2AW6A

Structure of a bacterial peptide pheromone/receptor complex and its mechanism of gene regulation
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
287
structure length
287
Chain Sequence
MFKIGSVLKQIRQELNYHQIDLYSGIMSKSVYIKVEADSRPISVEELSKFSERLGVNFFEILNRAGMNTKSVNETGKEKLLISKIFTNPDLFDKNFQRIEPKRLTSLQYFSIYLGYISIAHHYNIEVPTFNKTITSDLKHLYDKRTTFFGIDYEIVSNLLNVLPYEEVSSIIKPMYPIVDSFGKDYDLTIQTVLKNALTISIMNRNLKEAQYYINQFEHLKTIKNISINGYYDLEINYLKQIYQFLTDKNIDSYLNAVNIINIFKIIGKEDIHRSLVEELTKISAKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of peptide sex pheromone receptor PrgX and PrgX/pheromone complexes and regulation of conjugation in Enterococcus faecalis.
pubmed doi rcsb
source organism Enterococcus faecalis
molecule tags Transcription
molecule keywords PrgX
total genus 103
structure length 287
sequence length 287
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01381 HTH_3 Helix-turn-helix
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 2aw6A01
1.25.40.400 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2aw6A02
2R1JL 1R69A 4Z5DA 3L1PA 3FMYA 1CJGA 3G5GA 3OQMA 2FJRA 2CSFA 1YSEA 1RZRD 1X2LA 1JFSA 3JXCL 2EF8A 2WIUB 4GQMA 1LCCA 4YBAA 2AW6A 2XSDC 4X4CA 4MCXA 3BD1A 1DWKA 4J1WA 4PU3C 3UFDA 2XIUA 4IA8A 1X57A 1PNRA 2PIJA 1BDIA 4JCYA 2EBYA 1PERL 3EUSA 3QYXA 1O4XA 2LCVA 3GBFA 3GN5A 1ZZ9A 2MQKA 1BDHA 4YG1A 2PUBA 4JQDA 5K98B 4X4FA 1WETA 2KPJA 2H8RA 1ZZCA 4O8BA 4JCXA 4OB4A 4YG7B 4X4GA 4X4BA 3IVPA 3F51A 3G7DA 3GN5B 3QQ6A 1EFAA 1E3OC 2IU7A 1POUA 2OR1L 2IVGA 1R63A 2LYKA 3MLFA 4F8DA 1GT0C 2AWIA 3R1FA 2PUFA 4I6RA 1NERA 2JVLA 1UXDA 1LQCA 3KJXA 1PRVA 2BNNA 1JFTA 1S7EA 1ZZ8A 1JH9A 3TRBA 2XJ3A 3CLCA 3O9XA 3CROL 1DW9A 1ZZ7A 1RZRA 3PXPA 3QWGA 3SCGA 1QQBA 3KXAA 4I6UA 3KZ3A 4Z5CA 4NDWA 1LMB3 3CECA 1QP7A 1VPWA 3OQNA 5A7LA 1XWRA 1LLIA 2CROA 1ZZ6A 2PE5A 1RZSA 3D1NI 2IUOA 1WIZA 2LYSA 2LYJA 4FN3A 1B0NA 3QF3A 1LCDA 3JXBC 2GZUA 1IC8A 1Y9QA 3ZHMA 2XCJA 2LYQA 1ZS4A 2AUWA 3F6WA 2PUEA 4X4DA 4X4IA 2R63A 3BDNA 3RZZA 2BJCA 2MEZA 2AXUA 4FBIA 2GRLA 2L49A 2OFYA 3FYAA 4Z58A 4X4EA 2BNMA 4IWRA 2O49A 1PRUA 2PPXA 2ICTA 3FYMA 2HSGA 2O38A 3H5TA 3ZKCA 1OSLA 2PUDA 3B7HA 3OQOA 1ZAYA 2GRMA 2IV1A 4PU4C 1Y7YA 3DNVB 1ZUGA 2KEJA 2D5VA 3SCHA 2EWTA 2PUAA 1OCTC 1RPEL 4Z59A 1PRAA 1ZZBA 1NEQA 4YARA 1WH8A 1L1MA 2BNOA 4X4HA 2ICPA 2A6CA 1RIOA 1UXCA 1HF0A 3SCFA 1WH6A 2HINA 3BS3A 1UTXA 2KZ8A 4GHJA 2L8NA 2LYRA 4YG4A 1ZVVA 2AXZA 1QPZA 2WUSR 1ZPQA 2IVBA 1QQAA 4I8TA 1QP0A 2IVQA 2LYLA 3JXDL 1AU7A 4IVZA 1CQTA 2PUGA 4PU7A 1JWLA 3OMTA 3OP9A 4Y42A 2XI8A 2PUCA 3VK0A 2LYPA 4MCTA 3LISA 4J1XA 3S8QA 4Z5HA 1SQ8A 3ZHIA 3LFPA 3U3WA 2KEIA 2JCGA 3F52A 1QP4A 1ADRA 2O4AA 2B5AA 4PU8A 3HZIB 2AXVA 4I6TA 2KEKA
chains in the Genus database with same CATH superfamily
4GZ6A 2VTBB 3QFIA 1UJKA 1IQRA 2EF8A 2WIUB 3G0TA 2AW6A 3QNKA 3HXFA 3LVQE 4Z68A 5H7PA 4U8VD 2MQKA 1OUVA 3U64A 4N3CA 4GMJA 1H6OA 2C0MA 4X4GA 4GYWA 4QFVA 2FO7A 4UWKA 1S64A 1KZOA 5AYWD 3UINC 2CFUA 3PE5A 3FUIA 4FJZA 1NFIE 3UM1A 3DSSA 1LMB3 2GRRB 4CDNA 4J0UA 3LEWA 3FU3A 1DCEA 3LQXA 2RD0A 1LF8A 4ANUA 4Q2JA 4DK5A 4FU3A 4DE9A 4ZFHA 2XCBA 4I2WA 3OXLA 2O49A 1GW6A 1TEZA 1Y7YA 1Z3YA 3SCHA 2R59A 4ER5A 4WNDA 1PRAA 3VLDA 3Q73A 1FCHA 3FULA 1MYOA 3BU8A 5FINA 1WH6A 3KSLA 2V4HC 4LNGA 3EJNA 1UJJA 2XGMA 1SQMA 4U7EB 1EDUA 2WXFA 1ELWA 3ZUVB 3DRAA 3D9HA 3ML9A 2P9IG 4RSYA 1NI1A 4H7XA 4ZHBA 3LDZA 4UQYA 4A1SA 2E0IA 3ZU7B 1SQ8A 3G2UA 5CRUA 4N3BA 4DJAA 3B7RL 2ETCA 5JHAA 2R1JL 2J07A 3G5GA 2P9UG 2VGXA 2M4HA 3S2AA 2J09A 3GBFA 2HO1A 2XEHA 2I9CA 5D66A 4DRXE 4BETA 1E3OC 2XCCA 3FU0A 2X38A 1ZB1A 2PXEA 3JYSA 1H6KA 3RAUA 3CLCA 3CROL 1ZZ7A 4G25A 3PE3A 3B7UX 4I1OB 1E8YA 4NIKA 4JHRA 3FUMA 1Z5SC 3RU0A 2GW1A 1FVHA 4EKIA 3EHQA 4XI0A 4MRUA 2OEVA 3JUEA 4HRMB 2LYQA 4GA1A 1Q2ZA 2PUEA 4EPZA 2H6GA 2OV8A 2BJCA 3BDNA 2V0PA 3ZNGA 2FULA 4JL0A 4JXTA 3FTXA 4CT4A 3LXUX 3CHRA 1E7VA 3ASGA 5AJDA 1UN8A 2L9BA 4EK9A 1ZUGA 3HG0D 4F53A 3LY7A 3B95A 2V5FA 3PEVB 4GYYA 3CK7A 2A4ZA 1SZAA 3L16A 2M63A 1K8KG 4DX1A 3HYMB 1ZPQA 1QP0A 4B8CB 3JXDL 2QFCA 4LNBA 2AVPA 3IEGA 3S8QA 4CDMA 3FTWA 4GPMA 3DWLG 4B94A 4AXHA 1ADRA 2PXTA 1FT1A 3PH0C 4HRNA 2F8XK 2QC9A 4KMOA 4FA6A 5HRYA 1BLXB 1HX8A 1FT2A 4Q94A 3DXMG 5D2MC 4JCYA 2FEZA 1U3DA 3FUFA 3AS5A 2KPJA 3SNXA 3EUVA 4HOSA 2HCNA 3Q9UC 4DX2A 3AG2E 2CHXA 2L6JA 1H2VC 3GUUA 2OR1L 3PZ3A 4GTOA 2PUFA 4KZ0A 4L2YA 3TWXA 5JA4D 2Y69E 1JH9A 1TNYA 3IHVA 2PNNA 3CECA 4BERA 4DI4A 3ZVVA 2LSUA 4LNUD 1WG0A 2UY1A 5AN8A 1N4SA 3SBSA 4JC8A 3VWSA 2I2OA 5CCLA 2EIJE 1HG2A 3RKVA 3Q75A 3W9FA 5BPPA 3N71A 4FLHA 3FH5A 2GRMA 3CVVA 2D5VA 4GYOA 1NEQA 2XEVA 4AV7A 3BG1B 2XS8A 4GB9A 1EYHA 5LX8A 3L9TA 2ETAA 3TL5A 3E4BA 3OXFA 3OWQA 5ITZF 4R7LA 5ENPD 3PE4A 1OCZE 2XRZA 3L13A 3UM3A 3C3RA 2H6IA 2KZTA 4PS7A 4P29A 3FUEA 4YDOA 4GTMA 2ETBA 3M9LA 3E37A 2KEKA 1KZPA 3CVUA 2DVWA 3ENEA 4YDYA 1QYMA 2WQ7A 3FWVA 4U0UA 3R7RA 3T8KA 1P5QA 3G2TA 1E8WA 4J8YA 4A1GA 1HZ4A 3F51A 4ANXA 4KZCA 2WMOA 3LVRE 3TELA 3KJXA 2LXMA 4K5BA 1ZZ8A 1HQ1A 3GZ1A 4C0MA 1ZBPA 3IBEA 2Y1LE 3K9IA 4TXQA 1SVXA 2I1JA 3B7TA 5FZSA 3ULYA 4GTVA 1LCDA 3QB2A 2ZGDA 4L1BA 4RLYA 3CHMA 1D8EA 2Y4UA 3WG7E 1OY3D 1IHGA 3ZHEB 2EIME 5FQ8A 1IKND 4UQXA 3FYMA 2Q7FA 3BQOA 1TNZA 4NACA 1ZAYA 2R5SA 2KCLA 3UKRG 1RPEL 3MEJA 3OTNA 3V79K 5ARGA 5G04C 4YARA 3AS8A 3PDNA 5G05C 3LY8A 3S7DA 2KZ8A 1MZCA 4GHJA 2L8NA 5G05J 3NB2A 4ACLA 2IVQA 2LNIA 4Y6CA 3MCXA 5ENQD 4FHJA 1SW6A 2XS1A 3CSFA 5A23A 1OT8A 2ZISA 4N39A 3KEAA 1TR4A 4C48B 1HO8A 2XENA 2WXMA 2ZGGA 5A7DB 2XSDC 5LOZA 5KNGA 2KCKA 3FUNA 4F6RD 2HFZA 3ZKJA 2EBYA 4N5CA 3EUSA 3MGBA 3QK0A 2WM9A 2WVIA 4F1SA 3MKQA 1EFAA 1TNOA 3CHQA 5ARFA 5FJYA 1GT0C 3R1FA 1JCRA 2KC7A 2FO1E 1NERA 1AP7A 5BNWA 3FH7A 1S7EA 3TRBA 3FFLA 3PREA 4HRLA 1DW9A 1QQBA 1MX2A 3B7SA 3KXAA 2WXPA 4I6UA 3KZ3A 3AU5A 1E8ZA 2KBXA 5A7LA 1JWFA 3CVNA 2PE5A 2OOEA 3C5RA 4FN3A 3EHRA 4HS2A 3NBNB 1O1TA 4MS6A 3JCKC 2MEZA 2YHEA 2GRLA 2OCCE 5LCWJ 5CEAA 2HR2A 3P2BA 3TWUA 2PUDA 4HRAA 3OQOA 1DCQA 3TWTA 1QZXA 1OCTC 2Y4TA 1JCQA 3LYAA 2HE0A 1L1MA 5AARA 4KBQA 2UWJG 1S63A 2C2LA 3NOCD 2CG2A 2X6HA 3TWRA 1BU9A 3E32A 3EIJA 5KJLA 3MEKA 4ANWA 3RRNB 4GTSA 1ZU2A 1TJCA 5FZQA 2PUGA 4HQDA 2YBDA 4HI9A 4WWNA 3LISA 1HG5A 3FTUA 1N9AA 3AS4A 1Z3XA 3ZHIA 3GZDA 1V54E 2KEIA 2JCGA 3DSWA 3FTSA 4HOUA 2CFZA 3UT8A 3L82A 5KNHD 4GPKA 5AQBA 1QB2A 1MX6A 5EDSA 2LLWA 4JD2G 4PU3C 1BDIA 2FBNA 4KT6B 1V55E 2UY1B 4HB5A 5K98B 4X4FA 4I6EA 3HXCA 4U96D 4KVMA 2YQ8A 5EYLA 5DT2A 2IVGA 2LYKA 3CGHA 3QDNA 4BFRA 1LQCA 2P9NG 4AIFA 4DUIA 2WB2A 3UTMA 4IYPA 3Q7AA 1KT0A 2XJ3A 3O9XA 3AG3E 3MZLB 2KXPC 4U8YD 3KL4A 3ABME 2FFHA 3SFYA 3ZW3A 3CR3A 3J5QB 3I3NA 4XIFA 5CCMA 3EHNA 3P1UA 1IC8A 1WDYA 2VQ2A 2R02A 3TJPA 2VSYA 3ME5A 3RZZA 2J4BA 2KCVA 4X4EA 3GZDC 3T8MA 1HFAA 3NZLA 2VJ8A 3QWPA 3H5TA 5JJ7A 3APFA 1TN6A 3E30A 4W9RA 4Z59A 3PZ4A 1E8XA 4EBAA 4N2SA 3UT7A 1N4PA 4J7WA 3JQ1A 4BESA 3ZXPA 1WM5A 2IY0C 5EX3A 1OWOA 2ZIRA 4ME2A 2IVBA 1BI7B 1NZNA 3PEUB 4WWOA 2PL2A 3I4RB 4PU7A 2PM7A 3X2QE 1JPLA 5IY5E 2LYPA 4Q96A 4U8HA 4UI9J 3L54A 5JUWA 2ILRA 1Y6IA 1W3BA 4GTRA 5E76A 3HRAA 3IV0A 2AXVA 1TN8A 3QWVA 5DSXA 3GZCA 3FMYA 3NAWA 2CSFA 1LTXA 3LPZA 1PAQA 1HU3A 3U66A 4EZIA 4DX5D 2R17C 4HLLA 2PXPA 3LJNA 1IQUA 3DSVA 3DPYA 4OB4A 4YG7B 3BG0B 5AIJA 2BKKB 3GN5B 3FHEA 4XKBA 5KJKA 1POUA 2IO3C 4F8DA 4JA9A 3ZHEA 4N3AA 4J6IA 2L0IA 4XE0A 2LNMA 1NW3A 2QY7A 2PXDA 4FLBA 1L5JA 3QAQA 3CEQA 3TWSA 5KWDA 4GMRA 4G8KA 3D1NI 4BWRA 5ANRA 3ZEFA 3U4TA 1U3CA 4X4DA 3HIZA 2R63A 1E96B 5CECB 4G8LA 4I17A 3V2OA 1EF1C 4LSZE 5KJMA 3LKUA 3JXJA 4CDRA 3EDTB 3CVXA 3R9MA 3MV3B 4ABNA 2E2EA 2HINA 1ELKA 4BT9A 1X5BA 5BUZA 3ONLA 2WUSR 2IU1A 3TFLA 4AM9A 4IVZA 3UXGA 4OVUA 1H2TC 2XI8A 3E34A 5CBNA 3LS8A 4Q69A 4H7YA 5T3RA 4B0ZA 4UWHA 4UWGA 4HVBA 4URKA 4GQMA 4ER7A 1OWNA 2CHWA 2XZTG 4RQIA 2WXKA 3ML8A 1QZ2A 1O4XA 4JQDA 1E90A 4HOTA 4X4BA 3SF4A 3G7DA 3Q5MA 3LY9A 1K1AA 5ENNA 4JHJA 2A5UA 3T5XA 4EZJA 3LCAA 1PRVA 1WY6A 2BNNA 2V4LA 1QP7A 1OWMA 4YNDA 2WQ6A 4KXKB 1ZZ6A 2XPYA 4AOFA 5FTPA 3Q49B 4A55A 2LAIA 1YA0A 2AUWA 1VDYA 2X6IA 4DPRA 4X4IA 4G26A 4WUYA 1MX4A 1SA5A 3FYAA 1TNUA 2FF4A 3LJ3A 4PH4B 2O38A 3ZKCA 3V31A 5AAOA 2QYJA 3DNVB 3HVEB 2KEJA 2LLVA 3IKOB 4C9BB 4X4HA 1HF0A 2J7WA 1RZ4A 3NROA 4I1AA 3O4ZA 3OAWA 1QPZA 3D9PA 4FP7A 4DX6D 3DSUA 2P9LG 4CT0A 1U2ZA 2IEJA 5D0OD 3G2WA 2J4DA 2O4AA 2B5AA 4PU8A 3F6QA 5EN5D 3OQMA 4GCOA 4O6FA 1X2LA 3ZYMA 2PXLA 3ASHA 4TV3A 5ANLA 4GCNA 1X57A 5KJNA 1H6PA 1BDHA 2VSNA 1DVPA 3DEPA 4ANVA 3TXMA 4OAUC 4ILIA 2NYJA 3IVPA 3A9YA 3Q15A 3QQ6A 4BTBA 3HDXA 1EPUA 3OKZA 3ZYLA 2H6FA 5EIBE 1UXDA 4FJYA 4I9CA 4WNEA 3G2SA 1D9SA 2VSXE 3JXIA 3QWGA 3AAAC 1VPWA 2X6FA 1RZSA 3D3MA 5DBKA 1O1RA 1G3NB 2DIWA 1ZS4A 5FT9A 5DIZA 2KM4A 3KAEA 4J8DA 5T8IA 2BNMA 5GAHi 2B0OE 3TGOA 3UMVA 2F0YA 1LD8A 3FUDA 4WWPA 4JZYA 2BEDA 2L1PA 3C98A 2DCPA 3ONKA 2EIKE 3OXGA 2YINA 3NOGD 5LCWC 3ZXSA 2KZTB 3FDHA 5LP0A 1QQAA 2J49A 1AU7A 5CEDB 4F3VA 5FQ6A 3EHMA 2J08A 3VK0A 2GRQB 4J1XA 2WQHA 5KBAA 4K5AB 1YMPA 3ULEG 4GA0A 4ER6A 3F52A 1QP4A 4GTPA 5AQ9A 4UI9C 3NZUA 4XI9A 5ENSD 2MYOA 3JXCL 1H19A 4TRQA 5CMWA 1JWGA 3J5PA 4KVOA 4GMLA 3UM0A 3UFDA 4IA8A 4EKGA 3S7BA 3HXBA 3TWWA 4F1PA 4YDEA 3I4GA 1BPOA 1OCOE 3R9AB 4IULA 3KD7A 3DSXA 2R2LA 3KS2A 2IO2C 1Y8MA 4O8BA 4HOQA 4TXPA 4RG6A 5A6CA 1NA0A 2AWIA 4I6JA 3NZSA 4JW1A 3UQ3A 2GGFA 2VTBA 4J8FA 5B1BE 5CRVA 2J7UA 2J9QA 3EU9A 2VSOE 3CLJA 4JEUA 2L6BA 4FHKA 2MOWA 1JUQA 1SZ9A 3TWVA 2XHEA 1PC2A 4FULA 3TEPA 2MHKA 3SZ7A 3ABKE 4U0SA 3D9JA 4IWRA 3ZRHA 2EILE 2PPXA 4EQFA 2WXOA 3SFZA 3FU5A 3FUJA 1KPSB 4Y6WA 4I43A 1ELRA 3SX0A 2BF0X 2PQRA 3ABLE 3RO3A 2OVBA 4LRZA 4EBAG 1ZVVA 4YG4A 3Q79A 3SQVA 2BKGA 1UOHA 3SFXA 4JA7A 4HNAD 2Y0BG 4ACKA 1CQTA 1TJFA 3GW4A 1S70B 4K0RA 5ENTD 2HCSA 1N54A 2WXHA 1FVFA 1N0QA 1DNPA 3UX4A 2R03A 3LFPA 4L9PA 4BY6A 2WXQA 2F8YA 3UT4A 1N11A 4WAFA 3AU4A 5M72A 5DRTA 2DBAA 1MFQC 4J1WA 4E6HA 4HLEA 4X8QA 3QYXA 2DZNA 3GN5A 2LUHA 4BTAA 2PZIA 1MHQA 1OWPA 5HQ8A 3Q9NC 2XRYA 3CQGB 1S0PA 3FEYA 4JHKA 4BX9A 3C3OA 2IOSA 1INZA 5FQ7A 3RRUA 3ZPXA 4GTTA 3GZSA 2XXAA 3CHSA 2AJAA 4OYSA 1XWRA 1NL4A 3S7FA 4ATZD 2JQEA 2P9KG 4OAVB 1B0NA 1HE8A 3HHMA 4WVLA 3UM2A 4HI8A 5FIOA 4XEIG 1U2VG 3QKYA 4N5QA 3QOXA 5DTMA 2IQCA 4K5CA 3ZN3A 4Z58A 4GA2A 3GZ2A 2JEKA 2ICTA 2GRPB 2V5QC 2HSGA 3FEXA 2WPVA 2EWTA 2IJGX 5DRYA 3C72A 4M3OA 2RFAA 3RK6A 4HBDA 2ICPA 4L23A 2RG8A 5AJLA 3FTVA 3NXHA 5KCMA 3Q47B 5JJ6A 3MKRA 1HS6A 4APFA 4A3TA 3G2VA 2LYLA 3ESKA 2WXNA 3OMTA 4FC8A 1K3ZD 4MCTA 2H6HA 2I1KA 2VYIA 3FH8A 3UIPC 3DEOA 2XXQA 2WXRA 4UWLA 3ESLA 4RG9A 1R69A 4Z5DA 3PZ1A 1H0AA 4L7TA 2ODRD 1JFSA 5JJTA 4UWFA 3MA5A 3QJZA 4CEMA 3A9ZA 4GZ5A 2B6CA 1NA3A 4LEUA 5E75A 4BSXA 4RVBA 3ZFWA 5EYPF 5DTQA 5J90A 3Q7FA 2CHZA 3B13A 3PNLB 2XGOA 4I6RA 4OBMA 3TG5A 4G11A 4NURA 5J08A 2PXQA 2WXLA 2X6KA 3PUJA 3PUKA 2PXFA 5EKQD 2CROA 4B93B 2OVFA 5DTRA 4LCTA 1MQSA 2I6HA 1MJ0A 3UUXA 3QWWA 4D10C 4G23A 4LERA 4CYMD 2YNQA 4E85A 1B89A 2XQ0A 2DZOA 2X3MA 5C1DA 2ZU6B 2NSZA 3FP3A 1N52A 5CERB 3B7HA 4ILGA 3RJVA 4TXRA 4CGVA 2KATA 4U0ZA 2BNOA 2BTDA 1RIOA 1UXCA 1Z6TA 4NRHB 1AWCB 3TG4A 1RW2A 2HM8A 3QOUA 3B7BA 4IRUA 1KLXA 4G24A 4EQZA 5AQAA 3SI5A 2LXLA 3E33A 4J8SA 3O48A 3CSTA 5BXUA 2QYUA 5FWQA 1RZRD 3HXDA 3ASOE 1BI8B 4X4CA 4MCXA 3BD1A 5B1AE 2PIJA 3SD5A 3MKQB 1ZZ9A 1A5EA 3TAXA 2OEWA 4CRWA 1TNBA 4JCXA 1FPPA 5BV0A 1JCSA 1QQEA 2IU7A 2ONDA 3UIOC 2V8SE 1O5MA 3MLFA 1N95A 3PZDA 1A17A 2WXIA 3Q4AB 3ZPJA 2PXVA 4APOA 2PQNA 3SCGA 1XNFA 3CKCA 1LLIA 4TUUA 4M7CA 1OCRE 3D9KA 4O1PA 5HI7A 3QF3A 3JXBC 4B89A 1DC2A 4HXIA 2XPIA 4DI3A 2FI7A 5CMYA 3ZYKA 5FZRA 2OFYA 3SGHA 1N0RA 5C2YA 3AG4E 1PRUA 4HORA 2LSVA 1TYQG 2NC9A 3RRMB 4PU4C 4U07A 3V30A 4DLQA 4F7AA 2HYZA 2WMNA 4BX8A 3ZGQA 3CHOA 3NQPA 1UTXA 2LYRA 5AENA 1JWLA 4JB8P 2XPZA 3UWPA 1OXJA 3FUHA 1LD7A 4WNFA 4C0EA 4BEPA 4U95D 5JMND 3Q78A 3HVEA 4O60A 2P9PG 4I6TA 3D9MA 3D9NA 2R05A 1CJGA 4B8AA 4YVOA 3QOWA 4YBAA 1E7UA 4IN3B 1DWKA 5GAGi 4ATGA 4L2LA 2XIUA 1PNRA 3FTZA 1HF8A 1PERL 3SHFA 4YG1A 4XX5A 3DM5A 3S7JA 3FUKA 3PNTB 2PXBA 3ASFA 5HS0A 1N4RA 3JQ0A 3SR4A 2DYSE 1NP7A 4CCAA 4ER0A 1UW4B 1RZRA 3PXPA 5T4YA 4U63A 1K1BA 3QARA 3IHYA 2WXJA 3KEZA 2LYJA 1Y9QA 3NF1A 3UKUG 1UN9A 3SBTB 5EIDA 4AP2A 2WXGA 2XXPA 3DXKG 4I2ZA 2AXUA 4MBGA 2RKKA 4HFGA 5G2NA 3CVWA 3DBSA 2VEOA 3CKBA 1PY1A 1ZZBA 2VGEA 4XZ4A 3R7QA 1WH8A 3NDBB 4GU5A 1XGWA 3C3QA 3ASDA 4J8EA 1WAO1 3ZIMA 3BS3A 4DX7D 4LUNU 2AXZA 1TN7A 1N4QA 2P58C 4I9EA 2XEEA 3R09A 4PUCA 4Z5HA 3DSTA 1X81A 4AJWA 3CVPA 3HZIB 3L1PA 3MYVA 4I6GA 3DPDA 3ULQA 3IXEA 5G04J 4UQZA 3UPVA 4KYOB 3L17A 4DLOA 3JUIA 3WXXA 2LCVA 2PUBA 3D9IA 1WETA 2H8RA 2LAHA 5BW8C 1UG3A 3FTYA 5D0QD 3EIQC 2P2CP 3EU5A 4BT8A 1R63A 2NXPA 3RO2A 5B3SE 4NQ0A 2JVLA 3SO8A 1JFTA 4QQIA 3ISMC 3VLEA 5JHBA 3PRZA 3OQNA 3CQCB 5BT1A 3L6AA 1QNFA 2QZAA 1OWLA 3FU6A 2X6JA 4A63B 4AY5A 3W9GA 2GZUA 5LFAA 3ZHMA 2XCJA 3RSEG 3AG1E 2L49A 5CHEE 2VGYA 4CGWA 2IONA 4JPSA 3GYZA 4O1OA 4PS3A 4GAAA 2PUAA 3CVYA 3U9WA 4AVXA 2DYRE 2A6CA 4G1TA 3SCFA 3L22A 4XKCA 1YYHA 3FY4A 4GZ3A 4Y42A 3CV0A 3D9LA 1N94A 2EINE 3UI2A 3URZA 3SY2A 1D8DA 2A5EA 3MX3A 3CHPA 3U3WA 3VTYA 2YHCA 4AEZC 2P9SG 1HH8A 2PXUA 2FJRA 1YSEA 3TWQA 2PM6A 3PZ2A 2V3CC 3V2XA 1LCCA 1IXVA 3APDA 4YVQC 3A9XA 2GROB 2VGXB 2IFUA 4U04A 3I5PA 1BD8A 3T9KA 2BUGA 5FQ4A 1ZZCA 5CBOA 3CIAA 3D9OA 1H2UA 2RFMA 5BV1A 2J8SD 2Y3AA 3PVLA 3T5VA 1IHBA 2C0LA 3CK8A 4BSZB 2L0TB 3VTXA 1O1SA 4A3VA 4GZCA 5G55A 2DWZA 4UI9K 2CG3A 5ENRD 4WNGA 4Z5CA 4NDWA 2PXKA 3AJIA 1IYGA 3QC1A 2IUOA 4JEHA 1WIZA 2LYSA 2ZXWE 4K03A 3L08A 4GTQA 3CVQA 3F6WA 2LO6A 2GRNB 3TXNA 4N2QA 4PS8A 3BUAA 2XGSA 4FADA 4ER3A 2EQXA 3ASNE 4DE8A 4FBIA 2IF4A 5BXOA 4UUCA 3BEEA 4ILHB 4EHMA 3APCA 2IOLA 3CVLA 3HXEA 4MLPA 2MRIA 1OSLA 4OVVA 3RIBA 1HXIA 2IV1A 4EECA 4JVSA 4AY6A 2F37A 4CZ2D 4MKTA 5HKPA 4G2VA 1DULA 4EZKA 1YCSB 3KSQA 3MJWA 4V3IA 3MV2B 1OCCE 5AQ7A 3PS6A 4I8TA 2JLBA 1SA4A 4TUMA 2MXDA 2XZDG 2JABA 4PDXA 5EX0A 5ENOD 5EILA 4EZLA 3OP9A 2PUCA 3CK9A 1QBQA 3ZYQA 3VLFA 4YDWA 4LG6A 4I1MA 4GZDA 1KT1A
chains in the Genus database with same CATH topology
3O48A 3CSTA 4GZ6A 5FWQA 3OQMA 2VTBB 2WXMA 4GCOA 1RZRD 1X2LA 4O6FA 1UJKA 1IQRA 3ZYMA 2EF8A 2WIUB 5A7DB 3ASHA 2AW6A 2XSDC 3QNKA 4X4CA 4MCXA 3BD1A 4TV3A 3LVQE 5ANLA 5LOZA 2KCKA 4GCNA 1X57A 2PIJA 3FUNA 5KJNA 2EBYA 4N5CA 3EUSA 1BDHA 3SD5A 3MKQB 2VSNA 1ZZ9A 2MQKA 1DVPA 3MGBA 1OUVA 3TAXA 3U64A 4CRWA 4ANVA 3TXMA 3QK0A 4N3CA 4ILIA 4GMJA 4JCXA 2C0MA 4GYWA 4X4GA 3IVPA 2WM9A 2WVIA 4QFVA 5BV0A 4F1SA 3Q15A 3QQ6A 3MKQA 4BTBA 1EFAA 3CHQA 1QQEA 3HDXA 2IU7A 5ARFA 2ONDA 2FO7A 2V8SE 5FJYA 3MLFA 1EPUA 4UWKA 3PZDA 1GT0C 1A17A 3R1FA 2KC7A 1NERA 2WXIA 3Q4AB 3ZPJA 3ZYLA 1UXDA 5AYWD 4FJYA 2CFUA 4I9CA 4WNEA 3G2SA 4APOA 3FH7A 2VSXE 2PQNA 1S7EA 5BNWA 3FUIA 3TRBA 3FFLA 4FJZA 3PREA 1DW9A 1QQBA 3QWGA 3SCGA 3B7SA 3KXAA 1XNFA 4I6UA 3KZ3A 2WXPA 1LMB3 1VPWA 1E8ZA 3AU5A 3CKCA 4CDNA 4J0UA 5A7LA 1LLIA 1JWFA 2X6FA 3CVNA 3LEWA 2PE5A 1RZSA 3D3MA 4TUUA 5DBKA 3FU3A 2OOEA 4FN3A 3D9KA 2DIWA 4HS2A 3QF3A 2RD0A 3JXBC 5HI7A 1LF8A 4B89A 4ANUA 4DK5A 1ZS4A 5FT9A 5DIZA 4MS6A 2KM4A 4HXIA 2XPIA 3KAEA 4DI3A 4J8DA 4FU3A 2FI7A 2MEZA 2YHEA 3JCKC 2XCBA 5CMYA 5FZRA 2GRLA 3ZYKA 2OFYA 3SGHA 4I2WA 5C2YA 5T8IA 2BNMA 3OXLA 3TGOA 2O49A 1PRUA 1GW6A 3UMVA 5LCWJ 4HORA 2HR2A 2LSVA 3P2BA 1TEZA 2PUDA 2NC9A 3FUDA 3OQOA 3RRMB 4PU4C 4WWPA 1Y7YA 4U07A 1Z3YA 4JZYA 3SCHA 2R59A 4DLQA 4F7AA 1OCTC 4WNDA 2Y4TA 1PRAA 3VLDA 3LYAA 2HYZA 2WMNA 1L1MA 4KBQA 2UWJG 1FCHA 3C98A 3FULA 4BX8A 2DCPA 3ONKA 3ZGQA 3CHOA 2C2LA 1WH6A 3OXGA 2YINA 2CG2A 2X6HA 3NQPA 5LCWC 1UTXA 3EJNA 3EIJA 3ZXSA 2KZTB 2LYRA 1UJJA 2XGMA 5KJLA 1SQMA 3FDHA 5LP0A 1QQAA 1EDUA 2WXFA 3MEKA 1ELWA 4ANWA 2J49A 3RRNB 5AENA 1AU7A 1ZU2A 1TJCA 5FZQA 2PUGA 1JWLA 3ML9A 4F3VA 2XPZA 5FQ6A 3EHMA 3FUHA 2J08A 3VK0A 4RSYA 4WNFA 4WWNA 4C0EA 4H7XA 3LISA 1HG5A 4J1XA 3FTUA 3AS4A 3LDZA 4UQYA 4A1SA 2WQHA 1Z3XA 2E0IA 1SQ8A 3ZHIA 3G2UA 4DJAA 4N3BA 3HVEA 4GA0A 2KEIA 2JCGA 3F52A 1QP4A 3FTSA 4HOUA 2CFZA 3B7RL 5JHAA 3UT8A 4I6TA 3D9MA 2R1JL 3D9NA 1CJGA 2J07A 3G5GA 4UI9C 3NZUA 4XI9A 4YVOA 4B8AA 4GPKA 2VGXA 3JXCL 1H19A 4TRQA 5EDSA 5CMWA 1JWGA 4YBAA 1E7UA 4IN3B 4KVOA 1DWKA 4GMLA 4ATGA 4PU3C 3UFDA 2XIUA 4L2LA 4IA8A 3S2AA 3S7BA 1PNRA 3FTZA 1BDIA 2J09A 1BPOA 1HF8A 1PERL 2FBNA 3I4GA 4KT6B 3GBFA 4IULA 3R9AB 3SHFA 3KD7A 4YG1A 2UY1B 4XX5A 5K98B 4X4FA 2HO1A 3KS2A 4I6EA 1Y8MA 4O8BA 3FUKA 3PNTB 2I9CA 4HOQA 3ASFA 3S7JA 4KVMA 2YQ8A 1E3OC 2XCCA 2IVGA 2LYKA 3FU0A 4RG6A 3CGHA 3JQ0A 5A6CA 1NA0A 2AWIA 3QDNA 4I6JA 3NZSA 4JW1A 3UQ3A 4BFRA 2X38A 1LQCA 4AIFA 1NP7A 2GGFA 4CCAA 2WB2A 2VTBA 4IYPA 3JYSA 4J8FA 1H6KA 1KT0A 2XJ3A 3CLCA 3O9XA 3CROL 3MZLB 1UW4B 1ZZ7A 1RZRA 3PXPA 4G25A 2J9QA 4U63A 5T4YA 3PE3A 3ZW3A 2VSOE 3CLJA 4JEUA 3B7UX 3CR3A 1E8YA 4I1OB 4JHRA 3FUMA 4FHKA 3QARA 3IHYA 3RU0A 3I3NA 4XIFA 2WXJA 2GW1A 5CCMA 1FVHA 2MOWA 3EHNA 4XI0A 3KEZA 3P1UA 2LYJA 4MRUA 1JUQA 1IC8A 1Y9QA 3NF1A 1SZ9A 2LYQA 1UN9A 2VQ2A 2XHEA 4GA1A 3SBTB 1PC2A 2PUEA 3TJPA 4EPZA 4FULA 4AP2A 2OV8A 2VSYA 2WXGA 3BDNA 2BJCA 3RZZA 2J4BA 2MHKA 2KCVA 2V0PA 4I2ZA 3SZ7A 2AXUA 2FULA 4JL0A 4U0SA 3D9JA 4JXTA 4X4EA 3FTXA 4HFGA 4CT4A 4IWRA 3T8MA 1HFAA 3ZRHA 5G2NA 2VJ8A 2PPXA 3CHRA 1E7VA 3DBSA 3LXUX 3QWPA 3CVWA 4EQFA 2WXOA 3H5TA 5JJ7A 3APFA 3ASGA 5AJDA 1UN8A 2L9BA 3CKBA 3FU5A 3SFZA 3FUJA 1ZUGA 1PY1A 4F53A 4W9RA 4Y6WA 3LY7A 4Z59A 4I43A 1ZZBA 4XZ4A 1ELRA 2V5FA 3R7QA 3PEVB 1E8XA 1WH8A 4GYYA 2BF0X 4EBAA 4GU5A 2PQRA 4N2SA 3UT7A 3RO3A 3CK7A 1XGWA 3JQ1A 3ASDA 2A4ZA 1WAO1 1SZAA 3L16A 4J8EA 1WM5A 2OVBA 2M63A 3ZIMA 4LRZA 5EX3A 3BS3A 4EBAG 3HYMB 1ZVVA 4LUNU 4YG4A 2AXZA 1OWOA 4ME2A 1ZPQA 2IVBA 1NZNA 3PEUB 4JA7A 2P58C 1QP0A 4WWOA 4B8CB 3JXDL 2PL2A 3I4RB 4ACKA 2QFCA 1CQTA 4I9EA 4PU7A 1TJFA 2PM7A 3GW4A 2AVPA 3IEGA 4K0RA 1JPLA 2LYPA 1N54A 2WXHA 1FVFA 4Q96A 3S8QA 4U8HA 4CDMA 4PUCA 4Z5HA 3L54A 4UI9J 3FTWA 2ILRA 1Y6IA 1DNPA 3UX4A 1W3BA 5E76A 4B94A 3LFPA 4AJWA 3CVPA 4AXHA 1ADRA 3IV0A 3PH0C 4BY6A 3HZIB 2WXQA 2AXVA 3QWVA 3L1PA 3MYVA 3FMYA 4I6GA 3DPDA 4KMOA 3ULQA 4FA6A 2CSFA 3UT4A 3LPZA 5G04J 4UQZA 3UPVA 1PAQA 3AU4A 4KYOB 4WAFA 5M72A 2DBAA 1HX8A 4J1WA 3L17A 4E6HA 4DLOA 1HU3A 3JUIA 3U66A 4HLEA 4Q94A 2R17C 4JCYA 3WXXA 2FEZA 3QYXA 2LCVA 3GN5A 1U3DA 2PUBA 1IQUA 3D9IA 3FUFA 1WETA 4BTAA 3AS5A 2KPJA 2H8RA 2LAHA 5BW8C 2PZIA 3SNXA 4HOSA 1MHQA 1UG3A 1OWPA 3FTYA 5D0QD 4OB4A 4YG7B 5HQ8A 3BG0B 2XRYA 3EIQC 5AIJA 3CQGB 3GN5B 2CHXA 2L6JA 1H2VC 3FHEA 4XKBA 5KJKA 1S0PA 1POUA 4BT8A 2OR1L 1R63A 2NXPA 3FEYA 4JHKA 4F8DA 4JA9A 3RO2A 3ZHEA 4BX9A 2PUFA 4N3AA 4J6IA 4NQ0A 2JVLA 2IOSA 2L0IA 4KZ0A 4XE0A 1INZA 4L2YA 5FQ7A 1JFTA 3RRUA 2QY7A 3VLEA 3GZSA 4FLBA 1JH9A 5JHBA 3CHSA 1L5JA 3QAQA 3CEQA 3IHVA 3PRZA 3CECA 4OYSA 3OQNA 3CQCB 5BT1A 1XWRA 3L6AA 1QNFA 4DI4A 3ZVVA 2LSUA 3S7FA 1OWLA 3D1NI 3FU6A 2X6JA 4AY5A 4BWRA 2UY1A 1B0NA 2GZUA 5LFAA 5ANRA 3ZHMA 2XCJA 3ZEFA 1HE8A 3HHMA 3U4TA 1U3CA 4X4DA 3HIZA 3QKYA 2R63A 2IQCA 3SBSA 1E96B 3ZN3A 2L49A 4JC8A 4ABNA 4Z58A 2I2OA 5CHEE 5CCLA 4GA2A 4I17A 2VGYA 4CGWA 2IONA 1HG2A 4JPSA 1EF1C 3GZ2A 2JEKA 2ICTA 3GYZA 3LKUA 3RKVA 5KJMA 2HSGA 3FEXA 2WPVA 5BPPA 3N71A 4FLHA 4CDRA 3FH5A 3EDTB 2GRMA 3CVVA 4PS3A 2D5VA 4GAAA 2EWTA 2IJGX 2PUAA 4M3OA 4GYOA 1NEQA 3RK6A 2XEVA 3CVYA 3CVXA 4AV7A 3U9WA 3BG1B 4AVXA 3MV3B 2ICPA 2A6CA 1EYHA 4G1TA 4GB9A 5LX8A 4L23A 3SCFA 3L22A 2RG8A 2E2EA 2HINA 4XKCA 5AJLA 3TL5A 1ELKA 3E4BA 3FTVA 3OXFA 4BT9A 1X5BA 5KCMA 5BUZA 3Q47B 5JJ6A 3MKRA 1HS6A 4R7LA 3ONLA 3PE4A 2WUSR 2XRZA 4APFA 2IU1A 4A3TA 3G2VA 3FY4A 2LYLA 3ESKA 4AM9A 2WXNA 3L13A 4IVZA 4GZ3A 1H2TC 4OVUA 3OMTA 4Y42A 3CV0A 4FC8A 2KZTA 2XI8A 4PS7A 3D9LA 4P29A 4MCTA 2I1KA 2VYIA 3URZA 3FUEA 3FH8A 3LS8A 4Q69A 3MX3A 4H7YA 3CHPA 3U3WA 2WXRA 4UWLA 2YHCA 5T3RA 3VTYA 4AEZC 4B0ZA 3ESLA 4RG9A 2KEKA 1R69A 4Z5DA 1HH8A 4UWHA 4UWGA 3CVUA 1H0AA 3ENEA 4L7TA 4HVBA 2FJRA 4URKA 1YSEA 1JFSA 5JJTA 2PM6A 4UWFA 3MA5A 4GQMA 1LCCA 3APDA 4YVQC 1OWNA 2CHWA 3QJZA 2WQ7A 4CEMA 3FWVA 4U0UA 3R7RA 2VGXB 2IFUA 2WXKA 3I5PA 4U04A 3ML8A 4GZ5A 1QZ2A 1O4XA 4JQDA 2BUGA 5FQ4A 1E90A 1NA3A 1P5QA 4LEUA 3G2TA 4HOTA 1E8WA 5E75A 1ZZCA 3CIAA 3D9OA 4X4BA 4A1GA 1HZ4A 1H2UA 3SF4A 4BSXA 3F51A 3G7DA 4ANXA 3Q5MA 4RVBA 3ZFWA 3LY9A 5BV1A 4KZCA 5ENNA 4JHJA 2Y3AA 5J90A 2A5UA 4UQXA 2WMOA 3LVRE 3PVLA 3T5VA 3T5XA 2C0LA 2CHZA 3B13A 3PNLB 2XGOA 4I6RA 4EZJA 3TG5A 4G11A 3LCAA 4NURA 3KJXA 5J08A 3CK8A 1PRVA 1WY6A 2BNNA 2L0TB 2WXLA 2X6KA 3VTXA 1ZZ8A 4A3VA 3PUJA 3GZ1A 4C0MA 1ZBPA 4GZCA 3IBEA 5G55A 3PUKA 4UI9K 2CG3A 2V4LA 3K9IA 4WNGA 4Z5CA 4NDWA 1QP7A 1OWMA 5EKQD 4YNDA 2WQ6A 1IYGA 4KXKB 2CROA 1ZZ6A 2XPYA 3QC1A 2OVFA 4AOFA 5FTPA 3Q49B 2IUOA 4GZDA 4JEHA 4LCTA 1WIZA 2I1JA 2LYSA 1MQSA 2I6HA 3B7TA 4K03A 2LAIA 3L08A 1LCDA 5FZSA 4A55A 3UUXA 3QB2A 3QWWA 1YA0A 4L1BA 4D10C 4G23A 2AUWA 3F6WA 2LO6A 1VDYA 3CVQA 4LERA 3TXNA 3CHMA 2YNQA 4N2QA 2X6IA 4PS8A 4X4IA 2Y4UA 4G26A 4DPRA 1B89A 4E85A 4WUYA 2XGSA 4FADA 1IHGA 2EQXA 2XQ0A 4FBIA 3FYAA 2IF4A 2X3MA 3ZHEB 2FF4A 3BEEA 3LJ3A 4ILHB 5FQ8A 3APCA 4PH4B 2IOLA 2ZU6B 3CVLA 5C1DA 2NSZA 3FYMA 2Q7FA 2O38A 3ZKCA 2MRIA 1OSLA 1N52A 3FP3A 4MLPA 4OVVA 3RIBA 3B7HA 1HXIA 1ZAYA 4NACA 2IV1A 3DNVB 3HVEB 4ILGA 3RJVA 4EECA 2KEJA 2R5SA 2KCLA 4CGVA 4JVSA 4AY6A 1RPEL 3OTNA 3IKOB 2KATA 4MKTA 5ARGA 4U0ZA 5G04C 4C9BB 4YARA 2BNOA 4X4HA 3AS8A 3PDNA 2BTDA 5G05C 1RIOA 1UXCA 1HF0A 4G2VA 4EZKA 3LY8A 4I1AA 3S7DA 3MJWA 4V3IA 1Z6TA 4NRHB 2KZ8A 3MV2B 4GHJA 2L8NA 3O4ZA 5G05J 3OAWA 1QPZA 3TG4A 3D9PA 4FP7A 3PS6A 4I8TA 2HM8A 2JLBA 4ACLA 2IVQA 2LNIA 4Y6CA 3QOUA 4PDXA 3MCXA 5EX0A 4EZLA 4FHJA 3OP9A 4IRUA 3CSFA 2PUCA 5A23A 3CK9A 1KLXA 4I1MA 4G24A 3ZYQA 4CT0A 3SI5A 4N39A 3VLFA 5D0OD 3G2WA 2J4DA 2O4AA 2B5AA 4PU8A 1HO8A 4J8SA 1KT1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R1J L;  1R69 A;  4Z5D A;  3L1P A;  3FMY A;  1CJG A;  3G5G A;  3OQM A;  2FJR A;  2CSF A;  1YSE A;  1RZR D;  1X2L A;  1JFS A;  3JXC L;  2EF8 A;  2WIU B;  4GQM A;  1LCC A;  4YBA A;  2AW6 A;  2XSD C;  4X4C A;  4MCX A;  3BD1 A;  1DWK A;  4J1W A;  4PU3 C;  3UFD A;  2XIU A;  4IA8 A;  1X57 A;  1PNR A;  2PIJ A;  1BDI A;  4JCY A;  2EBY A;  1PER L;  3EUS A;  3QYX A;  1O4X A;  2LCV A;  3GBF A;  3GN5 A;  1ZZ9 A;  2MQK A;  1BDH A;  4YG1 A;  2PUB A;  4JQD A;  5K98 B;  4X4F A;  1WET A;  2KPJ A;  2H8R A;  1ZZC A;  4O8B A;  4JCX A;  4OB4 A;  4YG7 B;  4X4G A;  4X4B A;  3IVP A;  3F51 A;  3G7D A;  3GN5 B;  3QQ6 A;  1EFA A;  1E3O C;  2IU7 A;  1POU A;  2OR1 L;  2IVG A;  1R63 A;  2LYK A;  3MLF A;  4F8D A;  1GT0 C;  2AWI A;  3R1F A;  2PUF A;  4I6R A;  1NER A;  2JVL A;  1UXD A;  1LQC A;  3KJX A;  1PRV A;  2BNN A;  1JFT A;  1S7E A;  1ZZ8 A;  1JH9 A;  3TRB A;  2XJ3 A;  3CLC A;  3O9X A;  3CRO L;  1DW9 A;  1ZZ7 A;  1RZR A;  3PXP A;  3QWG A;  3SCG A;  1QQB A;  3KXA A;  4I6U A;  3KZ3 A;  4Z5C A;  4NDW A;  1LMB 3;  3CEC A;  1QP7 A;  1VPW A;  3OQN A;  5A7L A;  1XWR A;  1LLI A;  2CRO A;  1ZZ6 A;  2PE5 A;  1RZS A;  3D1N I;  2IUO A;  1WIZ A;  2LYS A;  2LYJ A;  4FN3 A;  1B0N A;  3QF3 A;  1LCD A;  3JXB C;  2GZU A;  1IC8 A;  1Y9Q A;  3ZHM A;  2XCJ A;  2LYQ A;  1ZS4 A;  2AUW A;  3F6W A;  2PUE A;  4X4D A;  4X4I A;  2R63 A;  3BDN A;  3RZZ A;  2BJC A;  2MEZ A;  2AXU A;  4FBI A;  2GRL A;  2L49 A;  2OFY A;  3FYA A;  4Z58 A;  4X4E A;  2BNM A;  4IWR A;  2O49 A;  1PRU A;  2PPX A;  2ICT A;  3FYM A;  2HSG A;  2O38 A;  3H5T A;  3ZKC A;  1OSL A;  2PUD A;  3B7H A;  3OQO A;  1ZAY A;  2GRM A;  2IV1 A;  4PU4 C;  1Y7Y A;  3DNV B;  1ZUG A;  2KEJ A;  2D5V A;  3SCH A;  2EWT A;  2PUA A;  1OCT C;  1RPE L;  4Z59 A;  1PRA A;  1ZZB A;  1NEQ A;  4YAR A;  1WH8 A;  1L1M A;  2BNO A;  4X4H A;  2ICP A;  2A6C A;  1RIO A;  1UXC A;  1HF0 A;  3SCF A;  1WH6 A;  2HIN A;  3BS3 A;  1UTX A;  2KZ8 A;  4GHJ A;  2L8N A;  2LYR A;  4YG4 A;  1ZVV A;  2AXZ A;  1QPZ A;  2WUS R;  1ZPQ A;  2IVB A;  1QQA A;  4I8T A;  1QP0 A;  2IVQ A;  2LYL A;  3JXD L;  1AU7 A;  4IVZ A;  1CQT A;  2PUG A;  4PU7 A;  1JWL A;  3OMT A;  3OP9 A;  4Y42 A;  2XI8 A;  2PUC A;  3VK0 A;  2LYP A;  4MCT A;  3LIS A;  4J1X A;  3S8Q A;  4Z5H A;  1SQ8 A;  3ZHI A;  3LFP A;  3U3W A;  2KEI A;  2JCG A;  3F52 A;  1QP4 A;  1ADR A;  2O4A A;  2B5A A;  4PU8 A;  3HZI B;  2AXV A;  4I6T A;  2KEK A; 
#chains in the Genus database with same CATH topology
 4GZ6 A;  2VTB B;  3QFI A;  1UJK A;  1IQR A;  2EF8 A;  2WIU B;  3G0T A;  2AW6 A;  3QNK A;  3HXF A;  3LVQ E;  4Z68 A;  5H7P A;  4U8V D;  2MQK A;  1OUV A;  3U64 A;  4N3C A;  4GMJ A;  1H6O A;  2C0M A;  4X4G A;  4GYW A;  4QFV A;  2FO7 A;  4UWK A;  1S64 A;  1KZO A;  5AYW D;  3UIN C;  2CFU A;  3PE5 A;  3FUI A;  4FJZ A;  1NFI E;  3UM1 A;  3DSS A;  1LMB 3;  2GRR B;  4CDN A;  4J0U A;  3LEW A;  3FU3 A;  1DCE A;  3LQX A;  2RD0 A;  1LF8 A;  4ANU A;  4Q2J A;  4DK5 A;  4FU3 A;  4DE9 A;  4ZFH A;  2XCB A;  4I2W A;  3OXL A;  2O49 A;  1GW6 A;  1TEZ A;  1Y7Y A;  1Z3Y A;  3SCH A;  2R59 A;  4ER5 A;  4WND A;  1PRA A;  3VLD A;  3Q73 A;  1FCH A;  3FUL A;  1MYO A;  3BU8 A;  5FIN A;  1WH6 A;  3KSL A;  2V4H C;  4LNG A;  3EJN A;  1UJJ A;  2XGM A;  1SQM A;  4U7E B;  1EDU A;  2WXF A;  1ELW A;  3ZUV B;  3DRA A;  3D9H A;  3ML9 A;  2P9I G;  4RSY A;  1NI1 A;  4H7X A;  4ZHB A;  3LDZ A;  4UQY A;  4A1S A;  2E0I A;  3ZU7 B;  1SQ8 A;  3G2U A;  5CRU A;  4N3B A;  4DJA A;  3B7R L;  2ETC A;  5JHA A;  2R1J L;  2J07 A;  3G5G A;  2P9U G;  2VGX A;  2M4H A;  3S2A A;  2J09 A;  3GBF A;  2HO1 A;  2XEH A;  2I9C A;  5D66 A;  4DRX E;  4BET A;  1E3O C;  2XCC A;  3FU0 A;  2X38 A;  1ZB1 A;  2PXE A;  3JYS A;  1H6K A;  3RAU A;  3CLC A;  3CRO L;  1ZZ7 A;  4G25 A;  3PE3 A;  3B7U X;  4I1O B;  1E8Y A;  4NIK A;  4JHR A;  3FUM A;  1Z5S C;  3RU0 A;  2GW1 A;  1FVH A;  4EKI A;  3EHQ A;  4XI0 A;  4MRU A;  2OEV A;  3JUE A;  4HRM B;  2LYQ A;  4GA1 A;  1Q2Z A;  2PUE A;  4EPZ A;  2H6G A;  2OV8 A;  2BJC A;  3BDN A;  2V0P A;  3ZNG A;  2FUL A;  4JL0 A;  4JXT A;  3FTX A;  4CT4 A;  3LXU X;  3CHR A;  1E7V A;  3ASG A;  5AJD A;  1UN8 A;  2L9B A;  4EK9 A;  1ZUG A;  3HG0 D;  4F53 A;  3LY7 A;  3B95 A;  2V5F A;  3PEV B;  4GYY A;  3CK7 A;  2A4Z A;  1SZA A;  3L16 A;  2M63 A;  1K8K G;  4DX1 A;  3HYM B;  1ZPQ A;  1QP0 A;  4B8C B;  3JXD L;  2QFC A;  4LNB A;  2AVP A;  3IEG A;  3S8Q A;  4CDM A;  3FTW A;  4GPM A;  3DWL G;  4B94 A;  4AXH A;  1ADR A;  2PXT A;  1FT1 A;  3PH0 C;  4HRN A;  2F8X K;  2QC9 A;  4KMO A;  4FA6 A;  5HRY A;  1BLX B;  1HX8 A;  1FT2 A;  4Q94 A;  3DXM G;  5D2M C;  4JCY A;  2FEZ A;  1U3D A;  3FUF A;  3AS5 A;  2KPJ A;  3SNX A;  3EUV A;  4HOS A;  2HCN A;  3Q9U C;  4DX2 A;  3AG2 E;  2CHX A;  2L6J A;  1H2V C;  3GUU A;  2OR1 L;  3PZ3 A;  4GTO A;  2PUF A;  4KZ0 A;  4L2Y A;  3TWX A;  5JA4 D;  2Y69 E;  1JH9 A;  1TNY A;  3IHV A;  2PNN A;  3CEC A;  4BER A;  4DI4 A;  3ZVV A;  2LSU A;  4LNU D;  1WG0 A;  2UY1 A;  5AN8 A;  1N4S A;  3SBS A;  4JC8 A;  3VWS A;  2I2O A;  5CCL A;  2EIJ E;  1HG2 A;  3RKV A;  3Q75 A;  3W9F A;  5BPP A;  3N71 A;  4FLH A;  3FH5 A;  2GRM A;  3CVV A;  2D5V A;  4GYO A;  1NEQ A;  2XEV A;  4AV7 A;  3BG1 B;  2XS8 A;  4GB9 A;  1EYH A;  5LX8 A;  3L9T A;  2ETA A;  3TL5 A;  3E4B A;  3OXF A;  3OWQ A;  5ITZ F;  4R7L A;  5ENP D;  3PE4 A;  1OCZ E;  2XRZ A;  3L13 A;  3UM3 A;  3C3R A;  2H6I A;  2KZT A;  4PS7 A;  4P29 A;  3FUE A;  4YDO A;  4GTM A;  2ETB A;  3M9L A;  3E37 A;  2KEK A;  1KZP A;  3CVU A;  2DVW A;  3ENE A;  4YDY A;  1QYM A;  2WQ7 A;  3FWV A;  4U0U A;  3R7R A;  3T8K A;  1P5Q A;  3G2T A;  1E8W A;  4J8Y A;  4A1G A;  1HZ4 A;  3F51 A;  4ANX A;  4KZC A;  2WMO A;  3LVR E;  3TEL A;  3KJX A;  2LXM A;  4K5B A;  1ZZ8 A;  1HQ1 A;  3GZ1 A;  4C0M A;  1ZBP A;  3IBE A;  2Y1L E;  3K9I A;  4TXQ A;  1SVX A;  2I1J A;  3B7T A;  5FZS A;  3ULY A;  4GTV A;  1LCD A;  3QB2 A;  2ZGD A;  4L1B A;  4RLY A;  3CHM A;  1D8E A;  2Y4U A;  3WG7 E;  1OY3 D;  1IHG A;  3ZHE B;  2EIM E;  5FQ8 A;  1IKN D;  4UQX A;  3FYM A;  2Q7F A;  3BQO A;  1TNZ A;  4NAC A;  1ZAY A;  2R5S A;  2KCL A;  3UKR G;  1RPE L;  3MEJ A;  3OTN A;  3V79 K;  5ARG A;  5G04 C;  4YAR A;  3AS8 A;  3PDN A;  5G05 C;  3LY8 A;  3S7D A;  2KZ8 A;  1MZC A;  4GHJ A;  2L8N A;  5G05 J;  3NB2 A;  4ACL A;  2IVQ A;  2LNI A;  4Y6C A;  3MCX A;  5ENQ D;  4FHJ A;  1SW6 A;  2XS1 A;  3CSF A;  5A23 A;  1OT8 A;  2ZIS A;  4N39 A;  3KEA A;  1TR4 A;  4C48 B;  1HO8 A;  2XEN A;  2WXM A;  2ZGG A;  5A7D B;  2XSD C;  5LOZ A;  5KNG A;  2KCK A;  3FUN A;  4F6R D;  2HFZ A;  3ZKJ A;  2EBY A;  4N5C A;  3EUS A;  3MGB A;  3QK0 A;  2WM9 A;  2WVI A;  4F1S A;  3MKQ A;  1EFA A;  1TNO A;  3CHQ A;  5ARF A;  5FJY A;  1GT0 C;  3R1F A;  1JCR A;  2KC7 A;  2FO1 E;  1NER A;  1AP7 A;  5BNW A;  3FH7 A;  1S7E A;  3TRB A;  3FFL A;  3PRE A;  4HRL A;  1DW9 A;  1QQB A;  1MX2 A;  3B7S A;  3KXA A;  2WXP A;  4I6U A;  3KZ3 A;  3AU5 A;  1E8Z A;  2KBX A;  5A7L A;  1JWF A;  3CVN A;  2PE5 A;  2OOE A;  3C5R A;  4FN3 A;  3EHR A;  4HS2 A;  3NBN B;  1O1T A;  4MS6 A;  3JCK C;  2MEZ A;  2YHE A;  2GRL A;  2OCC E;  5LCW J;  5CEA A;  2HR2 A;  3P2B A;  3TWU A;  2PUD A;  4HRA A;  3OQO A;  1DCQ A;  3TWT A;  1QZX A;  1OCT C;  2Y4T A;  1JCQ A;  3LYA A;  2HE0 A;  1L1M A;  5AAR A;  4KBQ A;  2UWJ G;  1S63 A;  2C2L A;  3NOC D;  2CG2 A;  2X6H A;  3TWR A;  1BU9 A;  3E32 A;  3EIJ A;  5KJL A;  3MEK A;  4ANW A;  3RRN B;  4GTS A;  1ZU2 A;  1TJC A;  5FZQ A;  2PUG A;  4HQD A;  2YBD A;  4HI9 A;  4WWN A;  3LIS A;  1HG5 A;  3FTU A;  1N9A A;  3AS4 A;  1Z3X A;  3ZHI A;  3GZD A;  1V54 E;  2KEI A;  2JCG A;  3DSW A;  3FTS A;  4HOU A;  2CFZ A;  3UT8 A;  3L82 A;  5KNH D;  4GPK A;  5AQB A;  1QB2 A;  1MX6 A;  5EDS A;  2LLW A;  4JD2 G;  4PU3 C;  1BDI A;  2FBN A;  4KT6 B;  1V55 E;  2UY1 B;  4HB5 A;  5K98 B;  4X4F A;  4I6E A;  3HXC A;  4U96 D;  4KVM A;  2YQ8 A;  5EYL A;  5DT2 A;  2IVG A;  2LYK A;  3CGH A;  3QDN A;  4BFR A;  1LQC A;  2P9N G;  4AIF A;  4DUI A;  2WB2 A;  3UTM A;  4IYP A;  3Q7A A;  1KT0 A;  2XJ3 A;  3O9X A;  3AG3 E;  3MZL B;  2KXP C;  4U8Y D;  3KL4 A;  3ABM E;  2FFH A;  3SFY A;  3ZW3 A;  3CR3 A;  3J5Q B;  3I3N A;  4XIF A;  5CCM A;  3EHN A;  3P1U A;  1IC8 A;  1WDY A;  2VQ2 A;  2R02 A;  3TJP A;  2VSY A;  3ME5 A;  3RZZ A;  2J4B A;  2KCV A;  4X4E A;  3GZD C;  3T8M A;  1HFA A;  3NZL A;  2VJ8 A;  3QWP A;  3H5T A;  5JJ7 A;  3APF A;  1TN6 A;  3E30 A;  4W9R A;  4Z59 A;  3PZ4 A;  1E8X A;  4EBA A;  4N2S A;  3UT7 A;  1N4P A;  4J7W A;  3JQ1 A;  4BES A;  3ZXP A;  1WM5 A;  2IY0 C;  5EX3 A;  1OWO A;  2ZIR A;  4ME2 A;  2IVB A;  1BI7 B;  1NZN A;  3PEU B;  4WWO A;  2PL2 A;  3I4R B;  4PU7 A;  2PM7 A;  3X2Q E;  1JPL A;  5IY5 E;  2LYP A;  4Q96 A;  4U8H A;  4UI9 J;  3L54 A;  5JUW A;  2ILR A;  1Y6I A;  1W3B A;  4GTR A;  5E76 A;  3HRA A;  3IV0 A;  2AXV A;  1TN8 A;  3QWV A;  5DSX A;  3GZC A;  3FMY A;  3NAW A;  2CSF A;  1LTX A;  3LPZ A;  1PAQ A;  1HU3 A;  3U66 A;  4EZI A;  4DX5 D;  2R17 C;  4HLL A;  2PXP A;  3LJN A;  1IQU A;  3DSV A;  3DPY A;  4OB4 A;  4YG7 B;  3BG0 B;  5AIJ A;  2BKK B;  3GN5 B;  3FHE A;  4XKB A;  5KJK A;  1POU A;  2IO3 C;  4F8D A;  4JA9 A;  3ZHE A;  4N3A A;  4J6I A;  2L0I A;  4XE0 A;  2LNM A;  1NW3 A;  2QY7 A;  2PXD A;  4FLB A;  1L5J A;  3QAQ A;  3CEQ A;  3TWS A;  5KWD A;  4GMR A;  4G8K A;  3D1N I;  4BWR A;  5ANR A;  3ZEF A;  3U4T A;  1U3C A;  4X4D A;  3HIZ A;  2R63 A;  1E96 B;  5CEC B;  4G8L A;  4I17 A;  3V2O A;  1EF1 C;  4LSZ E;  5KJM A;  3LKU A;  3JXJ A;  4CDR A;  3EDT B;  3CVX A;  3R9M A;  3MV3 B;  4ABN A;  2E2E A;  2HIN A;  1ELK A;  4BT9 A;  1X5B A;  5BUZ A;  3ONL A;  2WUS R;  2IU1 A;  3TFL A;  4AM9 A;  4IVZ A;  3UXG A;  4OVU A;  1H2T C;  2XI8 A;  3E34 A;  5CBN A;  3LS8 A;  4Q69 A;  4H7Y A;  5T3R A;  4B0Z A;  4UWH A;  4UWG A;  4HVB A;  4URK A;  4GQM A;  4ER7 A;  1OWN A;  2CHW A;  2XZT G;  4RQI A;  2WXK A;  3ML8 A;  1QZ2 A;  1O4X A;  4JQD A;  1E90 A;  4HOT A;  4X4B A;  3SF4 A;  3G7D A;  3Q5M A;  3LY9 A;  1K1A A;  5ENN A;  4JHJ A;  2A5U A;  3T5X A;  4EZJ A;  3LCA A;  1PRV A;  1WY6 A;  2BNN A;  2V4L A;  1QP7 A;  1OWM A;  4YND A;  2WQ6 A;  4KXK B;  1ZZ6 A;  2XPY A;  4AOF A;  5FTP A;  3Q49 B;  4A55 A;  2LAI A;  1YA0 A;  2AUW A;  1VDY A;  2X6I A;  4DPR A;  4X4I A;  4G26 A;  4WUY A;  1MX4 A;  1SA5 A;  3FYA A;  1TNU A;  2FF4 A;  3LJ3 A;  4PH4 B;  2O38 A;  3ZKC A;  3V31 A;  5AAO A;  2QYJ A;  3DNV B;  3HVE B;  2KEJ A;  2LLV A;  3IKO B;  4C9B B;  4X4H A;  1HF0 A;  2J7W A;  1RZ4 A;  3NRO A;  4I1A A;  3O4Z A;  3OAW A;  1QPZ A;  3D9P A;  4FP7 A;  4DX6 D;  3DSU A;  2P9L G;  4CT0 A;  1U2Z A;  2IEJ A;  5D0O D;  3G2W A;  2J4D A;  2O4A A;  2B5A A;  4PU8 A;  3F6Q A;  5EN5 D;  3OQM A;  4GCO A;  4O6F A;  1X2L A;  3ZYM A;  2PXL A;  3ASH A;  4TV3 A;  5ANL A;  4GCN A;  1X57 A;  5KJN A;  1H6P A;  1BDH A;  2VSN A;  1DVP A;  3DEP A;  4ANV A;  3TXM A;  4OAU C;  4ILI A;  2NYJ A;  3IVP A;  3A9Y A;  3Q15 A;  3QQ6 A;  4BTB A;  3HDX A;  1EPU A;  3OKZ A;  3ZYL A;  2H6F A;  5EIB E;  1UXD A;  4FJY A;  4I9C A;  4WNE A;  3G2S A;  1D9S A;  2VSX E;  3JXI A;  3QWG A;  3AAA C;  1VPW A;  2X6F A;  1RZS A;  3D3M A;  5DBK A;  1O1R A;  1G3N B;  2DIW A;  1ZS4 A;  5FT9 A;  5DIZ A;  2KM4 A;  3KAE A;  4J8D A;  5T8I A;  2BNM A;  5GAH i;  2B0O E;  3TGO A;  3UMV A;  2F0Y A;  1LD8 A;  3FUD A;  4WWP A;  4JZY A;  2BED A;  2L1P A;  3C98 A;  2DCP A;  3ONK A;  2EIK E;  3OXG A;  2YIN A;  3NOG D;  5LCW C;  3ZXS A;  2KZT B;  3FDH A;  5LP0 A;  1QQA A;  2J49 A;  1AU7 A;  5CED B;  4F3V A;  5FQ6 A;  3EHM A;  2J08 A;  3VK0 A;  2GRQ B;  4J1X A;  2WQH A;  5KBA A;  4K5A B;  1YMP A;  3ULE G;  4GA0 A;  4ER6 A;  3F52 A;  1QP4 A;  4GTP A;  5AQ9 A;  4UI9 C;  3NZU A;  4XI9 A;  5ENS D;  2MYO A;  3JXC L;  1H19 A;  4TRQ A;  5CMW A;  1JWG A;  3J5P A;  4KVO A;  4GML A;  3UM0 A;  3UFD A;  4IA8 A;  4EKG A;  3S7B A;  3HXB A;  3TWW A;  4F1P A;  4YDE A;  3I4G A;  1BPO A;  1OCO E;  3R9A B;  4IUL A;  3KD7 A;  3DSX A;  2R2L A;  3KS2 A;  2IO2 C;  1Y8M A;  4O8B A;  4HOQ A;  4TXP A;  4RG6 A;  5A6C A;  1NA0 A;  2AWI A;  4I6J A;  3NZS A;  4JW1 A;  3UQ3 A;  2GGF A;  2VTB A;  4J8F A;  5B1B E;  5CRV A;  2J7U A;  2J9Q A;  3EU9 A;  2VSO E;  3CLJ A;  4JEU A;  2L6B A;  4FHK A;  2MOW A;  1JUQ A;  1SZ9 A;  3TWV A;  2XHE A;  1PC2 A;  4FUL A;  3TEP A;  2MHK A;  3SZ7 A;  3ABK E;  4U0S A;  3D9J A;  4IWR A;  3ZRH A;  2EIL E;  2PPX A;  4EQF A;  2WXO A;  3SFZ A;  3FU5 A;  3FUJ A;  1KPS B;  4Y6W A;  4I43 A;  1ELR A;  3SX0 A;  2BF0 X;  2PQR A;  3ABL E;  3RO3 A;  2OVB A;  4LRZ A;  4EBA G;  1ZVV A;  4YG4 A;  3Q79 A;  3SQV A;  2BKG A;  1UOH A;  3SFX A;  4JA7 A;  4HNA D;  2Y0B G;  4ACK A;  1CQT A;  1TJF A;  3GW4 A;  1S70 B;  4K0R A;  5ENT D;  2HCS A;  1N54 A;  2WXH A;  1FVF A;  1N0Q A;  1DNP A;  3UX4 A;  2R03 A;  3LFP A;  4L9P A;  4BY6 A;  2WXQ A;  2F8Y A;  3UT4 A;  1N11 A;  4WAF A;  3AU4 A;  5M72 A;  5DRT A;  2DBA A;  1MFQ C;  4J1W A;  4E6H A;  4HLE A;  4X8Q A;  3QYX A;  2DZN A;  3GN5 A;  2LUH A;  4BTA A;  2PZI A;  1MHQ A;  1OWP A;  5HQ8 A;  3Q9N C;  2XRY A;  3CQG B;  1S0P A;  3FEY A;  4JHK A;  4BX9 A;  3C3O A;  2IOS A;  1INZ A;  5FQ7 A;  3RRU A;  3ZPX A;  4GTT A;  3GZS A;  2XXA A;  3CHS A;  2AJA A;  4OYS A;  1XWR A;  1NL4 A;  3S7F A;  4ATZ D;  2JQE A;  2P9K G;  4OAV B;  1B0N A;  1HE8 A;  3HHM A;  4WVL A;  3UM2 A;  4HI8 A;  5FIO A;  4XEI G;  1U2V G;  3QKY A;  4N5Q A;  3QOX A;  5DTM A;  2IQC A;  4K5C A;  3ZN3 A;  4Z58 A;  4GA2 A;  3GZ2 A;  2JEK A;  2ICT A;  2GRP B;  2V5Q C;  2HSG A;  3FEX A;  2WPV A;  2EWT A;  2IJG X;  5DRY A;  3C72 A;  4M3O A;  2RFA A;  3RK6 A;  4HBD A;  2ICP A;  4L23 A;  2RG8 A;  5AJL A;  3FTV A;  3NXH A;  5KCM A;  3Q47 B;  5JJ6 A;  3MKR A;  1HS6 A;  4APF A;  4A3T A;  3G2V A;  2LYL A;  3ESK A;  2WXN A;  3OMT A;  4FC8 A;  1K3Z D;  4MCT A;  2H6H A;  2I1K A;  2VYI A;  3FH8 A;  3UIP C;  3DEO A;  2XXQ A;  2WXR A;  4UWL A;  3ESL A;  4RG9 A;  1R69 A;  4Z5D A;  3PZ1 A;  1H0A A;  4L7T A;  2ODR D;  1JFS A;  5JJT A;  4UWF A;  3MA5 A;  3QJZ A;  4CEM A;  3A9Z A;  4GZ5 A;  2B6C A;  1NA3 A;  4LEU A;  5E75 A;  4BSX A;  4RVB A;  3ZFW A;  5EYP F;  5DTQ A;  5J90 A;  3Q7F A;  2CHZ A;  3B13 A;  3PNL B;  2XGO A;  4I6R A;  4OBM A;  3TG5 A;  4G11 A;  4NUR A;  5J08 A;  2PXQ A;  2WXL A;  2X6K A;  3PUJ A;  3PUK A;  2PXF A;  5EKQ D;  2CRO A;  4B93 B;  2OVF A;  5DTR A;  4LCT A;  1MQS A;  2I6H A;  1MJ0 A;  3UUX A;  3QWW A;  4D10 C;  4G23 A;  4LER A;  4CYM D;  2YNQ A;  4E85 A;  1B89 A;  2XQ0 A;  2DZO A;  2X3M A;  5C1D A;  2ZU6 B;  2NSZ A;  3FP3 A;  1N52 A;  5CER B;  3B7H A;  4ILG A;  3RJV A;  4TXR A;  4CGV A;  2KAT A;  4U0Z A;  2BNO A;  2BTD A;  1RIO A;  1UXC A;  1Z6T A;  4NRH B;  1AWC B;  3TG4 A;  1RW2 A;  2HM8 A;  3QOU A;  3B7B A;  4IRU A;  1KLX A;  4G24 A;  4EQZ A;  5AQA A;  3SI5 A;  2LXL A;  3E33 A;  4J8S A;  3O48 A;  3CST A;  5BXU A;  2QYU A;  5FWQ A;  1RZR D;  3HXD A;  3ASO E;  1BI8 B;  4X4C A;  4MCX A;  3BD1 A;  5B1A E;  2PIJ A;  3SD5 A;  3MKQ B;  1ZZ9 A;  1A5E A;  3TAX A;  2OEW A;  4CRW A;  1TNB A;  4JCX A;  1FPP A;  5BV0 A;  1JCS A;  1QQE A;  2IU7 A;  2OND A;  3UIO C;  2V8S E;  1O5M A;  3MLF A;  1N95 A;  3PZD A;  1A17 A;  2WXI A;  3Q4A B;  3ZPJ A;  2PXV A;  4APO A;  2PQN A;  3SCG A;  1XNF A;  3CKC A;  1LLI A;  4TUU A;  4M7C A;  1OCR E;  3D9K A;  4O1P A;  5HI7 A;  3QF3 A;  3JXB C;  4B89 A;  1DC2 A;  4HXI A;  2XPI A;  4DI3 A;  2FI7 A;  5CMY A;  3ZYK A;  5FZR A;  2OFY A;  3SGH A;  1N0R A;  5C2Y A;  3AG4 E;  1PRU A;  4HOR A;  2LSV A;  1TYQ G;  2NC9 A;  3RRM B;  4PU4 C;  4U07 A;  3V30 A;  4DLQ A;  4F7A A;  2HYZ A;  2WMN A;  4BX8 A;  3ZGQ A;  3CHO A;  3NQP A;  1UTX A;  2LYR A;  5AEN A;  1JWL A;  4JB8 P;  2XPZ A;  3UWP A;  1OXJ A;  3FUH A;  1LD7 A;  4WNF A;  4C0E A;  4BEP A;  4U95 D;  5JMN D;  3Q78 A;  3HVE A;  4O60 A;  2P9P G;  4I6T A;  3D9M A;  3D9N A;  2R05 A;  1CJG A;  4B8A A;  4YVO A;  3QOW A;  4YBA A;  1E7U A;  4IN3 B;  1DWK A;  5GAG i;  4ATG A;  4L2L A;  2XIU A;  1PNR A;  3FTZ A;  1HF8 A;  1PER L;  3SHF A;  4YG1 A;  4XX5 A;  3DM5 A;  3S7J A;  3FUK A;  3PNT B;  2PXB A;  3ASF A;  5HS0 A;  1N4R A;  3JQ0 A;  3SR4 A;  2DYS E;  1NP7 A;  4CCA A;  4ER0 A;  1UW4 B;  1RZR A;  3PXP A;  5T4Y A;  4U63 A;  1K1B A;  3QAR A;  3IHY A;  2WXJ A;  3KEZ A;  2LYJ A;  1Y9Q A;  3NF1 A;  3UKU G;  1UN9 A;  3SBT B;  5EID A;  4AP2 A;  2WXG A;  2XXP A;  3DXK G;  4I2Z A;  2AXU A;  4MBG A;  2RKK A;  4HFG A;  5G2N A;  3CVW A;  3DBS A;  2VEO A;  3CKB A;  1PY1 A;  1ZZB A;  2VGE A;  4XZ4 A;  3R7Q A;  1WH8 A;  3NDB B;  4GU5 A;  1XGW A;  3C3Q A;  3ASD A;  4J8E A;  1WAO 1;  3ZIM A;  3BS3 A;  4DX7 D;  4LUN U;  2AXZ A;  1TN7 A;  1N4Q A;  2P58 C;  4I9E A;  2XEE A;  3R09 A;  4PUC A;  4Z5H A;  3DST A;  1X81 A;  4AJW A;  3CVP A;  3HZI B;  3L1P A;  3MYV A;  4I6G A;  3DPD A;  3ULQ A;  3IXE A;  5G04 J;  4UQZ A;  3UPV A;  4KYO B;  3L17 A;  4DLO A;  3JUI A;  3WXX A;  2LCV A;  2PUB A;  3D9I A;  1WET A;  2H8R A;  2LAH A;  5BW8 C;  1UG3 A;  3FTY A;  5D0Q D;  3EIQ C;  2P2C P;  3EU5 A;  4BT8 A;  1R63 A;  2NXP A;  3RO2 A;  5B3S E;  4NQ0 A;  2JVL A;  3SO8 A;  1JFT A;  4QQI A;  3ISM C;  3VLE A;  5JHB A;  3PRZ A;  3OQN A;  3CQC B;  5BT1 A;  3L6A A;  1QNF A;  2QZA A;  1OWL A;  3FU6 A;  2X6J A;  4A63 B;  4AY5 A;  3W9G A;  2GZU A;  5LFA A;  3ZHM A;  2XCJ A;  3RSE G;  3AG1 E;  2L49 A;  5CHE E;  2VGY A;  4CGW A;  2ION A;  4JPS A;  3GYZ A;  4O1O A;  4PS3 A;  4GAA A;  2PUA A;  3CVY A;  3U9W A;  4AVX A;  2DYR E;  2A6C A;  4G1T A;  3SCF A;  3L22 A;  4XKC A;  1YYH A;  3FY4 A;  4GZ3 A;  4Y42 A;  3CV0 A;  3D9L A;  1N94 A;  2EIN E;  3UI2 A;  3URZ A;  3SY2 A;  1D8D A;  2A5E A;  3MX3 A;  3CHP A;  3U3W A;  3VTY A;  2YHC A;  4AEZ C;  2P9S G;  1HH8 A;  2PXU A;  2FJR A;  1YSE A;  3TWQ A;  2PM6 A;  3PZ2 A;  2V3C C;  3V2X A;  1LCC A;  1IXV A;  3APD A;  4YVQ C;  3A9X A;  2GRO B;  2VGX B;  2IFU A;  4U04 A;  3I5P A;  1BD8 A;  3T9K A;  2BUG A;  5FQ4 A;  1ZZC A;  5CBO A;  3CIA A;  3D9O A;  1H2U A;  2RFM A;  5BV1 A;  2J8S D;  2Y3A A;  3PVL A;  3T5V A;  1IHB A;  2C0L A;  3CK8 A;  4BSZ B;  2L0T B;  3VTX A;  1O1S A;  4A3V A;  4GZC A;  5G55 A;  2DWZ A;  4UI9 K;  2CG3 A;  5ENR D;  4WNG A;  4Z5C A;  4NDW A;  2PXK A;  3AJI A;  1IYG A;  3QC1 A;  2IUO A;  4JEH A;  1WIZ A;  2LYS A;  2ZXW E;  4K03 A;  3L08 A;  4GTQ A;  3CVQ A;  3F6W A;  2LO6 A;  2GRN B;  3TXN A;  4N2Q A;  4PS8 A;  3BUA A;  2XGS A;  4FAD A;  4ER3 A;  2EQX A;  3ASN E;  4DE8 A;  4FBI A;  2IF4 A;  5BXO A;  4UUC A;  3BEE A;  4ILH B;  4EHM A;  3APC A;  2IOL A;  3CVL A;  3HXE A;  4MLP A;  2MRI A;  1OSL A;  4OVV A;  3RIB A;  1HXI A;  2IV1 A;  4EEC A;  4JVS A;  4AY6 A;  2F37 A;  4CZ2 D;  4MKT A;  5HKP A;  4G2V A;  1DUL A;  4EZK A;  1YCS B;  3KSQ A;  3MJW A;  4V3I A;  3MV2 B;  1OCC E;  5AQ7 A;  3PS6 A;  4I8T A;  2JLB A;  1SA4 A;  4TUM A;  2MXD A;  2XZD G;  2JAB A;  4PDX A;  5EX0 A;  5ENO D;  5EIL A;  4EZL A;  3OP9 A;  2PUC A;  3CK9 A;  1QBQ A;  3ZYQ A;  3VLF A;  4YDW A;  4LG6 A;  4I1M A;  4GZD A;  1KT1 A; 
#chains in the Genus database with same CATH homology
 3O48 A;  3CST A;  4GZ6 A;  5FWQ A;  3OQM A;  2VTB B;  2WXM A;  4GCO A;  1RZR D;  1X2L A;  4O6F A;  1UJK A;  1IQR A;  3ZYM A;  2EF8 A;  2WIU B;  5A7D B;  3ASH A;  2AW6 A;  2XSD C;  3QNK A;  4X4C A;  4MCX A;  3BD1 A;  4TV3 A;  3LVQ E;  5ANL A;  5LOZ A;  2KCK A;  4GCN A;  1X57 A;  2PIJ A;  3FUN A;  5KJN A;  2EBY A;  4N5C A;  3EUS A;  1BDH A;  3SD5 A;  3MKQ B;  2VSN A;  1ZZ9 A;  2MQK A;  1DVP A;  3MGB A;  1OUV A;  3TAX A;  3U64 A;  4CRW A;  4ANV A;  3TXM A;  3QK0 A;  4N3C A;  4ILI A;  4GMJ A;  4JCX A;  2C0M A;  4GYW A;  4X4G A;  3IVP A;  2WM9 A;  2WVI A;  4QFV A;  5BV0 A;  4F1S A;  3Q15 A;  3QQ6 A;  3MKQ A;  4BTB A;  1EFA A;  3CHQ A;  1QQE A;  3HDX A;  2IU7 A;  5ARF A;  2OND A;  2FO7 A;  2V8S E;  5FJY A;  3MLF A;  1EPU A;  4UWK A;  3PZD A;  1GT0 C;  1A17 A;  3R1F A;  2KC7 A;  1NER A;  2WXI A;  3Q4A B;  3ZPJ A;  3ZYL A;  1UXD A;  5AYW D;  4FJY A;  2CFU A;  4I9C A;  4WNE A;  3G2S A;  4APO A;  3FH7 A;  2VSX E;  2PQN A;  1S7E A;  5BNW A;  3FUI A;  3TRB A;  3FFL A;  4FJZ A;  3PRE A;  1DW9 A;  1QQB A;  3QWG A;  3SCG A;  3B7S A;  3KXA A;  1XNF A;  4I6U A;  3KZ3 A;  2WXP A;  1LMB 3;  1VPW A;  1E8Z A;  3AU5 A;  3CKC A;  4CDN A;  4J0U A;  5A7L A;  1LLI A;  1JWF A;  2X6F A;  3CVN A;  3LEW A;  2PE5 A;  1RZS A;  3D3M A;  4TUU A;  5DBK A;  3FU3 A;  2OOE A;  4FN3 A;  3D9K A;  2DIW A;  4HS2 A;  3QF3 A;  2RD0 A;  3JXB C;  5HI7 A;  1LF8 A;  4B89 A;  4ANU A;  4DK5 A;  1ZS4 A;  5FT9 A;  5DIZ A;  4MS6 A;  2KM4 A;  4HXI A;  2XPI A;  3KAE A;  4DI3 A;  4J8D A;  4FU3 A;  2FI7 A;  2MEZ A;  2YHE A;  3JCK C;  2XCB A;  5CMY A;  5FZR A;  2GRL A;  3ZYK A;  2OFY A;  3SGH A;  4I2W A;  5C2Y A;  5T8I A;  2BNM A;  3OXL A;  3TGO A;  2O49 A;  1PRU A;  1GW6 A;  3UMV A;  5LCW J;  4HOR A;  2HR2 A;  2LSV A;  3P2B A;  1TEZ A;  2PUD A;  2NC9 A;  3FUD A;  3OQO A;  3RRM B;  4PU4 C;  4WWP A;  1Y7Y A;  4U07 A;  1Z3Y A;  4JZY A;  3SCH A;  2R59 A;  4DLQ A;  4F7A A;  1OCT C;  4WND A;  2Y4T A;  1PRA A;  3VLD A;  3LYA A;  2HYZ A;  2WMN A;  1L1M A;  4KBQ A;  2UWJ G;  1FCH A;  3C98 A;  3FUL A;  4BX8 A;  2DCP A;  3ONK A;  3ZGQ A;  3CHO A;  2C2L A;  1WH6 A;  3OXG A;  2YIN A;  2CG2 A;  2X6H A;  3NQP A;  5LCW C;  1UTX A;  3EJN A;  3EIJ A;  3ZXS A;  2KZT B;  2LYR A;  1UJJ A;  2XGM A;  5KJL A;  1SQM A;  3FDH A;  5LP0 A;  1QQA A;  1EDU A;  2WXF A;  3MEK A;  1ELW A;  4ANW A;  2J49 A;  3RRN B;  5AEN A;  1AU7 A;  1ZU2 A;  1TJC A;  5FZQ A;  2PUG A;  1JWL A;  3ML9 A;  4F3V A;  2XPZ A;  5FQ6 A;  3EHM A;  3FUH A;  2J08 A;  3VK0 A;  4RSY A;  4WNF A;  4WWN A;  4C0E A;  4H7X A;  3LIS A;  1HG5 A;  4J1X A;  3FTU A;  3AS4 A;  3LDZ A;  4UQY A;  4A1S A;  2WQH A;  1Z3X A;  2E0I A;  1SQ8 A;  3ZHI A;  3G2U A;  4DJA A;  4N3B A;  3HVE A;  4GA0 A;  2KEI A;  2JCG A;  3F52 A;  1QP4 A;  3FTS A;  4HOU A;  2CFZ A;  3B7R L;  5JHA A;  3UT8 A;  4I6T A;  3D9M A;  2R1J L;  3D9N A;  1CJG A;  2J07 A;  3G5G A;  4UI9 C;  3NZU A;  4XI9 A;  4YVO A;  4B8A A;  4GPK A;  2VGX A;  3JXC L;  1H19 A;  4TRQ A;  5EDS A;  5CMW A;  1JWG A;  4YBA A;  1E7U A;  4IN3 B;  4KVO A;  1DWK A;  4GML A;  4ATG A;  4PU3 C;  3UFD A;  2XIU A;  4L2L A;  4IA8 A;  3S2A A;  3S7B A;  1PNR A;  3FTZ A;  1BDI A;  2J09 A;  1BPO A;  1HF8 A;  1PER L;  2FBN A;  3I4G A;  4KT6 B;  3GBF A;  4IUL A;  3R9A B;  3SHF A;  3KD7 A;  4YG1 A;  2UY1 B;  4XX5 A;  5K98 B;  4X4F A;  2HO1 A;  3KS2 A;  4I6E A;  1Y8M A;  4O8B A;  3FUK A;  3PNT B;  2I9C A;  4HOQ A;  3ASF A;  3S7J A;  4KVM A;  2YQ8 A;  1E3O C;  2XCC A;  2IVG A;  2LYK A;  3FU0 A;  4RG6 A;  3CGH A;  3JQ0 A;  5A6C A;  1NA0 A;  2AWI A;  3QDN A;  4I6J A;  3NZS A;  4JW1 A;  3UQ3 A;  4BFR A;  2X38 A;  1LQC A;  4AIF A;  1NP7 A;  2GGF A;  4CCA A;  2WB2 A;  2VTB A;  4IYP A;  3JYS A;  4J8F A;  1H6K A;  1KT0 A;  2XJ3 A;  3CLC A;  3O9X A;  3CRO L;  3MZL B;  1UW4 B;  1ZZ7 A;  1RZR A;  3PXP A;  4G25 A;  2J9Q A;  4U63 A;  5T4Y A;  3PE3 A;  3ZW3 A;  2VSO E;  3CLJ A;  4JEU A;  3B7U X;  3CR3 A;  1E8Y A;  4I1O B;  4JHR A;  3FUM A;  4FHK A;  3QAR A;  3IHY A;  3RU0 A;  3I3N A;  4XIF A;  2WXJ A;  2GW1 A;  5CCM A;  1FVH A;  2MOW A;  3EHN A;  4XI0 A;  3KEZ A;  3P1U A;  2LYJ A;  4MRU A;  1JUQ A;  1IC8 A;  1Y9Q A;  3NF1 A;  1SZ9 A;  2LYQ A;  1UN9 A;  2VQ2 A;  2XHE A;  4GA1 A;  3SBT B;  1PC2 A;  2PUE A;  3TJP A;  4EPZ A;  4FUL A;  4AP2 A;  2OV8 A;  2VSY A;  2WXG A;  3BDN A;  2BJC A;  3RZZ A;  2J4B A;  2MHK A;  2KCV A;  2V0P A;  4I2Z A;  3SZ7 A;  2AXU A;  2FUL A;  4JL0 A;  4U0S A;  3D9J A;  4JXT A;  4X4E A;  3FTX A;  4HFG A;  4CT4 A;  4IWR A;  3T8M A;  1HFA A;  3ZRH A;  5G2N A;  2VJ8 A;  2PPX A;  3CHR A;  1E7V A;  3DBS A;  3LXU X;  3QWP A;  3CVW A;  4EQF A;  2WXO A;  3H5T A;  5JJ7 A;  3APF A;  3ASG A;  5AJD A;  1UN8 A;  2L9B A;  3CKB A;  3FU5 A;  3SFZ A;  3FUJ A;  1ZUG A;  1PY1 A;  4F53 A;  4W9R A;  4Y6W A;  3LY7 A;  4Z59 A;  4I43 A;  1ZZB A;  4XZ4 A;  1ELR A;  2V5F A;  3R7Q A;  3PEV B;  1E8X A;  1WH8 A;  4GYY A;  2BF0 X;  4EBA A;  4GU5 A;  2PQR A;  4N2S A;  3UT7 A;  3RO3 A;  3CK7 A;  1XGW A;  3JQ1 A;  3ASD A;  2A4Z A;  1WAO 1;  1SZA A;  3L16 A;  4J8E A;  1WM5 A;  2OVB A;  2M63 A;  3ZIM A;  4LRZ A;  5EX3 A;  3BS3 A;  4EBA G;  3HYM B;  1ZVV A;  4LUN U;  4YG4 A;  2AXZ A;  1OWO A;  4ME2 A;  1ZPQ A;  2IVB A;  1NZN A;  3PEU B;  4JA7 A;  2P58 C;  1QP0 A;  4WWO A;  4B8C B;  3JXD L;  2PL2 A;  3I4R B;  4ACK A;  2QFC A;  1CQT A;  4I9E A;  4PU7 A;  1TJF A;  2PM7 A;  3GW4 A;  2AVP A;  3IEG A;  4K0R A;  1JPL A;  2LYP A;  1N54 A;  2WXH A;  1FVF A;  4Q96 A;  3S8Q A;  4U8H A;  4CDM A;  4PUC A;  4Z5H A;  3L54 A;  4UI9 J;  3FTW A;  2ILR A;  1Y6I A;  1DNP A;  3UX4 A;  1W3B A;  5E76 A;  4B94 A;  3LFP A;  4AJW A;  3CVP A;  4AXH A;  1ADR A;  3IV0 A;  3PH0 C;  4BY6 A;  3HZI B;  2WXQ A;  2AXV A;  3QWV A;  3L1P A;  3MYV A;  3FMY A;  4I6G A;  3DPD A;  4KMO A;  3ULQ A;  4FA6 A;  2CSF A;  3UT4 A;  3LPZ A;  5G04 J;  4UQZ A;  3UPV A;  1PAQ A;  3AU4 A;  4KYO B;  4WAF A;  5M72 A;  2DBA A;  1HX8 A;  4J1W A;  3L17 A;  4E6H A;  4DLO A;  1HU3 A;  3JUI A;  3U66 A;  4HLE A;  4Q94 A;  2R17 C;  4JCY A;  3WXX A;  2FEZ A;  3QYX A;  2LCV A;  3GN5 A;  1U3D A;  2PUB A;  1IQU A;  3D9I A;  3FUF A;  1WET A;  4BTA A;  3AS5 A;  2KPJ A;  2H8R A;  2LAH A;  5BW8 C;  2PZI A;  3SNX A;  4HOS A;  1MHQ A;  1UG3 A;  1OWP A;  3FTY A;  5D0Q D;  4OB4 A;  4YG7 B;  5HQ8 A;  3BG0 B;  2XRY A;  3EIQ C;  5AIJ A;  3CQG B;  3GN5 B;  2CHX A;  2L6J A;  1H2V C;  3FHE A;  4XKB A;  5KJK A;  1S0P A;  1POU A;  4BT8 A;  2OR1 L;  1R63 A;  2NXP A;  3FEY A;  4JHK A;  4F8D A;  4JA9 A;  3RO2 A;  3ZHE A;  4BX9 A;  2PUF A;  4N3A A;  4J6I A;  4NQ0 A;  2JVL A;  2IOS A;  2L0I A;  4KZ0 A;  4XE0 A;  1INZ A;  4L2Y A;  5FQ7 A;  1JFT A;  3RRU A;  2QY7 A;  3VLE A;  3GZS A;  4FLB A;  1JH9 A;  5JHB A;  3CHS A;  1L5J A;  3QAQ A;  3CEQ A;  3IHV A;  3PRZ A;  3CEC A;  4OYS A;  3OQN A;  3CQC B;  5BT1 A;  1XWR A;  3L6A A;  1QNF A;  4DI4 A;  3ZVV A;  2LSU A;  3S7F A;  1OWL A;  3D1N I;  3FU6 A;  2X6J A;  4AY5 A;  4BWR A;  2UY1 A;  1B0N A;  2GZU A;  5LFA A;  5ANR A;  3ZHM A;  2XCJ A;  3ZEF A;  1HE8 A;  3HHM A;  3U4T A;  1U3C A;  4X4D A;  3HIZ A;  3QKY A;  2R63 A;  2IQC A;  3SBS A;  1E96 B;  3ZN3 A;  2L49 A;  4JC8 A;  4ABN A;  4Z58 A;  2I2O A;  5CHE E;  5CCL A;  4GA2 A;  4I17 A;  2VGY A;  4CGW A;  2ION A;  1HG2 A;  4JPS A;  1EF1 C;  3GZ2 A;  2JEK A;  2ICT A;  3GYZ A;  3LKU A;  3RKV A;  5KJM A;  2HSG A;  3FEX A;  2WPV A;  5BPP A;  3N71 A;  4FLH A;  4CDR A;  3FH5 A;  3EDT B;  2GRM A;  3CVV A;  4PS3 A;  2D5V A;  4GAA A;  2EWT A;  2IJG X;  2PUA A;  4M3O A;  4GYO A;  1NEQ A;  3RK6 A;  2XEV A;  3CVY A;  3CVX A;  4AV7 A;  3U9W A;  3BG1 B;  4AVX A;  3MV3 B;  2ICP A;  2A6C A;  1EYH A;  4G1T A;  4GB9 A;  5LX8 A;  4L23 A;  3SCF A;  3L22 A;  2RG8 A;  2E2E A;  2HIN A;  4XKC A;  5AJL A;  3TL5 A;  1ELK A;  3E4B A;  3FTV A;  3OXF A;  4BT9 A;  1X5B A;  5KCM A;  5BUZ A;  3Q47 B;  5JJ6 A;  3MKR A;  1HS6 A;  4R7L A;  3ONL A;  3PE4 A;  2WUS R;  2XRZ A;  4APF A;  2IU1 A;  4A3T A;  3G2V A;  3FY4 A;  2LYL A;  3ESK A;  4AM9 A;  2WXN A;  3L13 A;  4IVZ A;  4GZ3 A;  1H2T C;  4OVU A;  3OMT A;  4Y42 A;  3CV0 A;  4FC8 A;  2KZT A;  2XI8 A;  4PS7 A;  3D9L A;  4P29 A;  4MCT A;  2I1K A;  2VYI A;  3URZ A;  3FUE A;  3FH8 A;  3LS8 A;  4Q69 A;  3MX3 A;  4H7Y A;  3CHP A;  3U3W A;  2WXR A;  4UWL A;  2YHC A;  5T3R A;  3VTY A;  4AEZ C;  4B0Z A;  3ESL A;  4RG9 A;  2KEK A;  1R69 A;  4Z5D A;  1HH8 A;  4UWH A;  4UWG A;  3CVU A;  1H0A A;  3ENE A;  4L7T A;  4HVB A;  2FJR A;  4URK A;  1YSE A;  1JFS A;  5JJT A;  2PM6 A;  4UWF A;  3MA5 A;  4GQM A;  1LCC A;  3APD A;  4YVQ C;  1OWN A;  2CHW A;  3QJZ A;  2WQ7 A;  4CEM A;  3FWV A;  4U0U A;  3R7R A;  2VGX B;  2IFU A;  2WXK A;  3I5P A;  4U04 A;  3ML8 A;  4GZ5 A;  1QZ2 A;  1O4X A;  4JQD A;  2BUG A;  5FQ4 A;  1E90 A;  1NA3 A;  1P5Q A;  4LEU A;  3G2T A;  4HOT A;  1E8W A;  5E75 A;  1ZZC A;  3CIA A;  3D9O A;  4X4B A;  4A1G A;  1HZ4 A;  1H2U A;  3SF4 A;  4BSX A;  3F51 A;  3G7D A;  4ANX A;  3Q5M A;  4RVB A;  3ZFW A;  3LY9 A;  5BV1 A;  4KZC A;  5ENN A;  4JHJ A;  2Y3A A;  5J90 A;  2A5U A;  4UQX A;  2WMO A;  3LVR E;  3PVL A;  3T5V A;  3T5X A;  2C0L A;  2CHZ A;  3B13 A;  3PNL B;  2XGO A;  4I6R A;  4EZJ A;  3TG5 A;  4G11 A;  3LCA A;  4NUR A;  3KJX A;  5J08 A;  3CK8 A;  1PRV A;  1WY6 A;  2BNN A;  2L0T B;  2WXL A;  2X6K A;  3VTX A;  1ZZ8 A;  4A3V A;  3PUJ A;  3GZ1 A;  4C0M A;  1ZBP A;  4GZC A;  3IBE A;  5G55 A;  3PUK A;  4UI9 K;  2CG3 A;  2V4L A;  3K9I A;  4WNG A;  4Z5C A;  4NDW A;  1QP7 A;  1OWM A;  5EKQ D;  4YND A;  2WQ6 A;  1IYG A;  4KXK B;  2CRO A;  1ZZ6 A;  2XPY A;  3QC1 A;  2OVF A;  4AOF A;  5FTP A;  3Q49 B;  2IUO A;  4GZD A;  4JEH A;  4LCT A;  1WIZ A;  2I1J A;  2LYS A;  1MQS A;  2I6H A;  3B7T A;  4K03 A;  2LAI A;  3L08 A;  1LCD A;  5FZS A;  4A55 A;  3UUX A;  3QB2 A;  3QWW A;  1YA0 A;  4L1B A;  4D10 C;  4G23 A;  2AUW A;  3F6W A;  2LO6 A;  1VDY A;  3CVQ A;  4LER A;  3TXN A;  3CHM A;  2YNQ A;  4N2Q A;  2X6I A;  4PS8 A;  4X4I A;  2Y4U A;  4G26 A;  4DPR A;  1B89 A;  4E85 A;  4WUY A;  2XGS A;  4FAD A;  1IHG A;  2EQX A;  2XQ0 A;  4FBI A;  3FYA A;  2IF4 A;  2X3M A;  3ZHE B;  2FF4 A;  3BEE A;  3LJ3 A;  4ILH B;  5FQ8 A;  3APC A;  4PH4 B;  2IOL A;  2ZU6 B;  3CVL A;  5C1D A;  2NSZ A;  3FYM A;  2Q7F A;  2O38 A;  3ZKC A;  2MRI A;  1OSL A;  1N52 A;  3FP3 A;  4MLP A;  4OVV A;  3RIB A;  3B7H A;  1HXI A;  1ZAY A;  4NAC A;  2IV1 A;  3DNV B;  3HVE B;  4ILG A;  3RJV A;  4EEC A;  2KEJ A;  2R5S A;  2KCL A;  4CGV A;  4JVS A;  4AY6 A;  1RPE L;  3OTN A;  3IKO B;  2KAT A;  4MKT A;  5ARG A;  4U0Z A;  5G04 C;  4C9B B;  4YAR A;  2BNO A;  4X4H A;  3AS8 A;  3PDN A;  2BTD A;  5G05 C;  1RIO A;  1UXC A;  1HF0 A;  4G2V A;  4EZK A;  3LY8 A;  4I1A A;  3S7D A;  3MJW A;  4V3I A;  1Z6T A;  4NRH B;  2KZ8 A;  3MV2 B;  4GHJ A;  2L8N A;  3O4Z A;  5G05 J;  3OAW A;  1QPZ A;  3TG4 A;  3D9P A;  4FP7 A;  3PS6 A;  4I8T A;  2HM8 A;  2JLB A;  4ACL A;  2IVQ A;  2LNI A;  4Y6C A;  3QOU A;  4PDX A;  3MCX A;  5EX0 A;  4EZL A;  4FHJ A;  3OP9 A;  4IRU A;  3CSF A;  2PUC A;  5A23 A;  3CK9 A;  1KLX A;  4I1M A;  4G24 A;  3ZYQ A;  4CT0 A;  3SI5 A;  4N39 A;  3VLF A;  5D0O D;  3G2W A;  2J4D A;  2O4A A;  2B5A A;  4PU8 A;  1HO8 A;  4J8S A;  1KT1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...