WA 4FLBA 3RIBA 5JJTA 4UQYA 4GB9A 2ETAA 4HORA 1O4XA 2F8YA 2J49A 4LNGA 2VTBA 4LRZA 1H2TC 4AP2A 3GZDA 3OKZA 3Q9NC 2KXPC 3CVVA 1FPPA 2LYPA 2O38A 3PZ3A 2LYLA 3UINC 3PVLA 3E37A 2HO1A 3K9IA 4X8QA 2WXHA 3FH8A 3CK9A 3ZKCA 1R63A 4JPSA 2V4HC 2GW1A 1KPSB 4ZHBA 2IOLA 3ESLA 3LJNA 2UY1B 4NDWA 3FTSA 4A1SA 4D10C 2WMNA 1IQRA 2DIWA 5LOZA 4GTRA 2I2OA 4JA9A 3CVQA 2LXLA 4OAUC 2H6FA 3QB2A 5B3SE 5CBNA 1Z3XA 4GMRA 2UY1A 2WIUB 1B89A 1JCSA 3LJ3A 4ER3A 1PRVA 5HI7A 3FU0A 3ULYA 2FF4A 2IVQA 3AU5A 4XKCA 4KVMA 3LVRE 1KLXA 1MX2A 5FQ6A 4GTQA 1HZ4A 4Z58A 1KZPA 2CHWA 3P1UA 4BT8A 2PUFA 4XX5A 2BKGA 4C48B 4DPRA 5EDSA 5ARGA 4FHKA 2X3MA 4Z68A 4UWKA 2EWTA 3EU9A 4RQIA 1D8EA 4HOQA 3LCAA 1NP7A 3PZ4A 5BUZA 4L23A 3FUHA 4DX2A 4FADA 2ONDA 5ENRD 4WWPA 4EK9A 4CDNA 2CSFA 4F53A 3TEPA 4X4EA 5ANRA 2IJGX 3GYZA 1S64A 3Q7FA 5CCLA 3CIAA 1EDUA 1OCCE 2IONA 1BDIA 3I3NA 3T5XA 2LO6A 3UT7A 4URKA 3CR3A 3AU4A 2WXGA 3QAQA 3C72A 1SW6A 1OCRE 3C3QA 5EYPF 2PUGA 3BG1B 4UQZA 1ZZ9A 2ZGDA 5M72A 4NQ0A 3QYXA 4DX6D 3BUAA 4BEPA 3J5PA 5CHEE 4KYOB 4U07A 1KZOA 3QOUA 1HE8A 4ABNA 2ICTA 1HXIA 4L7TA 3ABME 3ABKE 3M9LA 1PRAA 4XZ4A 3RZZA 5G04J 3ABLE 3FFLA 3MKQA 3TWSA 4N3BA 3FYAA 1S7EA 1TN8A 2RFMA 5CEAA 4TUMA 4IRUA 3D9NA 4GCOA 5CERB 2L8NA 4EBAA 5CRVA 1Y9QA 3AG2E 4I1OB 1U3CA 1N11A 4N5QA 2PUAA 3CGHA 4ER0A 3MLFA 4I6TA 4ILIA 2FFHA 2FEZA 3D9KA 3FU5A 2HSGA 1DCEA 2BNMA 3JXDL 5DRTA 2E2EA 3RRUA 4R7LA 5FQ4A 4JHKA 4TRQA 1NERA 3TWTA 5ARFA 3QOXA 3DPDA 2L9BA 1OUVA 1U3DA 5G05C 2OR1L 3R7QA 1OWPA 2R03A 2VSOE 3FP3A 2ETCA 1Q2ZA 2KBXA 4U0SA 1WH6A 4B94A 3SI5A 2XXPA 3CROL 3FUFA 1Y8MA 3SCGA 2GROB 3CVYA 2CG3A 4UWGA 4XI0A 3NZLA 4QFVA 4GMLA 4JQDA 2PXBA 5AQBA 2X6JA 1SQ8A 2WXMA 5A23A 3AG1E 1BI8B 5G04C 3ZU7B 3U9WA 4JB8P 3Q5MA 1LTXA 1WDYA 3FH5A 3L6AA 2MOWA 2PL2A 2LUHA 3D9IA 4RSYA 1OCZE 3PEVB 3APFA 1OCOE 1RZRD 3KAEA 3RRNB 3FU3A 2PUEA 5CRUA 1X5BA 3V2OA 4AY6A 5BNWA 4WNGA 3KJXA 2BNOA 1POUA 4ACLA 3DXKG 1YYHA 3B7BA 3QWWA 4G23A 3SCHA 4K03A 2ZGGA 4U8VD 4M7CA 3ZPXA 3FHEA 2PXFA 1V54E 2KZ8A 3QFIA 1S0PA 4UWHA 3D9JA 1BI7B 2HCSA 3D9HA 4Y6WA 2IY0C 4A3TA 3LPZA 2V0PA 1BPOA 1O1SA 2RG8A 4ANWA 3JUEA 1QB2A 2VTBB 5JHBA 4GTTA 3MEJA 4EHMA 3EHNA 2PXQA 4YVOA 3DSTA 4DRXE 5DTMA 3O4ZA 4U8HA 3NB2A 2PXTA 3ZHMA 2DYRE 2P9UG 2WXNA 4ANXA 1ZZ6A 3AG4E 1BD8A 3Q9UC 1TNYA 5EN5D 3ZGQA 5FQ7A 3J5QB 3F51A 1HG5A 4TXRA 3IBEA 5B1BE 3U66A 2PQNA 4HRNA 3GZ1A 4P29A 4E85A 3CVWA 3DEOA 3F6QA 4HI9A 3FUJA 4MBGA 3ASHA 2XENA 1JCQA 3EHQA 3ONLA 4CYMD 4I17A 4XKBA 5AN8A 2FI7A 1HFAA 3LDZA 3Q73A 3B7HA 3HVEB 4N3CA 1TNZA 4ACKA 3OWQA 3Q78A 4UWFA 1OWLA 2XZTG 1XWRA 4AXHA 2PUBA 4AVXA 3EU5A 4EZIA 5H7PA 3AG3E 1IYGA 3SNXA 3DRAA 2XGSA 4WNDA 1FVHA 4OAVB 3TXMA 2MEZA 3SCFA 1X57A 4C0EA 3TAXA 4PH4B 1UN9A 4IN3B 1TNBA 2ZISA 2CFZA 4HBDA 3ZYMA 1HX8A 4F1PA 5EILA 3CKCA 4UQXA 3NOCD 4RG9A 3FUDA 4UI9C 1N0QA 3KSLA 2WXIA 4O60A 2VJ8A 4AJWA 5FQ8A 5GAGi 3SFYA 1HG2A 2DVWA 3SY2A 2XS8A 1E8YA 4I6UA 2F8XK 2FJRA 3UT8A 3UMVA 5CBOA 4I6JA 1PRUA 2KM4A 1NA0A 3EDTB 3G7DA 2BF0X 3CHSA 5IY5E 2PZIA 3L13A 1ZPQA 4HNAD 2H8RA 1N4RA 3A9ZA 2EF8A 2DWZA 3V31A 1U2VG 2IEJA 5DIZA 3FUNA 4XIFA 4WNFA 1G3NB 2XEVA 4F1SA 3UX4A 4YDWA 3OP9A 3CECA 1K1AA 1E8XA 2BKKB 3CSFA 4ME2A 5DTRA 2NYJA 5EKQD 2J7WA 1ZZ8A 3O48A 1R69A 2QC9A 3TG4A 1PNRA 2L0TB 4GYWA 3SGHA 1UG3A 2KEKA 3UPVA 2LYKA 1FVFA 1ZZ7A 1CJGA 3G2VA 3FH7A 1QZ2A 5BV0A 1BDHA 3S7JA 1S70B 3BS3A 1W3BA 2QY7A 3SFZA 3TWQA 3T8KA 4EPZA 1N52A 2FO1E 2WXOA 1XNFA 5LP0A 1WY6A 4BWRA 1HQ1A 3FDHA 3JYSA 1NEQA 2FO7A 2XRYA 2PXPA 3L54A 3UIPC 3LYAA 3UKRG 1SA4A 4JVSA 1QP4A 2XRZA 3L17A 4I6GA 1VPWA 3QQ6A 1IC8A 3TRBA 3G2UA 4KMOA 4GZ6A 3PNLB 5CMYA 3U4TA 3CHMA 1OY3D 3LFPA 1IHBA 1N94A 2XPIA 3IV0A 4HS2A 5LFAA 5KJLA 3OXLA 4F7AA 4FJZA 4FU3A 2IVBA 2L1PA 3GN5B 1EFAA 3ZXSA 3HRAA 3PS6A 1WETA 2O4AA 3PZ1A 5AIJA 5D2MC 3E30A 2C2LA 2XPYA 3W9FA 1JWFA 3PEUB 4QQIA 5AQ9A 2YNQA 4CT0A 1QPZA 5T3RA 1WH8A 2J4DA 4GMJA 4DLOA 3WXXA 3MKRA 4HLLA 3S7BA 2QYJA 4GAAA 4G8LA 3FMYA 1LD7A 4X4FA 2XCCA 4JA7A 3EIJA 2LAHA 1RZSA 3APCA 2KZTA 2XI8A 2CG2A 4I9CA 3MV2B 2IU7A 1YMPA 4J8DA 1DNPA 1PAQA 5LX8A 5E76A 4BTBA 3HDXA 3F52A 3P2BA 4IULA 3OQOA 4UWLA 4Y6CA 3MJWA 4EZKA 3DSWA 5CCMA 2RD0A 4PDXA 1YSEA 4BX9A 4U7EB 1D8DA 4B0ZA 1E3OC 2EILE 3G2SA 1MQSA 2P9IG 4G25A 3CK8A 3ASGA 3FEYA 3LS8A 5AENA 4FULA 1GW6A 4L2YA 3HXEA 2H6IA 1QQBA 5KWDA 2PM7A 2XS1A 3ZHEB 3EUSA 4EKIA 3S2AA 1MHQA 3HVEA 3ENEA 4HOTA 3D1NI 3L9TA 1E96B 4GZDA 2JVLA 4H7YA 3SHFA 3VLFA 1JH9A 3B7UX 4W9RA 3ONKA 2Y1LE 4ANVA 2Y4TA 3GZ2A 2M4HA 4PU7A 5FINA 2IU1A 5ANLA 4CGVA 4HQDA 1KT0A 1WIZA 5ITZF 1RZRA 3DSXA 4XI9A 2R17C 2CFUA 4GZ5A 3R9AB 2LLVA 1H2UA 2WM9A 5AYWD 2RFAA 1ZS4A 4HOUA 2PXDA 1TR4A 4AY5A 3D9OA 1RIOA 1Y6IA 2DBAA 3CVLA 3LY9A 3SBSA 3A9YA 3TWXA 4N3AA 3CSTA 1BU9A 5BW8C 4DJAA 3IXEA 2OCCE 4I1AA 3SO8A 1DVPA 2GRNB 3AJIA 5D0QD 3C3RA 5JHAA 2BNNA 2R59A 4NACA 2VQ2A 1LD8A 2V5FA 3TWWA 2ICPA 4LNBA 2VSNA 2PUDA 2DZNA 3ASDA 1E7UA 4B8AA 4YDYA 3HZIB 1H19A 4GHJA 4GA0A 3QKYA 4IYPA 3D9MA 4I6EA 3KZ3A 3AS8A 3CLCA 3EJNA 3HXCA 3R9MA 2DCPA 1OWMA 2GRQB 3RJVA 3HXBA 5JJ7A 4GTSA 1Y7YA 4J6IA 3NZUA 5DTQA 1TNOA 4YNDA 3ZVVA 1SVXA 3ZFWA 3L16A 4HRMB 3NZSA 2B6CA 5KJNA 1QBQA 1ZZBA 3BDNA 4LG6A 2EIJE 3QWVA 2PXKA 3RO2A 5EYLA 2MRIA 3R09A 2P9LG 4BESA 5FZQA 2XSDC 2J8SD 3T9KA 3GW4A 4NIKA 2I6HA 2EIKE 2V3CC 4BFRA 5HKPA 5FIOA 4N39A 3IKOB 2MYOA 2CROA 3T8MA 2AJAA 3DSUA 5JA4D 3L22A 3GBFA 3OMTA 4X4BA 1H0AA 3U64A 5ENSD 2WXPA 3UM2A 4B8CB 1ELRA 2P9NG 3WG7E 1P5QA 2Q7FA 2WPVA 1MYOA 5B1AE 3A9XA 5ENPD 3I4GA 4JCXA 3FTVA 4LEUA 3ZRHA 2KZTB 2BTDA 2ILRA 2V4LA 2JQEA 3EUVA 4AV7A 2MXDA 4APFA 2DZOA 1O5MA 4JXTA 4DE9A 2JABA 2YBDA 2KCKA 4ER6A 1OWOA 5DRYA 2BEDA 1E8WA 2EQXA 5JJ6A 3ML8A 3KS2A 5A7LA 3MCXA 2L49A 4WUYA 2HR2A 4WWOA 3EIQC 4IVZA 3H5TA 3QWGA 1RPEL 1RW2A 1N9AA 2RKKA 3Q7AA 1GT0C 2ZIRA 3ZW3A 3BEEA 4ILGA 2NSZA 3ISMC
chains in the Genus database with same CATH topology
2KCVA 1EF1C 2LYLA 2H8RA 2OOEA 1JFTA 2I1JA 1LQCA 3PVLA 1UW4B 2EF8A 4J1XA 2HO1A 4PS8A 3K9IA 5ENNA 5DIZA 5BT1A 2A6CA 2WQ7A 3FUNA 2WXHA 4WNFA 4XIFA 3FH8A 1SZAA 3CLJA 4X4HA 1WAO1 2XEVA 3CK9A 2LYQA 5KCMA 3UX4A 3ZKCA 2WXJA 4F1SA 2VGXA 3D3MA 3OQNA 3OP9A 4BSXA 2Y3AA 1R63A 4GA2A 4Z59A 4U04A 3CECA 3KEZA 1E8XA 1QP7A 4JPSA 3CSFA 4ME2A 4I2ZA 3FTWA 3UFDA 2XHEA 3DBSA 2GW1A 5EX0A 2IOLA 2WB2A 3QNKA 5EKQD 3TG5A 3ESLA 1ZZ8A 2YINA 2UY1B 4NDWA 3FTXA 3O48A 2IUOA 1R69A 3FTSA 2WMNA 4A1SA 4AIFA 4D10C 1IQRA 2DIWA 3TG4A 5LOZA 4MS6A 1PNRA 4MRUA 3FTZA 2L0TB 3D9PA 4GYWA 2I2OA 4OVVA 4EZJA 2LYSA 3CVXA 3CVYA 3SGHA 4B89A 3QK0A 3L08A 1UG3A 3CVQA 4JA9A 4Z5CA 3VK0A 2KEKA 3KD7A 3MGBA 3UPVA 2LYKA 1FVFA 1ZZ7A 1CJGA 2NXPA 1Z3XA 1B0NA 3FH7A 3G2VA 3QB2A 5G55A 3NQPA 1QZ2A 3CEQA 5HQ8A 1HF0A 4K0RA 3TJPA 2XJ3A 3S7DA 1BDHA 5BV0A 3S7JA 1X2LA 2UY1A 2WIUB 3BS3A 1W3BA 3KXAA 3FUKA 2QY7A 3SFZA 4Q69A 2OV8A 2QFCA 4ANUA 1QNFA 4PU4C 1ZU2A 2I9CA 4EPZA 1N52A 3RRMB 4YG1A 2JLBA 2WXOA 2LYRA 1XNFA 3HHMA 1WY6A 3FUIA 1SQMA 4BX9A 1B89A 4BWRA 5LP0A 3FDHA 4GPKA 3LJ3A 4OVUA 1PRVA 3G2WA 3JYSA 5HI7A 1NEQA 2FO7A 2XRYA 3CVNA 3FU0A 2VGXB 3L54A 2FF4A 3FY4A 4I8TA 2IVQA 3LYAA 1H2VC 3AU5A 3QDNA 4LUNU 3LXUX 4JVSA 2WUSR 1QP4A 4J8FA 4XKCA 2XRZA 3L17A 3LVRE 4I6GA 1VPWA 3B7SA 4KVMA 3QQ6A 1IC8A 1KLXA 3PREA 5FQ6A 4CEMA 3TRBA 1HS6A 2LNIA 3QC1A 3G2UA 4O8BA 5BV1A 4KMOA 3U66A 4GZ6A 3PNLB 2WVIA 1HZ4A 3E4BA 2VYIA 4Z58A 5CMYA 2CHWA 3AS4A 3P1UA 4BT8A 4A3VA 4G1TA 3U4TA 2PUFA 2NC9A 3CHMA 3IHVA 3LFPA 4CT4A 4XX5A 1UXDA 3GN5A 4DPRA 4JCYA 2XPIA 5EDSA 2B5AA 3IV0A 4HS2A 3CQCB 5ARGA 4FHKA 2X3MA 3PH0C 5LFAA 3PUKA 3SF4A 4KZCA 1UXCA 3OXLA 4PUCA 2EWTA 4UWKA 5KJLA 4U0UA 2KC7A 1TJCA 3ZHEA 3LEWA 1NA3A 4F7AA 2C0MA 4HOQA 2VGYA 3LCAA 3MV3B 4BX8A 1NP7A 2R63A 4FJZA 2JCGA 3I5PA 5BUZA 4FU3A 4L23A 3FWVA 3FUHA 3B7RL 2IVBA 4PS7A 3R1FA 2ONDA 2WXLA 3CHOA 4FADA 5C1DA 4C0MA 3LKUA 3ML9A 3GN5B 1E8ZA 4WWPA 4APOA 4CDNA 1EFAA 3ZXSA 2CSFA 1NZNA 3PS6A 1WETA 4JL0A 2O4AA 3RO3A 4F53A 4MLPA 5AIJA 4X4EA 5ANRA 3PE3A 2WXFA 3T5VA 2C2LA 2IJGX 3GYZA 5FZSA 3F6WA 2KATA 2XPYA 1IHGA 2GZUA 1SZ9A 5T4YA 3FU6A 1JWFA 5CCLA 4CDMA 3PEUB 3CIAA 4X4DA 1EDUA 3QWPA 3R7RA 2IONA 4J0UA 2YNQA 1PC2A 4FLHA 4CT0A 1BDIA 2I1KA 1LLIA 2YQ8A 1QPZA 3I3NA 3T5XA 4PU3C 5T3RA 1WH8A 2J4DA 2LO6A 4GMJA 2PQRA 3UT7A 4DLOA 4URKA 1VDYA 3CR3A 3AU4A 2WXGA 3MKRA 3QAQA 3WXXA 1E7VA 3S7BA 4Q96A 5FTPA 2KPJA 4OYSA 2PUGA 3BG1B 4FBIA 3JXBC 3MEKA 4GAAA 3SZ7A 4J8EA 4UQZA 2WQ6A 3Q49B 1ZZ9A 4GZ3A 4BT9A 3FMYA 3D9LA 3OAWA 4OB4A 4X4FA 2XPZA 4Z5HA 4X4CA 2PPXA 2FULA 2XCCA 3EIJA 4JA7A 4FN3A 4CCAA 2LAHA 1OSLA 3FULA 5M72A 4NQ0A 3QYXA 1RZSA 3APCA 2YHCA 2KZTA 3CQGB 2IVGA 2AUWA 2PIJA 2XI8A 2CG2A 4I9CA 3PNTB 1FCHA 2WXRA 1DWKA 3MV2B 4Q94A 2IU7A 4LERA 5CHEE 4HFGA 4KYOB 2IQCA 4U07A 3URZA 4XE0A 4J8DA 4CDRA 1DNPA 1H6KA 1PAQA 2P58C 3QOUA 3ZYKA 1HE8A 4ABNA 5E76A 2LSUA 4BTBA 5LX8A 3TGOA 3BG0B 2ICTA 4F3VA 1HXIA 4N5CA 2GRMA 3HDXA 3F52A 2BUGA 3P2BA 4IULA 4L7TA 5J90A 4WNEA 3OQOA 3VTXA 4UWLA 1PRAA 4Y6CA 1IQUA 3MJWA 4XZ4A 4EZKA 3RZZA 3PXPA 4G24A 4U0ZA 5FJYA 5J08A 5G04J 5CCMA 3FFLA 3MKQA 2RD0A 4PDXA 3ZEFA 1YSEA 4N3BA 2EBYA 2A5UA 3FYAA 1TJFA 1KT1A 2OFYA 2X6HA 1S7EA 3GZSA 4GZCA 4N2SA 1L5JA 2KCLA 4FJYA 4B0ZA 1DW9A 3OXFA 1E3OC 4IRUA 1XGWA 3G2SA 3D9NA 1LF8A 1MQSA 4GCOA 2JEKA 4G25A 3QARA 4X4GA 4JEUA 3CK8A 3NF1A 2L8NA 1OCTC 3ASGA 4GYYA 4EBAA 3SD5A 3AS5A 1Y9QA 2UWJG 1YA0A 2X6KA 1U3CA 3FEYA 3L1PA 3LS8A 4I1OB 2XQ0A 3S7FA 4KXKB 5AENA 3CK7A 2PUAA 4FULA 1GW6A 3CGHA 3HIZA 4L2YA 5CMWA 3TL5A 3MLFA 1QQBA 4RG6A 2PM7A 3ZHEB 4MKTA 3EUSA 4I6TA 4ILIA 3MYVA 3S2AA 5E75A 2FEZA 4FP7A 1MHQA 3HVEA 3RU0A 3D9KA 3ENEA 1HH8A 2HSGA 2WXKA 4X4IA 3FU5A 3D1NI 2WXQA 3OQMA 3PUJA 4HOTA 1E96B 2BNMA 2GRLA 3JXDL 4GZDA 5FZRA 2PUCA 2E2EA 3RRUA 4HOSA 4C9BB 2IF4A 4R7LA 5FQ4A 4JHKA 4TRQA 4L2LA 2JVLA 1NERA 5ARFA 4H7YA 3SHFA 1QQAA 3VLFA 1ZVVA 4KBQA 1JH9A 3DPDA 3SBTB 2L9BA 1OUVA 2WQHA 1EPUA 1U3DA 5G05C 2OR1L 3B7UX 1OWPA 4W9RA 3R7QA 3ONKA 2VSOE 4JEHA 3FP3A 4UI9K 3ESKA 4U0SA 4H7XA 1WH6A 4B94A 4GA1A 4ANVA 3SI5A 3RKVA 4G26A 5LCWC 3CROL 1Z3YA 2Y4TA 3FUFA 3FTUA 2IV1A 1Y8MA 3SCGA 3GZ2A 4YVQC 3TXMA 2CG3A 4KT6B 1HF8A 4UWGA 4JHJA 4XI0A 4F8DA 4DK5A 4PU7A 3CHRA 4QFVA 4WAFA 4GMLA 4JQDA 3ULQA 2X6JA 1JPLA 3FUEA 3OXGA 5DBKA 1SQ8A 2IU1A 5ANLA 1UJJA 4CRWA 2WXMA 5A23A 4CGVA 3Q15A 5G04C 3CVUA 4AM9A 3PE4A 3IVPA 3U9WA 4HVBA 2J9QA 2OVBA 1CQTA 1WIZA 1UTXA 1RZRA 1KT0A 3Q5MA 3RK6A 3FH5A 3L6AA 4XI9A 2R17C 2XCJA 2MOWA 2CFUA 2PL2A 4GZ5A 3R9AB 3IHYA 5LCWJ 3D9IA 4EBAG 4RSYA 4IWRA 4MCXA 2J08A 2X6FA 2O49A 3JQ0A 5AJDA 4J1WA 2GGFA 2HINA 1PERL 1E90A 1H2UA 2AXUA 2WM9A 3Q47B 4EQFA 4Z5DA 2HYZA 2X38A 5AYWD 1L1MA 3MZLB 4I43A 1ZS4A 2D5VA 3PEVB 4M3OA 4HOUA 2VSXE 3APFA 5D0OD 1RZRD 3KAEA 4AY5A 4G11A 3D9OA 1RIOA 3Q4AB 1Y6IA 3RRNB 2DBAA 4I6RA 5AJLA 3CVLA 3PRZA 3LY7A 3LY9A 2VSYA 3SBSA 1UJKA 3CVPA 3CV0A 3UT4A 4HLEA 3CHQA 2AW6A 3C98A 3FU3A 4UI9J 2PUEA 4V3IA 4DI4A 4N3AA 3APDA 1PY1A 3CSTA 1X5BA 2WMOA 3MX3A 5BW8C 4AY6A 4DJAA 5BNWA 4WNGA 3KJXA 2AVPA 2BNOA 1POUA 4U63A 4G2VA 4I1AA 4NRHB 4ACLA 1DVPA 4N2QA 5D0QD 4NURA 1LCCA 3QWWA 4FHJA 3SCHA 3G2TA 4G23A 4K03A 4BTAA 4AEZC 3DNVB 2BNNA 5JHAA 2R59A 4PU8A 4NACA 2VQ2A 2HM8A 3FHEA 1JWLA 3VTYA 1QP0A 2J07A 4YG7B 3LVQE 2LCVA 2KZ8A 3O9XA 1S0PA 3G5GA 3FTYA 4UWHA 2LAIA 3D9JA 2V5FA 4A55A 2ICPA 1ADRA 3S8QA 2VSNA 2XCBA 4YG4A 3FUMA 2M63A 4Y6WA 3VLDA 2PUDA 2X6IA 3CKBA 4A3TA 3ASDA 1E7UA 3LPZA 4B8AA 1ZUGA 4DLQA 2V0PA 3LISA 3CHPA 2PE5A 1BPOA 2RG8A 2J4BA 4ANWA 4GU5A 3HZIB 3IEGA 1H19A 2VTBB 4GHJA 4GA0A 5JHBA 3QKYA 2Y4UA 4TV3A 4IA8A 2L6JA 4IYPA 3D9MA 4I6EA 3EHNA 3KZ3A 3AS8A 3CLCA 3EJNA 3FYMA 3JUIA 4YVOA 2DCPA 4AOFA 5K98B 1OWMA 3O4ZA 4U8HA 3RJVA 2C0LA 5G05J 1LCDA 3JCKC 4Y42A 1ZBPA 5JJ7A 2XIUA 1Y7YA 4J6IA 4BY6A 3NZUA 3PDNA 3ZHMA 2MHKA 1TEZA 3QJZA 1UN8A 4YNDA 3MKQB 4A1GA 3ZVVA 2R5SA 2WXNA 4PS3A 3ZFWA 4ANXA 1ZZ6A 4EZLA 1AU7A 3L16A 2KEIA 2ZU6B 2J09A 3NZSA 5KJNA 4MCTA 1ZZBA 4TUUA 3BDNA 2XGMA 3ZGQA 1ELWA 5FQ7A 3QWVA 4E6HA 3RO2A 2MRIA 3MA5A 3UUXA 3F51A 1HG5A 2YHEA 1INZA 5FZQA 2XSDC 4GQMA 3IBEA 3GW4A 3ZPJA 3ZIMA 2I6HA 3OTNA 1LMB3 1JUQA 2V8SE 3I4RB 3BD1A 4BFRA 2PQNA 4KVOA 3GZ1A 4P29A 3ZYLA 4E85A 4N39A 1HU3A 3IKOB 4GCNA 4I1MA 3ZYQA 4JHRA 3CVWA 3FUJA 4DI3A 3UQ3A 4ATGA 3L13A 2CROA 4GYOA 3T8MA 3ASHA 4KZ0A 1ZAYA 4WWNA 3FEXA 4CGWA 2R1JL 4ILHB 3ONLA 3L22A 3GBFA 2IFUA 4LCTA 3OMTA 4X4BA 4RVBA 4I9EA 1QQEA 1H0AA 3U64A 2FBNA 2IOSA 4I17A 4XKBA 2LSVA 5EX3A 2LYJA 2KEJA 2E0IA 1ZZCA 2CHZA 2FI7A 2WXPA 5FT9A 5BPPA 1HFAA 3LDZA 3B7HA 4FC8A 4B8CB 5KJKA 3HVEB 4I2WA 4N3CA 5G2NA 1ELRA 4ACKA 3LY8A 1P5QA 2Q7FA 2XGOA 2BJCA 2WPVA 4UWFA 1EYHA 1OWLA 1A17A 3I4GA 1XWRA 4AXHA 5KJMA 2PUBA 4JCXA 4AVXA 1WM5A 4JC8A 3FTVA 1ELKA 1OWNA 1N54A 5T8IA 1IYGA 3SNXA 4LEUA 2PM6A 3ZRHA 2XGSA 5A6CA 4O6FA 4YARA 4WNDA 3JXCL 1FVHA 2AWIA 2BTDA 2KZTB 3HYMB 2ILRA 2V4LA 3PZDA 2MEZA 1Z6TA 3SCFA 1X57A 3B13A 3N71A 4HXIA 3VLEA 4C0EA 5FWQA 3TAXA 2L0IA 1JWGA 4JZYA 4AV7A 4PH4B 1UN9A 3ZHIA 3ASFA 4IN3B 4J8SA 2CFZA 2CHXA 2OVFA 4APFA 4JXTA 3ZYMA 1HX8A 1HO8A 3ZN3A 4JW1A 3EHMA 3CKCA 2KCKA 4UQXA 3JQ1A 4RG9A 3FUDA 1OWOA 2AXVA 4UI9C 4YBAA 2WXIA 3QF3A 2EQXA 1E8WA 3U3WA 4EECA 2VJ8A 3ML8A 5JJ6A 3KS2A 5A7LA 5FQ8A 4AJWA 3TXNA 4FLBA 1HG2A 3RIBA 3MCXA 4L1BA 2L49A 5JJTA 4UQYA 1E8YA 1JFSA 4I6UA 5C2YA 4GB9A 4WUYA 2HR2A 4WWOA 4HORA 2FJRA 3EIQC 1O4XA 2MQKA 2J49A 4IVZA 5A7DB 3UT8A 4FA6A 2VTBA 3UMVA 3H5TA 4I6JA 1PRUA 2AXZA 2KM4A 1NA0A 1H2TC 3EDTB 3QWGA 3G7DA 1RPEL 2BF0X 3B7TA 4LRZA 4AP2A 3CVVA 1GT0C 2LYPA 3CHSA 2O38A 2PZIA 3ZW3A 3BEEA 1ZPQA 4ILGA 2NSZA 2A4ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OR1 L;  2LYL A;  2H8R A;  1JFT A;  1LQC A;  2EF8 A;  4J1X A;  4X4D A;  1WH6 A;  1ZZ6 A;  2A6C A;  1AU7 A;  2KEI A;  3CRO L;  4X4H A;  2IV1 A;  2LYQ A;  3F6W A;  1BDI A;  3SCG A;  3ZKC A;  1LLI A;  1QPZ A;  3OQN A;  3OP9 A;  4F8D A;  4PU3 C;  1WH8 A;  4MCT A;  1ZZB A;  4PU7 A;  3BDN A;  1R63 A;  4Z59 A;  3CEC A;  4JQD A;  1QP7 A;  2KPJ A;  2PUG A;  3UFD A;  1SQ8 A;  3F51 A;  4FBI A;  3JXB C;  2XSD C;  4GQM A;  3IVP A;  1ZZ8 A;  4NDW A;  1ZZ9 A;  1CQT A;  1WIZ A;  1UTX A;  2IUO A;  1R69 A;  1RZR A;  1LMB 3;  2XCJ A;  3BD1 A;  3FMY A;  1PNR A;  4OB4 A;  4X4F A;  4Z5H A;  2LYS A;  2PPX A;  4X4C A;  4IWR A;  4MCX A;  4FN3 A;  2O49 A;  2CRO A;  4J1W A;  4Z5C A;  3VK0 A;  2HIN A;  2KEK A;  1OSL A;  3QYX A;  2AXU A;  1RZS A;  1PER L;  1ZAY A;  2LYK A;  4Z5D A;  1ZZ7 A;  1CJG A;  1B0N A;  1L1M A;  2R1J L;  1ZS4 A;  2IVG A;  2D5V A;  2AUW A;  2PIJ A;  2XI8 A;  3GBF A;  1HF0 A;  2XJ3 A;  1RZR D;  1BDH A;  1X2L A;  3OMT A;  2WIU B;  3BS3 A;  1DWK A;  4X4B A;  2IU7 A;  3KXA A;  1RIO A;  4I6R A;  4PU4 C;  4YG1 A;  2LYJ A;  2KEJ A;  1ZZC A;  2LYR A;  2AW6 A;  2ICT A;  3B7H A;  2PUE A;  1PRV A;  1NEQ A;  2GRM A;  3F52 A;  2BJC A;  4I8T A;  2IVQ A;  3KJX A;  2BNO A;  3OQO A;  1POU A;  1PRA A;  1XWR A;  2WUS R;  1QP4 A;  3RZZ A;  3PXP A;  2PUB A;  4JCX A;  1VPW A;  1LCC A;  3QQ6 A;  3SCH A;  1IC8 A;  3DNV B;  1YSE A;  2BNN A;  2EBY A;  3TRB A;  3FYA A;  2OFY A;  4PU8 A;  1S7E A;  4O8B A;  4YAR A;  3JXC L;  2AWI A;  2MEZ A;  1DW9 A;  3SCF A;  1X57 A;  4Z58 A;  1E3O C;  1JWL A;  1QP0 A;  4YG7 B;  2LCV A;  2KZ8 A;  3O9X A;  3G5G A;  3ZHI A;  4X4G A;  2PUF A;  3LFP A;  1UXD A;  2ICP A;  2L8N A;  3GN5 A;  1OCT C;  4JCY A;  1ADR A;  2B5A A;  3S8Q A;  4YG4 A;  1Y9Q A;  2PUD A;  3L1P A;  1UXC A;  1ZUG A;  2EWT A;  2PUA A;  2AXV A;  3LIS A;  2PE5 A;  4YBA A;  3QF3 A;  3MLF A;  1QQB A;  3U3W A;  3HZI B;  5A7L A;  2R63 A;  3EUS A;  4GHJ A;  2JCG A;  4I6T A;  3ZHM A;  2L49 A;  4IA8 A;  1JFS A;  2IVB A;  3R1F A;  2HSG A;  4I6U A;  4X4I A;  3D1N I;  3KZ3 A;  3OQM A;  3CLC A;  3FYM A;  2FJR A;  3GN5 B;  1O4X A;  2BNM A;  2GRL A;  2MQK A;  4IVZ A;  5K98 B;  3JXD L;  1EFA A;  2CSF A;  3H5T A;  1WET A;  2PUC A;  1PRU A;  2AXZ A;  2O4A A;  3QWG A;  3G7D A;  4X4E A;  4Y42 A;  1LCD A;  1RPE L;  2XIU A;  1GT0 C;  2LYP A;  2JVL A;  1NER A;  1Y7Y A;  2O38 A;  1QQA A;  1ZVV A;  1ZPQ A;  1JH9 A;  2GZU A; 
#chains in the Genus database with same CATH topology
 3RSE G;  1JFT A;  1UW4 B;  4J1X A;  4PS8 A;  1U2Z A;  4U96 D;  2WQ7 A;  1N4S A;  5CEC B;  3CLJ A;  4X4H A;  2WXJ A;  2VGX A;  3OQN A;  1FT1 A;  2IO2 C;  4U04 A;  4Z59 A;  2GRR B;  3KEZ A;  1QP7 A;  4I2Z A;  4CZ2 D;  2XHE A;  3DBS A;  5EX0 A;  2WB2 A;  3QNK A;  3TG5 A;  4AIF A;  3DSS A;  4EZJ A;  4OVV A;  2LYS A;  4TXP A;  3GUU A;  5EID A;  3VK0 A;  1D9S A;  3MGB A;  3KEA A;  4DX5 D;  5G55 A;  3NQP A;  5HQ8 A;  1HF0 A;  4K0R A;  2XJ3 A;  3S7D A;  4Q69 A;  3KXA A;  3FUK A;  2OV8 A;  4ANU A;  1QNF A;  2I9C A;  4YG1 A;  2JLB A;  3HHM A;  2LYR A;  5BXU A;  2LLW A;  4ZFH A;  4GPK A;  4OVU A;  5KNH D;  3B95 A;  3CVN A;  2VGX B;  3FY4 A;  1H2V C;  3QDN A;  3LXU X;  2WUS R;  1TN7 A;  3AAA C;  5HRY A;  2LNI A;  3QC1 A;  2WVI A;  3E4B A;  3HG0 D;  2V5Q C;  3TFL A;  3AS4 A;  2NC9 A;  3IHV A;  4CT4 A;  1IXV A;  1UXD A;  3GN5 A;  2B5A A;  3PUK A;  3SF4 A;  4PUC A;  1NA3 A;  2C0M A;  2VGY A;  3MV3 B;  3SX0 A;  3B7R L;  3CHO A;  2WXL A;  3LKU A;  3ML9 A;  4APO A;  4Q2J A;  1NZN A;  3TWU A;  1IHG A;  4EKG A;  5T4Y A;  2R2L A;  4X4D A;  2R02 A;  3R7R A;  1N4Q A;  1PC2 A;  4FLH A;  2I1K A;  1LLI A;  2YQ8 A;  2PQR A;  2B0O E;  3TWR A;  2LXM A;  5FTP A;  4OYS A;  1QZX A;  3JXB C;  4U95 D;  3SZ7 A;  4J8E A;  3Q49 B;  1O1R A;  3KL4 A;  4DX7 D;  4GTO A;  3OAW A;  4X4C A;  4CCA A;  2FUL A;  3FUL A;  1OSL A;  3CQG B;  2IVG A;  2PIJ A;  2WXR A;  3URZ A;  4CDR A;  2P58 C;  3TGO A;  2LSU A;  3BG0 B;  4F3V A;  2VGE A;  3DWL G;  5J90 A;  4WNE A;  1IQU A;  5J08 A;  4YDO A;  4U0Z A;  4G24 A;  1H6P A;  5FJY A;  5KCM A;  2EBY A;  2A5U A;  3GZS A;  4N2S A;  2KCL A;  4FJY A;  3OXF A;  4JEU A;  1OCT C;  3UTM A;  3SD5 A;  3AS5 A;  2UWJ G;  2X6K A;  3L1P A;  2XQ0 A;  3CK7 A;  3HIZ A;  4K5B A;  5CMW A;  4RG6 A;  2Y69 E;  3MYV A;  3PUJ A;  1HH8 A;  2WXQ A;  3BU8 A;  5AAO A;  5FZR A;  4HOS A;  4C9B B;  1QQA A;  4KBQ A;  4HB5 A;  2WQH A;  1EPU A;  4EQZ A;  4RLY A;  4UI9 K;  4H7X A;  4O1O A;  3C3O A;  4GA1 A;  5LCW C;  3RKV A;  2H6G A;  3ZUV B;  4F8D A;  1RZ4 A;  4WAF A;  3FUE A;  3OXG A;  4CRW A;  1UJJ A;  2XEE A;  3Q15 A;  3CVU A;  4AM9 A;  3IVP A;  2J9Q A;  2OVB A;  1CQT A;  1MJ0 A;  1UTX A;  1NFI E;  3RK6 A;  2XCJ A;  2H6H A;  4MCX A;  5AJD A;  4J1W A;  1N4P A;  2HIN A;  1IKN D;  1E90 A;  2F0Y A;  4BET A;  4Z5D A;  2HYZ A;  2X38 A;  1L1M A;  3UKU G;  3Q4A B;  3PRZ A;  3LY7 A;  1UJK A;  3CVP A;  4K5C A;  3CHQ A;  3C98 A;  4UI9 J;  4V3I A;  4DI4 A;  3MX3 A;  2WMO A;  1V55 E;  4U63 A;  4G2V A;  3Q75 A;  3NBN B;  2XXA A;  1Z5S C;  4XEI G;  2XEH A;  1LCC A;  4HRL A;  4BTA A;  5DT2 A;  1JCR A;  4AEZ C;  3DNV B;  3VTY A;  4GTM A;  1QP0 A;  2J07 A;  3LVQ E;  2LCV A;  3O9X A;  2LAI A;  3S8Q A;  2XCB A;  3VLD A;  4YG4 A;  2X6I A;  3UI2 A;  1ZUG A;  4DLQ A;  3LIS A;  2PE5 A;  2J4B A;  3IEG A;  5AAR A;  4TV3 A;  3SQV A;  4IA8 A;  2L6J A;  3FYM A;  4AOF A;  5K98 B;  1MFQ C;  2C0L A;  5G05 J;  1LCD A;  2HCN A;  4Y42 A;  1ZBP A;  2XIU A;  3PDN A;  2MHK A;  1TEZ A;  3QJZ A;  1UN8 A;  1OXJ A;  4A1G A;  4EZL A;  1AU7 A;  3LQX A;  5BXO A;  5EIB E;  4MCT A;  4TUU A;  4UUC A;  2XGM A;  2OEW A;  4E6H A;  3MA5 A;  3UUX A;  2ODR D;  4GQM A;  3ZIM A;  2A5E A;  2EIM E;  3BD1 A;  4KVO A;  4GCN A;  3ZYQ A;  4ATG A;  4WWN A;  1QYM A;  4CGW A;  2R1J L;  3SFX A;  2IFU A;  4LCT A;  4RVB A;  4I9E A;  1QQE A;  2FBN A;  5EX3 A;  2LYJ A;  2E0I A;  2CHZ A;  4FC8 A;  3SR4 A;  4I2W A;  5G2N A;  2XGO A;  4GTV A;  2BJC A;  1EYH A;  5KJM A;  4JC8 A;  1OWN A;  3NDB B;  5T8I A;  5JMN D;  5DSX A;  4YAR A;  5LCW J;  3JXC L;  3PZD A;  2QZA A;  1Z6T A;  3W9G A;  4HXI A;  1N95 A;  2L0I A;  4JZY A;  4J8S A;  3ASF A;  2EIN E;  4BSZ B;  3ZN3 A;  1HO8 A;  1TYQ G;  5KNG A;  2L6B A;  1MZC A;  4YBA A;  3NOG D;  3QF3 A;  4EEC A;  3TXN A;  4L1B A;  1JFS A;  1BLX B;  5C2Y A;  5A7D B;  4FA6 A;  2MQK A;  4DE8 A;  2AXZ A;  4LNU D;  3B7T A;  2A4Z A;  2KCV A;  1EF1 C;  2OOE A;  2I1J A;  1LQC A;  5ENT D;  3BQO A;  5ENN A;  5BT1 A;  2GRP B;  2A6C A;  2PXU A;  1SZA A;  1WAO 1;  2LYQ A;  3E34 A;  3D3M A;  4BSX A;  4DX1 A;  2Y3A A;  4GA2 A;  3FTW A;  3UFD A;  2P9S G;  2YIN A;  3FTX A;  2IUO A;  3DXM G;  3ASN E;  4MS6 A;  4MRU A;  3FTZ A;  3D9P A;  3CVX A;  3E33 A;  4B89 A;  3QK0 A;  3L08 A;  4G8K A;  4Z5C A;  3KD7 A;  2NXP A;  1B0N A;  3CEQ A;  3TJP A;  1X2L A;  3PE5 A;  4DUI A;  2QFC A;  4A63 B;  4PU4 C;  1ZU2 A;  3RRM B;  4HLE A;  2F37 A;  3FUI A;  1SQM A;  3G2W A;  3RAU A;  2XXQ A;  4I8T A;  4GPM A;  4LUN U;  3UM3 A;  4J8F A;  5GAH i;  3B7S A;  3PRE A;  5AQ7 A;  4CEM A;  1HS6 A;  5BV1 A;  4O8B A;  2VYI A;  3E32 A;  1O1T A;  1NI1 A;  1N0R A;  4G1T A;  4JCY A;  3CQC B;  3PH0 C;  4KZC A;  1UXC A;  4U0U A;  2KC7 A;  1TJC A;  3ZHE A;  3LEW A;  3NXH A;  4BX8 A;  1A5E A;  2R63 A;  2JCG A;  3I5P A;  1K8K G;  3FWV A;  4PS7 A;  3R1F A;  5C1D A;  4C0M A;  1E8Z A;  4JL0 A;  3RO3 A;  4MLP A;  3DM5 A;  3PE3 A;  2WXF A;  3T5V A;  5FZS A;  3F6W A;  2KAT A;  2GZU A;  3GZC A;  1SZ9 A;  3FU6 A;  1MX4 A;  4CDM A;  3QWP A;  2PXV A;  4ATZ D;  4J0U A;  1X81 A;  4PU3 C;  1VDY A;  4K5A B;  2LNM A;  1E7V A;  4Q96 A;  2KPJ A;  2ETB A;  4FBI A;  3MEK A;  3UWP A;  2WQ6 A;  4JD2 G;  4GZ3 A;  4BT9 A;  3UXG A;  3D9L A;  4OB4 A;  2XPZ A;  4Z5H A;  2PPX A;  4FN3 A;  2PXL A;  2XZD G;  2QYU A;  2YHC A;  3V2X A;  3UIO C;  2AUW A;  3QOW A;  3PNT B;  1FCH A;  4Q94 A;  1DWK A;  3ASO E;  4LER A;  4HFG A;  3UM0 A;  2IQC A;  3NAW A;  4XE0 A;  1H6K A;  2HE0 A;  3L82 A;  3ZYK A;  4F6R D;  1DCQ A;  4N5C A;  2GRM A;  1TN6 A;  2BUG A;  3ULE G;  3VTX A;  3PXP A;  3ZEF A;  2X6H A;  3TEL A;  1TJF A;  1KT1 A;  2OFY A;  4GZC A;  1L5J A;  1DW9 A;  1XGW A;  1LF8 A;  2JEK A;  4OBM A;  3QAR A;  4X4G A;  2ZXW E;  3NF1 A;  4YDE A;  4GYY A;  1YA0 A;  3S7F A;  4KXK B;  3TL5 A;  4MKT A;  5E75 A;  4FP7 A;  3RU0 A;  3SBT B;  2WXK A;  4X4I A;  3OQM A;  3DPY A;  2GRL A;  2PUC A;  2IF4 A;  4L2L A;  1ZVV A;  4A3V A;  1MX6 A;  3V30 A;  4TXQ A;  4JEH A;  1WG0 A;  3HXD A;  3ESK A;  3PZ2 A;  4ER7 A;  4G26 A;  1Z3Y A;  3FTU A;  2IV1 A;  4YVQ C;  4DK5 A;  3G0T A;  4KT6 B;  1HF8 A;  4JHJ A;  1UOH A;  3EHR A;  2DYS E;  3CHR A;  5KBA A;  3ULQ A;  1JPL A;  5DBK A;  2PXE A;  3PE4 A;  4HVB A;  3Q79 A;  3JXI A;  1FT2 A;  4LSZ E;  3IHY A;  4EBA G;  4IWR A;  2J08 A;  2X6F A;  3JQ0 A;  2O49 A;  2GGF A;  1PER L;  3NRO A;  2AXU A;  3Q47 B;  4EQF A;  4I43 A;  3MZL B;  2D5V A;  4M3O A;  3KSQ A;  2VSX E;  5D0O D;  4G11 A;  2OEV A;  4I6R A;  5AJL A;  2VSY A;  3UT4 A;  3CV0 A;  2AW6 A;  3APD A;  1PY1 A;  5AQA A;  3C5R A;  1TNU A;  2AVP A;  1OT8 A;  4NRH B;  1AWC B;  4N2Q A;  4NUR A;  2P9K G;  3JXJ A;  1NW3 A;  1H6O A;  3G2T A;  4FHJ A;  5HS0 A;  4ER5 A;  4PU8 A;  2HM8 A;  1JWL A;  1K3Z D;  4YG7 B;  3G5G A;  3FTY A;  4A55 A;  1ADR A;  3FUM A;  5ENO D;  1SA5 A;  2M63 A;  3CKB A;  3CHP A;  3GZD C;  4GU5 A;  2Y4U A;  2PNN A;  3JUI A;  4HI8 A;  3DSV A;  3JCK C;  3ZNG A;  3ZKJ A;  4BY6 A;  1K1B A;  3MKQ B;  2R5S A;  1NL4 A;  4PS3 A;  1DUL A;  3ME5 A;  1AP7 A;  2KEI A;  2ZU6 B;  2J09 A;  5D66 A;  1ELW A;  1DC2 A;  5ENQ D;  2YHE A;  1INZ A;  2J7U A;  2HFZ A;  3HXF A;  3ZPJ A;  3OTN A;  1LMB 3;  1JUQ A;  2V8S E;  3I4R B;  3ZYL A;  1HU3 A;  4I1M A;  4GTP A;  3TWV A;  4JHR A;  4J8Y A;  4DI3 A;  3UQ3 A;  4GYO A;  4KZ0 A;  1ZAY A;  3FEX A;  1ZB1 A;  4ILH B;  2VEO A;  2IO3 C;  2IOS A;  2LSV A;  2KEJ A;  5FT9 A;  4BER A;  1ZZC A;  5BPP A;  5KJK A;  3LY8 A;  4B93 B;  1A17 A;  3X2Q E;  1S63 A;  4HRA A;  1WM5 A;  1ELK A;  1N54 A;  3V79 K;  1YCS B;  2PM6 A;  5A6C A;  4O1P A;  4O6F A;  2AWI A;  3HYM B;  3UM1 A;  3VLE A;  3B13 A;  3N71 A;  5JUW A;  5FWQ A;  1JWG A;  3ZHI A;  3ZXP A;  4U8Y D;  2CHX A;  2OVF A;  2Y0B G;  2P2C P;  4WVL A;  4JW1 A;  5CED B;  3EHM A;  3VWS A;  3JQ1 A;  2AXV A;  3DEP A;  2P9P G;  2R05 A;  4L9P A;  4J7W A;  3U3W A;  4FLB A;  3RIB A;  5JJT A;  4UQY A;  4GB9 A;  2ETA A;  4HOR A;  1O4X A;  2F8Y A;  2J49 A;  4LNG A;  2VTB A;  4LRZ A;  1H2T C;  4AP2 A;  3GZD A;  3OKZ A;  3Q9N C;  2KXP C;  3CVV A;  1FPP A;  2LYP A;  2O38 A;  3PZ3 A;  2LYL A;  3UIN C;  3PVL A;  3E37 A;  2HO1 A;  3K9I A;  4X8Q A;  2WXH A;  3FH8 A;  3CK9 A;  3ZKC A;  1R63 A;  4JPS A;  2V4H C;  2GW1 A;  1KPS B;  4ZHB A;  2IOL A;  3ESL A;  3LJN A;  2UY1 B;  4NDW A;  3FTS A;  4A1S A;  4D10 C;  2WMN A;  1IQR A;  2DIW A;  5LOZ A;  4GTR A;  2I2O A;  4JA9 A;  3CVQ A;  2LXL A;  4OAU C;  2H6F A;  3QB2 A;  5B3S E;  5CBN A;  1Z3X A;  4GMR A;  2UY1 A;  2WIU B;  1B89 A;  1JCS A;  3LJ3 A;  4ER3 A;  1PRV A;  5HI7 A;  3FU0 A;  3ULY A;  2FF4 A;  2IVQ A;  3AU5 A;  4XKC A;  4KVM A;  3LVR E;  1KLX A;  1MX2 A;  5FQ6 A;  4GTQ A;  1HZ4 A;  4Z58 A;  1KZP A;  2CHW A;  3P1U A;  4BT8 A;  2PUF A;  4XX5 A;  2BKG A;  4C48 B;  4DPR A;  5EDS A;  5ARG A;  4FHK A;  2X3M A;  4Z68 A;  4UWK A;  2EWT A;  3EU9 A;  4RQI A;  1D8E A;  4HOQ A;  3LCA A;  1NP7 A;  3PZ4 A;  5BUZ A;  4L23 A;  3FUH A;  4DX2 A;  4FAD A;  2OND A;  5ENR D;  4WWP A;  4EK9 A;  4CDN A;  2CSF A;  4F53 A;  3TEP A;  4X4E A;  5ANR A;  2IJG X;  3GYZ A;  1S64 A;  3Q7F A;  5CCL A;  3CIA A;  1EDU A;  1OCC E;  2ION A;  1BDI A;  3I3N A;  3T5X A;  2LO6 A;  3UT7 A;  4URK A;  3CR3 A;  3AU4 A;  2WXG A;  3QAQ A;  3C72 A;  1SW6 A;  1OCR E;  3C3Q A;  5EYP F;  2PUG A;  3BG1 B;  4UQZ A;  1ZZ9 A;  2ZGD A;  5M72 A;  4NQ0 A;  3QYX A;  4DX6 D;  3BUA A;  4BEP A;  3J5P A;  5CHE E;  4KYO B;  4U07 A;  1KZO A;  3QOU A;  1HE8 A;  4ABN A;  2ICT A;  1HXI A;  4L7T A;  3ABM E;  3ABK E;  3M9L A;  1PRA A;  4XZ4 A;  3RZZ A;  5G04 J;  3ABL E;  3FFL A;  3MKQ A;  3TWS A;  4N3B A;  3FYA A;  1S7E A;  1TN8 A;  2RFM A;  5CEA A;  4TUM A;  4IRU A;  3D9N A;  4GCO A;  5CER B;  2L8N A;  4EBA A;  5CRV A;  1Y9Q A;  3AG2 E;  4I1O B;  1U3C A;  1N11 A;  4N5Q A;  2PUA A;  3CGH A;  4ER0 A;  3MLF A;  4I6T A;  4ILI A;  2FFH A;  2FEZ A;  3D9K A;  3FU5 A;  2HSG A;  1DCE A;  2BNM A;  3JXD L;  5DRT A;  2E2E A;  3RRU A;  4R7L A;  5FQ4 A;  4JHK A;  4TRQ A;  1NER A;  3TWT A;  5ARF A;  3QOX A;  3DPD A;  2L9B A;  1OUV A;  1U3D A;  5G05 C;  2OR1 L;  3R7Q A;  1OWP A;  2R03 A;  2VSO E;  3FP3 A;  2ETC A;  1Q2Z A;  2KBX A;  4U0S A;  1WH6 A;  4B94 A;  3SI5 A;  2XXP A;  3CRO L;  3FUF A;  1Y8M A;  3SCG A;  2GRO B;  3CVY A;  2CG3 A;  4UWG A;  4XI0 A;  3NZL A;  4QFV A;  4GML A;  4JQD A;  2PXB A;  5AQB A;  2X6J A;  1SQ8 A;  2WXM A;  5A23 A;  3AG1 E;  1BI8 B;  5G04 C;  3ZU7 B;  3U9W A;  4JB8 P;  3Q5M A;  1LTX A;  1WDY A;  3FH5 A;  3L6A A;  2MOW A;  2PL2 A;  2LUH A;  3D9I A;  4RSY A;  1OCZ E;  3PEV B;  3APF A;  1OCO E;  1RZR D;  3KAE A;  3RRN B;  3FU3 A;  2PUE A;  5CRU A;  1X5B A;  3V2O A;  4AY6 A;  5BNW A;  4WNG A;  3KJX A;  2BNO A;  1POU A;  4ACL A;  3DXK G;  1YYH A;  3B7B A;  3QWW A;  4G23 A;  3SCH A;  4K03 A;  2ZGG A;  4U8V D;  4M7C A;  3ZPX A;  3FHE A;  2PXF A;  1V54 E;  2KZ8 A;  3QFI A;  1S0P A;  4UWH A;  3D9J A;  1BI7 B;  2HCS A;  3D9H A;  4Y6W A;  2IY0 C;  4A3T A;  3LPZ A;  2V0P A;  1BPO A;  1O1S A;  2RG8 A;  4ANW A;  3JUE A;  1QB2 A;  2VTB B;  5JHB A;  4GTT A;  3MEJ A;  4EHM A;  3EHN A;  2PXQ A;  4YVO A;  3DST A;  4DRX E;  5DTM A;  3O4Z A;  4U8H A;  3NB2 A;  2PXT A;  3ZHM A;  2DYR E;  2P9U G;  2WXN A;  4ANX A;  1ZZ6 A;  3AG4 E;  1BD8 A;  3Q9U C;  1TNY A;  5EN5 D;  3ZGQ A;  5FQ7 A;  3J5Q B;  3F51 A;  1HG5 A;  4TXR A;  3IBE A;  5B1B E;  3U66 A;  2PQN A;  4HRN A;  3GZ1 A;  4P29 A;  4E85 A;  3CVW A;  3DEO A;  3F6Q A;  4HI9 A;  3FUJ A;  4MBG A;  3ASH A;  2XEN A;  1JCQ A;  3EHQ A;  3ONL A;  4CYM D;  4I17 A;  4XKB A;  5AN8 A;  2FI7 A;  1HFA A;  3LDZ A;  3Q73 A;  3B7H A;  3HVE B;  4N3C A;  1TNZ A;  4ACK A;  3OWQ A;  3Q78 A;  4UWF A;  1OWL A;  2XZT G;  1XWR A;  4AXH A;  2PUB A;  4AVX A;  3EU5 A;  4EZI A;  5H7P A;  3AG3 E;  1IYG A;  3SNX A;  3DRA A;  2XGS A;  4WND A;  1FVH A;  4OAV B;  3TXM A;  2MEZ A;  3SCF A;  1X57 A;  4C0E A;  3TAX A;  4PH4 B;  1UN9 A;  4IN3 B;  1TNB A;  2ZIS A;  2CFZ A;  4HBD A;  3ZYM A;  1HX8 A;  4F1P A;  5EIL A;  3CKC A;  4UQX A;  3NOC D;  4RG9 A;  3FUD A;  4UI9 C;  1N0Q A;  3KSL A;  2WXI A;  4O60 A;  2VJ8 A;  4AJW A;  5FQ8 A;  5GAG i;  3SFY A;  1HG2 A;  2DVW A;  3SY2 A;  2XS8 A;  1E8Y A;  4I6U A;  2F8X K;  2FJR A;  3UT8 A;  3UMV A;  5CBO A;  4I6J A;  1PRU A;  2KM4 A;  1NA0 A;  3EDT B;  3G7D A;  2BF0 X;  3CHS A;  5IY5 E;  2PZI A;  3L13 A;  1ZPQ A;  4HNA D;  2H8R A;  1N4R A;  3A9Z A;  2EF8 A;  2DWZ A;  3V31 A;  1U2V G;  2IEJ A;  5DIZ A;  3FUN A;  4XIF A;  4WNF A;  1G3N B;  2XEV A;  4F1S A;  3UX4 A;  4YDW A;  3OP9 A;  3CEC A;  1K1A A;  1E8X A;  2BKK B;  3CSF A;  4ME2 A;  5DTR A;  2NYJ A;  5EKQ D;  2J7W A;  1ZZ8 A;  3O48 A;  1R69 A;  2QC9 A;  3TG4 A;  1PNR A;  2L0T B;  4GYW A;  3SGH A;  1UG3 A;  2KEK A;  3UPV A;  2LYK A;  1FVF A;  1ZZ7 A;  1CJG A;  3G2V A;  3FH7 A;  1QZ2 A;  5BV0 A;  1BDH A;  3S7J A;  1S70 B;  3BS3 A;  1W3B A;  2QY7 A;  3SFZ A;  3TWQ A;  3T8K A;  4EPZ A;  1N52 A;  2FO1 E;  2WXO A;  1XNF A;  5LP0 A;  1WY6 A;  4BWR A;  1HQ1 A;  3FDH A;  3JYS A;  1NEQ A;  2FO7 A;  2XRY A;  2PXP A;  3L54 A;  3UIP C;  3LYA A;  3UKR G;  1SA4 A;  4JVS A;  1QP4 A;  2XRZ A;  3L17 A;  4I6G A;  1VPW A;  3QQ6 A;  1IC8 A;  3TRB A;  3G2U A;  4KMO A;  4GZ6 A;  3PNL B;  5CMY A;  3U4T A;  3CHM A;  1OY3 D;  3LFP A;  1IHB A;  1N94 A;  2XPI A;  3IV0 A;  4HS2 A;  5LFA A;  5KJL A;  3OXL A;  4F7A A;  4FJZ A;  4FU3 A;  2IVB A;  2L1P A;  3GN5 B;  1EFA A;  3ZXS A;  3HRA A;  3PS6 A;  1WET A;  2O4A A;  3PZ1 A;  5AIJ A;  5D2M C;  3E30 A;  2C2L A;  2XPY A;  3W9F A;  1JWF A;  3PEU B;  4QQI A;  5AQ9 A;  2YNQ A;  4CT0 A;  1QPZ A;  5T3R A;  1WH8 A;  2J4D A;  4GMJ A;  4DLO A;  3WXX A;  3MKR A;  4HLL A;  3S7B A;  2QYJ A;  4GAA A;  4G8L A;  3FMY A;  1LD7 A;  4X4F A;  2XCC A;  4JA7 A;  3EIJ A;  2LAH A;  1RZS A;  3APC A;  2KZT A;  2XI8 A;  2CG2 A;  4I9C A;  3MV2 B;  2IU7 A;  1YMP A;  4J8D A;  1DNP A;  1PAQ A;  5LX8 A;  5E76 A;  4BTB A;  3HDX A;  3F52 A;  3P2B A;  4IUL A;  3OQO A;  4UWL A;  4Y6C A;  3MJW A;  4EZK A;  3DSW A;  5CCM A;  2RD0 A;  4PDX A;  1YSE A;  4BX9 A;  4U7E B;  1D8D A;  4B0Z A;  1E3O C;  2EIL E;  3G2S A;  1MQS A;  2P9I G;  4G25 A;  3CK8 A;  3ASG A;  3FEY A;  3LS8 A;  5AEN A;  4FUL A;  1GW6 A;  4L2Y A;  3HXE A;  2H6I A;  1QQB A;  5KWD A;  2PM7 A;  2XS1 A;  3ZHE B;  3EUS A;  4EKI A;  3S2A A;  1MHQ A;  3HVE A;  3ENE A;  4HOT A;  3D1N I;  3L9T A;  1E96 B;  4GZD A;  2JVL A;  4H7Y A;  3SHF A;  3VLF A;  1JH9 A;  3B7U X;  4W9R A;  3ONK A;  2Y1L E;  4ANV A;  2Y4T A;  3GZ2 A;  2M4H A;  4PU7 A;  5FIN A;  2IU1 A;  5ANL A;  4CGV A;  4HQD A;  1KT0 A;  1WIZ A;  5ITZ F;  1RZR A;  3DSX A;  4XI9 A;  2R17 C;  2CFU A;  4GZ5 A;  3R9A B;  2LLV A;  1H2U A;  2WM9 A;  5AYW D;  2RFA A;  1ZS4 A;  4HOU A;  2PXD A;  1TR4 A;  4AY5 A;  3D9O A;  1RIO A;  1Y6I A;  2DBA A;  3CVL A;  3LY9 A;  3SBS A;  3A9Y A;  3TWX A;  4N3A A;  3CST A;  1BU9 A;  5BW8 C;  4DJA A;  3IXE A;  2OCC E;  4I1A A;  3SO8 A;  1DVP A;  2GRN B;  3AJI A;  5D0Q D;  3C3R A;  5JHA A;  2BNN A;  2R59 A;  4NAC A;  2VQ2 A;  1LD8 A;  2V5F A;  3TWW A;  2ICP A;  4LNB A;  2VSN A;  2PUD A;  2DZN A;  3ASD A;  1E7U A;  4B8A A;  4YDY A;  3HZI B;  1H19 A;  4GHJ A;  4GA0 A;  3QKY A;  4IYP A;  3D9M A;  4I6E A;  3KZ3 A;  3AS8 A;  3CLC A;  3EJN A;  3HXC A;  3R9M A;  2DCP A;  1OWM A;  2GRQ B;  3RJV A;  3HXB A;  5JJ7 A;  4GTS A;  1Y7Y A;  4J6I A;  3NZU A;  5DTQ A;  1TNO A;  4YND A;  3ZVV A;  1SVX A;  3ZFW A;  3L16 A;  4HRM B;  3NZS A;  2B6C A;  5KJN A;  1QBQ A;  1ZZB A;  3BDN A;  4LG6 A;  2EIJ E;  3QWV A;  2PXK A;  3RO2 A;  5EYL A;  2MRI A;  3R09 A;  2P9L G;  4BES A;  5FZQ A;  2XSD C;  2J8S D;  3T9K A;  3GW4 A;  4NIK A;  2I6H A;  2EIK E;  2V3C C;  4BFR A;  5HKP A;  5FIO A;  4N39 A;  3IKO B;  2MYO A;  2CRO A;  3T8M A;  2AJA A;  3DSU A;  5JA4 D;  3L22 A;  3GBF A;  3OMT A;  4X4B A;  1H0A A;  3U64 A;  5ENS D;  2WXP A;  3UM2 A;  4B8C B;  1ELR A;  2P9N G;  3WG7 E;  1P5Q A;  2Q7F A;  2WPV A;  1MYO A;  5B1A E;  3A9X A;  5ENP D;  3I4G A;  4JCX A;  3FTV A;  4LEU A;  3ZRH A;  2KZT B;  2BTD A;  2ILR A;  2V4L A;  2JQE A;  3EUV A;  4AV7 A;  2MXD A;  4APF A;  2DZO A;  1O5M A;  4JXT A;  4DE9 A;  2JAB A;  2YBD A;  2KCK A;  4ER6 A;  1OWO A;  5DRY A;  2BED A;  1E8W A;  2EQX A;  5JJ6 A;  3ML8 A;  3KS2 A;  5A7L A;  3MCX A;  2L49 A;  4WUY A;  2HR2 A;  4WWO A;  3EIQ C;  4IVZ A;  3H5T A;  3QWG A;  1RPE L;  1RW2 A;  1N9A A;  2RKK A;  3Q7A A;  1GT0 C;  2ZIR A;  3ZW3 A;  3BEE A;  4ILG A;  2NSZ A;  3ISM C; 
#chains in the Genus database with same CATH homology
 2KCV A;  1EF1 C;  2LYL A;  2H8R A;  2OOE A;  1JFT A;  2I1J A;  1LQC A;  3PVL A;  1UW4 B;  2EF8 A;  4J1X A;  2HO1 A;  4PS8 A;  3K9I A;  5ENN A;  5DIZ A;  5BT1 A;  2A6C A;  2WQ7 A;  3FUN A;  2WXH A;  4WNF A;  4XIF A;  3FH8 A;  1SZA A;  3CLJ A;  4X4H A;  1WAO 1;  2XEV A;  3CK9 A;  2LYQ A;  5KCM A;  3UX4 A;  3ZKC A;  2WXJ A;  4F1S A;  2VGX A;  3D3M A;  3OQN A;  3OP9 A;  4BSX A;  2Y3A A;  1R63 A;  4GA2 A;  4Z59 A;  4U04 A;  3CEC A;  3KEZ A;  1E8X A;  1QP7 A;  4JPS A;  3CSF A;  4ME2 A;  4I2Z A;  3FTW A;  3UFD A;  2XHE A;  3DBS A;  2GW1 A;  5EX0 A;  2IOL A;  2WB2 A;  3QNK A;  5EKQ D;  3TG5 A;  3ESL A;  1ZZ8 A;  2YIN A;  2UY1 B;  4NDW A;  3FTX A;  3O48 A;  2IUO A;  1R69 A;  3FTS A;  2WMN A;  4A1S A;  4AIF A;  4D10 C;  1IQR A;  2DIW A;  3TG4 A;  5LOZ A;  4MS6 A;  1PNR A;  4MRU A;  3FTZ A;  2L0T B;  3D9P A;  4GYW A;  2I2O A;  4OVV A;  4EZJ A;  2LYS A;  3CVX A;  3CVY A;  3SGH A;  4B89 A;  3QK0 A;  3L08 A;  1UG3 A;  3CVQ A;  4JA9 A;  4Z5C A;  3VK0 A;  2KEK A;  3KD7 A;  3MGB A;  3UPV A;  2LYK A;  1FVF A;  1ZZ7 A;  1CJG A;  2NXP A;  1Z3X A;  1B0N A;  3FH7 A;  3G2V A;  3QB2 A;  5G55 A;  3NQP A;  1QZ2 A;  3CEQ A;  5HQ8 A;  1HF0 A;  4K0R A;  3TJP A;  2XJ3 A;  3S7D A;  1BDH A;  5BV0 A;  3S7J A;  1X2L A;  2UY1 A;  2WIU B;  3BS3 A;  1W3B A;  3KXA A;  3FUK A;  2QY7 A;  3SFZ A;  4Q69 A;  2OV8 A;  2QFC A;  4ANU A;  1QNF A;  4PU4 C;  1ZU2 A;  2I9C A;  4EPZ A;  1N52 A;  3RRM B;  4YG1 A;  2JLB A;  2WXO A;  2LYR A;  1XNF A;  3HHM A;  1WY6 A;  3FUI A;  1SQM A;  4BX9 A;  1B89 A;  4BWR A;  5LP0 A;  3FDH A;  4GPK A;  3LJ3 A;  4OVU A;  1PRV A;  3G2W A;  3JYS A;  5HI7 A;  1NEQ A;  2FO7 A;  2XRY A;  3CVN A;  3FU0 A;  2VGX B;  3L54 A;  2FF4 A;  3FY4 A;  4I8T A;  2IVQ A;  3LYA A;  1H2V C;  3AU5 A;  3QDN A;  4LUN U;  3LXU X;  4JVS A;  2WUS R;  1QP4 A;  4J8F A;  4XKC A;  2XRZ A;  3L17 A;  3LVR E;  4I6G A;  1VPW A;  3B7S A;  4KVM A;  3QQ6 A;  1IC8 A;  1KLX A;  3PRE A;  5FQ6 A;  4CEM A;  3TRB A;  1HS6 A;  2LNI A;  3QC1 A;  3G2U A;  4O8B A;  5BV1 A;  4KMO A;  3U66 A;  4GZ6 A;  3PNL B;  2WVI A;  1HZ4 A;  3E4B A;  2VYI A;  4Z58 A;  5CMY A;  2CHW A;  3AS4 A;  3P1U A;  4BT8 A;  4A3V A;  4G1T A;  3U4T A;  2PUF A;  2NC9 A;  3CHM A;  3IHV A;  3LFP A;  4CT4 A;  4XX5 A;  1UXD A;  3GN5 A;  4DPR A;  4JCY A;  2XPI A;  5EDS A;  2B5A A;  3IV0 A;  4HS2 A;  3CQC B;  5ARG A;  4FHK A;  2X3M A;  3PH0 C;  5LFA A;  3PUK A;  3SF4 A;  4KZC A;  1UXC A;  3OXL A;  4PUC A;  2EWT A;  4UWK A;  5KJL A;  4U0U A;  2KC7 A;  1TJC A;  3ZHE A;  3LEW A;  1NA3 A;  4F7A A;  2C0M A;  4HOQ A;  2VGY A;  3LCA A;  3MV3 B;  4BX8 A;  1NP7 A;  2R63 A;  4FJZ A;  2JCG A;  3I5P A;  5BUZ A;  4FU3 A;  4L23 A;  3FWV A;  3FUH A;  3B7R L;  2IVB A;  4PS7 A;  3R1F A;  2OND A;  2WXL A;  3CHO A;  4FAD A;  5C1D A;  4C0M A;  3LKU A;  3ML9 A;  3GN5 B;  1E8Z A;  4WWP A;  4APO A;  4CDN A;  1EFA A;  3ZXS A;  2CSF A;  1NZN A;  3PS6 A;  1WET A;  4JL0 A;  2O4A A;  3RO3 A;  4F53 A;  4MLP A;  5AIJ A;  4X4E A;  5ANR A;  3PE3 A;  2WXF A;  3T5V A;  2C2L A;  2IJG X;  3GYZ A;  5FZS A;  3F6W A;  2KAT A;  2XPY A;  1IHG A;  2GZU A;  1SZ9 A;  5T4Y A;  3FU6 A;  1JWF A;  5CCL A;  4CDM A;  3PEU B;  3CIA A;  4X4D A;  1EDU A;  3QWP A;  3R7R A;  2ION A;  4J0U A;  2YNQ A;  1PC2 A;  4FLH A;  4CT0 A;  1BDI A;  2I1K A;  1LLI A;  2YQ8 A;  1QPZ A;  3I3N A;  3T5X A;  4PU3 C;  5T3R A;  1WH8 A;  2J4D A;  2LO6 A;  4GMJ A;  2PQR A;  3UT7 A;  4DLO A;  4URK A;  1VDY A;  3CR3 A;  3AU4 A;  2WXG A;  3MKR A;  3QAQ A;  3WXX A;  1E7V A;  3S7B A;  4Q96 A;  5FTP A;  2KPJ A;  4OYS A;  2PUG A;  3BG1 B;  4FBI A;  3JXB C;  3MEK A;  4GAA A;  3SZ7 A;  4J8E A;  4UQZ A;  2WQ6 A;  3Q49 B;  1ZZ9 A;  4GZ3 A;  4BT9 A;  3FMY A;  3D9L A;  3OAW A;  4OB4 A;  4X4F A;  2XPZ A;  4Z5H A;  4X4C A;  2PPX A;  2FUL A;  2XCC A;  3EIJ A;  4JA7 A;  4FN3 A;  4CCA A;  2LAH A;  1OSL A;  3FUL A;  5M72 A;  4NQ0 A;  3QYX A;  1RZS A;  3APC A;  2YHC A;  2KZT A;  3CQG B;  2IVG A;  2AUW A;  2PIJ A;  2XI8 A;  2CG2 A;  4I9C A;  3PNT B;  1FCH A;  2WXR A;  1DWK A;  3MV2 B;  4Q94 A;  2IU7 A;  4LER A;  5CHE E;  4HFG A;  4KYO B;  2IQC A;  4U07 A;  3URZ A;  4XE0 A;  4J8D A;  4CDR A;  1DNP A;  1H6K A;  1PAQ A;  2P58 C;  3QOU A;  3ZYK A;  1HE8 A;  4ABN A;  5E76 A;  2LSU A;  4BTB A;  5LX8 A;  3TGO A;  3BG0 B;  2ICT A;  4F3V A;  1HXI A;  4N5C A;  2GRM A;  3HDX A;  3F52 A;  2BUG A;  3P2B A;  4IUL A;  4L7T A;  5J90 A;  4WNE A;  3OQO A;  3VTX A;  4UWL A;  1PRA A;  4Y6C A;  1IQU A;  3MJW A;  4XZ4 A;  4EZK A;  3RZZ A;  3PXP A;  4G24 A;  4U0Z A;  5FJY A;  5J08 A;  5G04 J;  5CCM A;  3FFL A;  3MKQ A;  2RD0 A;  4PDX A;  3ZEF A;  1YSE A;  4N3B A;  2EBY A;  2A5U A;  3FYA A;  1TJF A;  1KT1 A;  2OFY A;  2X6H A;  1S7E A;  3GZS A;  4GZC A;  4N2S A;  1L5J A;  2KCL A;  4FJY A;  4B0Z A;  1DW9 A;  3OXF A;  1E3O C;  4IRU A;  1XGW A;  3G2S A;  3D9N A;  1LF8 A;  1MQS A;  4GCO A;  2JEK A;  4G25 A;  3QAR A;  4X4G A;  4JEU A;  3CK8 A;  3NF1 A;  2L8N A;  1OCT C;  3ASG A;  4GYY A;  4EBA A;  3SD5 A;  3AS5 A;  1Y9Q A;  2UWJ G;  1YA0 A;  2X6K A;  1U3C A;  3FEY A;  3L1P A;  3LS8 A;  4I1O B;  2XQ0 A;  3S7F A;  4KXK B;  5AEN A;  3CK7 A;  2PUA A;  4FUL A;  1GW6 A;  3CGH A;  3HIZ A;  4L2Y A;  5CMW A;  3TL5 A;  3MLF A;  1QQB A;  4RG6 A;  2PM7 A;  3ZHE B;  4MKT A;  3EUS A;  4I6T A;  4ILI A;  3MYV A;  3S2A A;  5E75 A;  2FEZ A;  4FP7 A;  1MHQ A;  3HVE A;  3RU0 A;  3D9K A;  3ENE A;  1HH8 A;  2HSG A;  2WXK A;  4X4I A;  3FU5 A;  3D1N I;  2WXQ A;  3OQM A;  3PUJ A;  4HOT A;  1E96 B;  2BNM A;  2GRL A;  3JXD L;  4GZD A;  5FZR A;  2PUC A;  2E2E A;  3RRU A;  4HOS A;  4C9B B;  2IF4 A;  4R7L A;  5FQ4 A;  4JHK A;  4TRQ A;  4L2L A;  2JVL A;  1NER A;  5ARF A;  4H7Y A;  3SHF A;  1QQA A;  3VLF A;  1ZVV A;  4KBQ A;  1JH9 A;  3DPD A;  3SBT B;  2L9B A;  1OUV A;  2WQH A;  1EPU A;  1U3D A;  5G05 C;  2OR1 L;  3B7U X;  1OWP A;  4W9R A;  3R7Q A;  3ONK A;  2VSO E;  4JEH A;  3FP3 A;  4UI9 K;  3ESK A;  4U0S A;  4H7X A;  1WH6 A;  4B94 A;  4GA1 A;  4ANV A;  3SI5 A;  3RKV A;  4G26 A;  5LCW C;  3CRO L;  1Z3Y A;  2Y4T A;  3FUF A;  3FTU A;  2IV1 A;  1Y8M A;  3SCG A;  3GZ2 A;  4YVQ C;  3TXM A;  2CG3 A;  4KT6 B;  1HF8 A;  4UWG A;  4JHJ A;  4XI0 A;  4F8D A;  4DK5 A;  4PU7 A;  3CHR A;  4QFV A;  4WAF A;  4GML A;  4JQD A;  3ULQ A;  2X6J A;  1JPL A;  3FUE A;  3OXG A;  5DBK A;  1SQ8 A;  2IU1 A;  5ANL A;  1UJJ A;  4CRW A;  2WXM A;  5A23 A;  4CGV A;  3Q15 A;  5G04 C;  3CVU A;  4AM9 A;  3PE4 A;  3IVP A;  3U9W A;  4HVB A;  2J9Q A;  2OVB A;  1CQT A;  1WIZ A;  1UTX A;  1RZR A;  1KT0 A;  3Q5M A;  3RK6 A;  3FH5 A;  3L6A A;  4XI9 A;  2R17 C;  2XCJ A;  2MOW A;  2CFU A;  2PL2 A;  4GZ5 A;  3R9A B;  3IHY A;  5LCW J;  3D9I A;  4EBA G;  4RSY A;  4IWR A;  4MCX A;  2J08 A;  2X6F A;  2O49 A;  3JQ0 A;  5AJD A;  4J1W A;  2GGF A;  2HIN A;  1PER L;  1E90 A;  1H2U A;  2AXU A;  2WM9 A;  3Q47 B;  4EQF A;  4Z5D A;  2HYZ A;  2X38 A;  5AYW D;  1L1M A;  3MZL B;  4I43 A;  1ZS4 A;  2D5V A;  3PEV B;  4M3O A;  4HOU A;  2VSX E;  3APF A;  5D0O D;  1RZR D;  3KAE A;  4AY5 A;  4G11 A;  3D9O A;  1RIO A;  3Q4A B;  1Y6I A;  3RRN B;  2DBA A;  4I6R A;  5AJL A;  3CVL A;  3PRZ A;  3LY7 A;  3LY9 A;  2VSY A;  3SBS A;  1UJK A;  3CVP A;  3CV0 A;  3UT4 A;  4HLE A;  3CHQ A;  2AW6 A;  3C98 A;  3FU3 A;  4UI9 J;  2PUE A;  4V3I A;  4DI4 A;  4N3A A;  3APD A;  1PY1 A;  3CST A;  1X5B A;  2WMO A;  3MX3 A;  5BW8 C;  4AY6 A;  4DJA A;  5BNW A;  4WNG A;  3KJX A;  2AVP A;  2BNO A;  1POU A;  4U63 A;  4G2V A;  4I1A A;  4NRH B;  4ACL A;  1DVP A;  4N2Q A;  5D0Q D;  4NUR A;  1LCC A;  3QWW A;  4FHJ A;  3SCH A;  3G2T A;  4G23 A;  4K03 A;  4BTA A;  4AEZ C;  3DNV B;  2BNN A;  5JHA A;  2R59 A;  4PU8 A;  4NAC A;  2VQ2 A;  2HM8 A;  3FHE A;  1JWL A;  3VTY A;  1QP0 A;  2J07 A;  4YG7 B;  3LVQ E;  2LCV A;  2KZ8 A;  3O9X A;  1S0P A;  3G5G A;  3FTY A;  4UWH A;  2LAI A;  3D9J A;  2V5F A;  4A55 A;  2ICP A;  1ADR A;  3S8Q A;  2VSN A;  2XCB A;  4YG4 A;  3FUM A;  2M63 A;  4Y6W A;  3VLD A;  2PUD A;  2X6I A;  3CKB A;  4A3T A;  3ASD A;  1E7U A;  3LPZ A;  4B8A A;  1ZUG A;  4DLQ A;  2V0P A;  3LIS A;  3CHP A;  2PE5 A;  1BPO A;  2RG8 A;  2J4B A;  4ANW A;  4GU5 A;  3HZI B;  3IEG A;  1H19 A;  2VTB B;  4GHJ A;  4GA0 A;  5JHB A;  3QKY A;  2Y4U A;  4TV3 A;  4IA8 A;  2L6J A;  4IYP A;  3D9M A;  4I6E A;  3EHN A;  3KZ3 A;  3AS8 A;  3CLC A;  3EJN A;  3FYM A;  3JUI A;  4YVO A;  2DCP A;  4AOF A;  5K98 B;  1OWM A;  3O4Z A;  4U8H A;  3RJV A;  2C0L A;  5G05 J;  1LCD A;  3JCK C;  4Y42 A;  1ZBP A;  5JJ7 A;  2XIU A;  1Y7Y A;  4J6I A;  4BY6 A;  3NZU A;  3PDN A;  3ZHM A;  2MHK A;  1TEZ A;  3QJZ A;  1UN8 A;  4YND A;  3MKQ B;  4A1G A;  3ZVV A;  2R5S A;  2WXN A;  4PS3 A;  3ZFW A;  4ANX A;  1ZZ6 A;  4EZL A;  1AU7 A;  3L16 A;  2KEI A;  2ZU6 B;  2J09 A;  3NZS A;  5KJN A;  4MCT A;  1ZZB A;  4TUU A;  3BDN A;  2XGM A;  3ZGQ A;  1ELW A;  5FQ7 A;  3QWV A;  4E6H A;  3RO2 A;  2MRI A;  3MA5 A;  3UUX A;  3F51 A;  1HG5 A;  2YHE A;  1INZ A;  5FZQ A;  2XSD C;  4GQM A;  3IBE A;  3GW4 A;  3ZPJ A;  3ZIM A;  2I6H A;  3OTN A;  1LMB 3;  1JUQ A;  2V8S E;  3I4R B;  3BD1 A;  4BFR A;  2PQN A;  4KVO A;  3GZ1 A;  4P29 A;  3ZYL A;  4E85 A;  4N39 A;  1HU3 A;  3IKO B;  4GCN A;  4I1M A;  3ZYQ A;  4JHR A;  3CVW A;  3FUJ A;  4DI3 A;  3UQ3 A;  4ATG A;  3L13 A;  2CRO A;  4GYO A;  3T8M A;  3ASH A;  4KZ0 A;  1ZAY A;  4WWN A;  3FEX A;  4CGW A;  2R1J L;  4ILH B;  3ONL A;  3L22 A;  3GBF A;  2IFU A;  4LCT A;  3OMT A;  4X4B A;  4RVB A;  4I9E A;  1QQE A;  1H0A A;  3U64 A;  2FBN A;  2IOS A;  4I17 A;  4XKB A;  2LSV A;  5EX3 A;  2LYJ A;  2KEJ A;  2E0I A;  1ZZC A;  2CHZ A;  2FI7 A;  2WXP A;  5FT9 A;  5BPP A;  1HFA A;  3LDZ A;  3B7H A;  4FC8 A;  4B8C B;  5KJK A;  3HVE B;  4I2W A;  4N3C A;  5G2N A;  1ELR A;  4ACK A;  3LY8 A;  1P5Q A;  2Q7F A;  2XGO A;  2BJC A;  2WPV A;  4UWF A;  1EYH A;  1OWL A;  1A17 A;  3I4G A;  1XWR A;  4AXH A;  5KJM A;  2PUB A;  4JCX A;  4AVX A;  1WM5 A;  4JC8 A;  3FTV A;  1ELK A;  1OWN A;  1N54 A;  5T8I A;  1IYG A;  3SNX A;  4LEU A;  2PM6 A;  3ZRH A;  2XGS A;  5A6C A;  4O6F A;  4YAR A;  4WND A;  3JXC L;  1FVH A;  2AWI A;  2BTD A;  2KZT B;  3HYM B;  2ILR A;  2V4L A;  3PZD A;  2MEZ A;  1Z6T A;  3SCF A;  1X57 A;  3B13 A;  3N71 A;  4HXI A;  3VLE A;  4C0E A;  5FWQ A;  3TAX A;  2L0I A;  1JWG A;  4JZY A;  4AV7 A;  4PH4 B;  1UN9 A;  3ZHI A;  3ASF A;  4IN3 B;  4J8S A;  2CFZ A;  2CHX A;  2OVF A;  4APF A;  4JXT A;  3ZYM A;  1HX8 A;  1HO8 A;  3ZN3 A;  4JW1 A;  3EHM A;  3CKC A;  2KCK A;  4UQX A;  3JQ1 A;  4RG9 A;  3FUD A;  1OWO A;  2AXV A;  4UI9 C;  4YBA A;  2WXI A;  3QF3 A;  2EQX A;  1E8W A;  3U3W A;  4EEC A;  2VJ8 A;  3ML8 A;  5JJ6 A;  3KS2 A;  5A7L A;  5FQ8 A;  4AJW A;  3TXN A;  4FLB A;  1HG2 A;  3RIB A;  3MCX A;  4L1B A;  2L49 A;  5JJT A;  4UQY A;  1E8Y A;  1JFS A;  4I6U A;  5C2Y A;  4GB9 A;  4WUY A;  2HR2 A;  4WWO A;  4HOR A;  2FJR A;  3EIQ C;  1O4X A;  2MQK A;  2J49 A;  4IVZ A;  5A7D B;  3UT8 A;  4FA6 A;  2VTB A;  3UMV A;  3H5T A;  4I6J A;  1PRU A;  2AXZ A;  2KM4 A;  1NA0 A;  1H2T C;  3EDT B;  3QWG A;  3G7D A;  1RPE L;  2BF0 X;  3B7T A;  4LRZ A;  4AP2 A;  3CVV A;  1GT0 C;  2LYP A;  3CHS A;  2O38 A;  2PZI A;  3ZW3 A;  3BEE A;  1ZPQ A;  4ILG A;  2NSZ A;  2A4Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...