2AW6A

Structure of a bacterial peptide pheromone/receptor complex and its mechanism of gene regulation
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
287
structure length
287
Chain Sequence
MFKIGSVLKQIRQELNYHQIDLYSGIMSKSVYIKVEADSRPISVEELSKFSERLGVNFFEILNRAGMNTKSVNETGKEKLLISKIFTNPDLFDKNFQRIEPKRLTSLQYFSIYLGYISIAHHYNIEVPTFNKTITSDLKHLYDKRTTFFGIDYEIVSNLLNVLPYEEVSSIIKPMYPIVDSFGKDYDLTIQTVLKNALTISIMNRNLKEAQYYINQFEHLKTIKNISINGYYDLEINYLKQIYQFLTDKNIDSYLNAVNIINIFKIIGKEDIHRSLVEELTKISAKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PrgX
publication title Structure of peptide sex pheromone receptor PrgX and PrgX/pheromone complexes and regulation of conjugation in Enterococcus faecalis.
pubmed doi rcsb
source organism Enterococcus faecalis
molecule tags Transcription
total genus 103
structure length 287
sequence length 287
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01381 HTH_3 Helix-turn-helix
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 2aw6A01
1.25.40.400 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2aw6A02
3KXAA 1UXCA 2AW6A 1ZVVA 1X57A 2EBYA 4MCXA 1ZPQA 2PIJA 2FJRA 2BNMA 1AU7A 3HZIB 1DWKA 2L49A 3FYAA 2JVLA 1CQTA 4F8DA 2KZ8A 1OSLA 2LYRA 2LYLA 4YARA 2IV1A 1POUA 2PUEA 1OCTC 1ZZ6A 3H5TA 2R1JL 4X4CA 2B5AA 3B7HA 1LQCA 1QQAA 2OR1L 3SCHA 4X4GA 3JXDL 4JCYA 1PRAA 1EFAA 3SCGA 2LYQA 4GHJA 3VK0A 4Z59A 4Y42A 2WIUB 2XI8A 1PRVA 4IA8A 1O4XA 4JCXA 2IVQA 1R69A 1ZZ7A 3S8QA 2L8NA 1QPZA 3LISA 2LYSA 2R63A 1BDIA 2LYKA 2XIUA 3R1FA 4Z58A 4FBIA 3JXCL 1HF0A 3CECA 4JQDA 1WIZA 2GZUA 3OMTA 2D5VA 2KEKA 2PE5A 3KJXA 4OB4A 4FN3A 3SCFA 3U3WA 2IVBA 1JFSA 3ZHIA 1QP7A 1ZAYA 3UFDA 4YG4A 1XWRA 3ZHMA 4YG7B 1LLIA 2KPJA 3OQOA 2CROA 4MCTA 1WETA 1ZUGA 2GRLA 1E3OC 5A7LA 1JWLA 2KEIA 3GN5B 3FYMA 4PU8A 1RZRD 3G7DA 4PU7A 3FMYA 4X4IA 2LYJA 3QF3A 1GT0C 3O9XA 1JFTA 2BJCA 1QP0A 2HINA 4I8TA 2AXUA 1LCDA 1PRUA 3EUSA 3OQMA 4O8BA 1PNRA 2CSFA 2WUSR 1WH8A 1S7EA 3F51A 1IC8A 1UXDA 2AUWA 3QQ6A 2IU7A 1PERL 3F6WA 2ICPA 2AXVA 2GRMA 3IVPA 2MQKA 4J1WA 3F52A 3GN5A 1JH9A 2H8RA 4IWRA 1ZS4A 1RIOA 2O38A 3CROL 4YBAA 3ZKCA 2PUCA 4NDWA 2IUOA 3L1PA 3BDNA 2ICTA 1B0NA 1YSEA 2OFYA 2XCJA 1R63A 3CLCA 4J1XA 5K98B 3BD1A 3OQNA 1ZZCA 4Z5CA 1SQ8A 1RZSA 2O4AA 2HSGA 2PUDA 1RZRA 1QP4A 2AWIA 2EWTA 2A6CA 3PXPA 1LCCA 2O49A 2KEJA 1X2LA 1Y7YA 1L1MA 4GQMA 4Z5HA 4PU4C 3DNVB 3QYXA 2BNNA 2PUBA 2BNOA 3RZZA 1WH6A 4X4DA 3JXBC 3BS3A 3KZ3A 2XSDC 4X4FA 4IVZA 1ZZ9A 4I6TA 3TRBA 1ZZBA 1ADRA 4I6RA 4X4BA 2MEZA 4YG1A 3QWGA 2IVGA 2PUGA 2XJ3A 3D1NI 4X4HA 2LCVA 2EF8A 3MLFA 4I6UA 2JCGA 1Y9QA 3GBFA 1LMB3 1QQBA 3OP9A 2PPXA 1ZZ8A 2PUAA 4X4EA 1UTXA 1NERA 4PU3C 1CJGA 2AXZA 1BDHA 1RPEL 2PUFA 3G5GA 3LFPA 1DW9A 1VPWA 4Z5DA 2LYPA 1NEQA
chains in the Genus database with same CATH superfamily
3ULQA 4EKIA 4GZDA 5BNWA 3BU8A 3ZVVA 4U07A 2RFAA 3E4BA 2PUEA 1QBQA 3OAWA 1D8EA 3CVXA 1OWOA 3JXDL 3IXEA 3CVPA 5JHBA 2B6CA 5ENPD 3B13A 5KJLA 2V3CC 1MX2A 5D66A 2WXIA 1XGWA 3GUUA 4FADA 2PXTA 4DX2A 4LCTA 3U3WA 2EQXA 4L1BA 3GW4A 2M63A 3FH8A 4PU8A 4RG9A 4DI3A 4J8YA 4LNUD 4U96D 1E8WA 4XIFA 2PQNA 3LEWA 2F8XK 2LLVA 2MQKA 1DVPA 3OXFA 4Z68A 4DX7D 2XRYA 4HRMB 1QYMA 3JXJA 5IY5E 3TAXA 2A5UA 1DULA 4OVUA 4APOA 3S2AA 4PS7A 4J8SA 3HYMB 4GCOA 1IYGA 3CEQA 3EUVA 2P9KG 3SO8A 2P9NG 3ESLA 4I1OB 2IF4A 4N3AA 2XPIA 1OXJA 3MV2B 1UTXA 4PU3C 3AG4E 3VLDA 2VJ8A 1VPWA 4GZ6A 2R59A 5LX8A 3KL4A 2VTBA 2VSOE 3DEPA 1H0AA 2GRNB 2FBNA 3S7BA 3W9GA 4TUUA 1OWPA 3D9NA 2XS8A 2XHEA 1AU7A 3URZA 1OUVA 3R9MA 4GCNA 3I4GA 4ACKA 4JW1A 3O4ZA 2ETCA 4ATGA 3TWSA 3PE3A 2OEVA 4P29A 4EZJA 3ASNE 4E85A 1PAQA 1S63A 4MS6A 3UINC 3QWWA 4HLEA 1WIZA 3MX3A 4ACLA 5AAOA 2PE5A 2KCKA 1HF8A 1E8ZA 3BG0B 2R05A 4RVBA 3CKBA 3EUSA 4ZHBA 4U8VD 1QQEA 1G3NB 3G2VA 4IULA 3QQ6A 2PNNA 1UJJA 5ARFA 4JZYA 3F6WA 3UWPA 1YCSB 2DIWA 3FULA 1N4PA 4U0ZA 3TXNA 3PE4A 4LNBA 1B0NA 2LXMA 1HZ4A 3JUIA 1N95A 2WXOA 4Z5CA 3ZHEA 2CG3A 4K5CA 3HG0D 2XXPA 2J4BA 2HCSA 2O49A 4G23A 4B94A 4F3VA 5A7DB 4JL0A 1UG3A 4F1PA 3RZZA 3EHMA 4N3CA 5DBKA 3CVVA 4HBDA 2VTBB 4X4BA 1UW4B 2KATA 3UM3A 5E75A 3ZU7B 3UI2A 2X6JA 3GBFA 2XZTG 3R7RA 5H7PA 4OAVB 3MEJA 3FUIA 3Q73A 2WXRA 1DWKA 4I17A 2KCVA 5KJMA 3CQGB 5BW8C 2LYRA 4YARA 3CSFA 1ZZ6A 5C1DA 4TUMA 4JCYA 4U7EB 3IHVA 1Y8MA 3NB2A 3QWPA 5FZRA 3UXGA 1N0QA 4Z59A 5EN5D 2IONA 4EBAG 2R63A 2WQHA 4FBIA 3MA5A 3SQVA 3OMTA 1NZNA 3KJXA 4ER0A 3M9LA 3QNKA 5FQ4A 5FQ8A 3OQOA 3FTSA 4HOQA 2XXQA 1FPPA 1O1RA 3DEOA 2HO1A 1NA3A 3QK0A 4B89A 3DBSA 5DTRA 3U4TA 2F0YA 2HFZA 5J08A 3Q15A 4XI0A 1IKND 1D9SA 1K1BA 2ICPA 3ZHEB 2O38A 2L6JA 2XGOA 4J8EA 1R63A 2WXHA 3KEAA 3C3OA 2ZIRA 3LY9A 3GZDA 3RIBA 1LCCA 2L1PA 3T8KA 2LAIA 3ASOE 1S0PA 4APFA 4PU4C 1ELRA 2BNNA 3TJPA 3ENEA 3QAQA 2H6GA 3L08A 3Q4AB 4ILHB 1KT1A 3Q78A 4GYWA 3LS8A 5AENA 3ASDA 3NQPA 3LJNA 5CECB 4AEZC 1Y6IA 3VTYA 2EF8A 2WXNA 2V5FA 1LMB3 4M3OA 2PPXA 1RPEL 2F37A 5B1BE 1UXCA 2AW6A 5FT9A 2WMOA 1SZAA 3IEGA 4HOTA 3LVRE 2IV1A 2GROB 4K5AB 2Y4TA 1LQCA 3B7SA 3GZSA 4HI8A 1EFAA 4UUCA 4K03A 2XI8A 3S8QA 3DSXA 2XIUA 3JXIA 3DSVA 1ZB1A 1N4QA 3FTVA 2XXAA 1NW3A 4DUIA 4GTRA 2GZUA 3O48A 3BEEA 4IN3B 3ULEG 3LJ3A 3ZHIA 4AVXA 4MLPA 1LLIA 3APFA 1E3OC 4CCAA 3R9AB 3GZDC 2PM7A 1RZRD 5CBNA 3VTXA 4JXTA 2Y0BG 3C98A 3DWLG 1WH8A 4CDMA 4I6JA 4C48B 3VWSA 3EDTB 3F52A 4FC8A 1ZS4A 3CROL 2C2LA 2WXPA 3L1PA 5DIZA 1YSEA 3D9PA 4OBMA 3FUNA 5G05C 4EHMA 1HO8A 2PXUA 3QARA 3Q47B 4W9RA 3JUEA 1ZBPA 2KEJA 2BKGA 2FO1E 2PUBA 1YMPA 4I9EA 4O6FA 4QQIA 4C9BB 4NQ0A 3UM2A 4GTPA 1WH6A 3TRBA 4UWFA 1HS6A 1K8KG 2BF0X 1QZ2A 2IVGA 5JMND 5G04J 1HXIA 3X2QE 2XCCA 3FUFA 2E2EA 2HR2A 3G5GA 3FUMA 1MFQC 4HOUA 3JQ1A 4WNEA 3A9ZA 1BPOA 2HE0A 2LXLA 3HDXA 3L16A 1CQTA 3CVQA 3TEPA 4GMLA 3NZUA 2B5AA 3DPYA 2OR1L 5AN8A 5G04C 3SCGA 1MX6A 4BY6A 1HE8A 3HXBA 2QC9A 4GYYA 3MV3B 1R69A 1ZZ7A 2FEZA 4LUNU 4BETA 2XEEA 3T8MA 1MQSA 1HF0A 4JA7A 4I6EA 1UJKA 2QY7A 5DT2A 4FJYA 2V4HC 4CT4A 2L0TB 4U0UA 4UQXA 3FTUA 2R5SA 4RLYA 3ZXPA 2J4DA 3LYAA 1SVXA 1WETA 3FU0A 3PNTB 5AJDA 4Q69A 4N2QA 1GT0C 2AXUA 1OT8A 4ANWA 4PUCA 3TWUA 4KVMA 1N9AA 3EU9A 3Q9NC 4CYMD 2OEWA 4F53A 4AIFA 1ZZCA 3WG7E 1MX4A 2HSGA 5FTPA 1RZRA 1X2LA 4I43A 2KCLA 3PZ1A 4GQMA 2CHZA 4N5CA 2UWJG 4YVQC 3TFLA 3CVWA 1WAO1 4CDRA 3HVEA 4F1SA 5AQ7A 4K0RA 2GRQB 4GTSA 4GZ5A 3TGOA 2GRPB 3HHMA 4X4HA 3C5RA 4B8AA 1OY3D 1QQBA 4E6HA 4JD2G 3LY7A 5LCWJ 4G25A 3SBTB 3LFPA 1MYOA 4Z5DA 1NEQA 3B7TA 1Z6TA 3AG1E 2YNQA 4LEUA 4OYSA 3S7JA 3QOXA 5KCMA 1POUA 3QB2A 3W9FA 2PXEA 3RO2A 1UN9A 1U3DA 3L82A 3SCHA 4X4GA 1PY1A 2J09A 4Y42A 3GZCA 1O4XA 3B7UX 4UWLA 3LISA 3AU4A 1INZA 1FT2A 3ABME 2WQ6A 3CHOA 4EBAA 2WXQA 2YHEA 3J5PA 3L13A 4FHKA 4KYOB 3RK6A 1W3BA 1BDIA 4BX8A 3EHNA 3NOCD 2HYZA 3O9XA 2LNMA 4DRXE 1PNRA 5CERB 2J49A 2KZTA 3V30A 3FH5A 1RW2A 2Y69E 4Q94A 3PH0C 2LSVA 3GN5A 3CHPA 2KBXA 3RKVA 4NDWA 1E96B 4HI9A 2I6HA 1KT0A 4G26A 3ZKJA 3OQNA 2J07A 4WWPA 1SQ8A 2OVFA 2AWIA 2EWTA 3HVEB 3V31A 1JCSA 3IV0A 4Y6CA 3SZ7A 2CHXA 3QYXA 4BT9A 3DSTA 4G1TA 5CEAA 1TNZA 3I4RB 1OCRE 2WVIA 4AJWA 5JA4D 2XJ3A 2Y3AA 5BXOA 2V5QC 3OP9A 4BERA 5DTMA 2ZU6B 2AVPA 2PUFA 3Q75A 2H6IA 1AP7A 1DW9A 3T5XA 2IO3C 2LYPA 4HXIA 1EF1C 3T9KA 1E8XA 4YNDA 1YA0A 2WXMA 1OSLA 4GYOA 3IBEA 3SF4A 2QYUA 4A55A 1FCHA 3TWVA 2JLBA 3G2WA 1OCOE 2I9CA 1PRVA 3CLJA 4KMOA 2L9BA 4EKGA 3A9YA 5KNGA 3P1UA 1HU3A 3DSWA 4JQDA 2I1KA 4GAAA 3JYSA 2DVWA 2NSZA 2KZTB 1XWRA 3QDNA 4JHRA 3IKOB 3QJZA 1LTXA 3GN5B 3G7DA 3QF3A 3ONKA 4I8TA 1DNPA 1O5MA 1KZOA 1H6KA 2QFCA 3Q79A 1S7EA 2VSYA 2DYRE 1N52A 2UY1A 3PDNA 1TEZA 5JJ6A 4GPKA 3FEYA 3FTWA 3FU3A 3MEKA 2EIJE 3FHEA 3BUAA 3OTNA 5HRYA 3UIOC 1TJCA 3D9OA 4Z5HA 4GTTA 4HORA 3PUKA 2XZDG 3JXBC 2A5EA 2RKKA 4HQDA 5D0OD 1ZZ9A 1TN6A 4PDXA 5AYWD 2XS1A 3QWGA 4AP2A 4K5BA 3SNXA 3SGHA 1OWMA 2WMNA 3ML8A 3TWXA 4YDEA 1DC2A 3B95A 3OKZA 1S64A 3ZEFA 2EINE 2EBYA 3SFYA 2J7UA 2IU1A 4I9CA 3EIJA 2H6FA 3ZRHA 5ENSD 4UWGA 5A6CA 4LSZE 2R1JL 5E76A 2DZNA 3SI5A 3N71A 3E30A 4KVOA 3L54A 3JCKC 2YBDA 2IVQA 5CEDB 3ZPXA 3G2UA 5AJLA 5D2MC 1N0RA 4BT8A 2HM8A 4BX9A 4UQYA 2PZIA 1JFSA 1TNOA 1HG5A 2A4ZA 4FP7A 1B89A 2UY1B 4GTOA 4GTMA 2LUHA 1SZ9A 1RZ4A 2EIKE 4MKTA 4AY6A 4J8DA 1HQ1A 2IU7A 5AQ9A 2NYJA 3HXDA 1U2VG 2BKKB 1BI8B 4YBAA 4G8KA 1MJ0A 2PUCA 3JQ0A 1H19A 2IUOA 3BDNA 1IXVA 3UT7A 3D9IA 2ODRD 4DI4A 3CLCA 1UOHA 3WXXA 4A3VA 1QNFA 3CK8A 5AQAA 2WQ7A 2VGYA 2DYSE 3CV0A 2LNIA 4ER6A 1UN8A 3CKCA 4FLHA 3SR4A 3DXKG 4LRZA 2FI7A 3DM5A 3Q49B 5ANLA 3ZYLA 3NOGD 3S7DA 5CMYA 2CG2A 4UQZA 2YQ8A 4JA9A 3MZLB 3FTXA 3D9LA 5KNHD 2XGMA 4X4EA 1N54A 2PQRA 2AXZA 4GZ3A 4GA0A 2VGEA 3LKUA 4NACA 2WXJA 2P58C 4XZ4A 1ZPQA 5A23A 3OXLA 3L17A 2LAHA 2MRIA 3H5TA 4I1AA 4F7AA 5FWQA 3S7FA 3Q5MA 4GZCA 3HXFA 4GHJA 5T8IA 2WIUB 1X5BA 5EKQD 2Q7FA 3ASFA 3A9XA 3MKQA 4B93B 1NFIE 3Q7AA 3UMVA 4G11A 3TXMA 1V54E 3C3QA 5KWDA 4HS2A 1BI7B 1ZUGA 5A7LA 1QB2A 4DE8A 2ZGDA 2X6IA 1X81A 3U66A 2WXKA 5M72A 4CZ2D 2VEOA 1JCRA 3DXMG 4DX6D 3IVPA 4J1WA 2IO2C 3ABLE 1JWFA 1NI1A 1HG2A 3CK7A 5AIJA 4HRNA 2CHWA 2O4AA 4IRUA 1RZSA 4DE9A 5JUWA 4A1GA 1IQUA 3FUHA 3F6QA 3CVYA 3SX0A 3FU5A 3ULYA 1E7UA 2P9UG 3OWQA 2XSDC 3AJIA 4OVVA 4DX5D 1ELKA 3MKRA 2WXLA 4IVZA 4ANVA 3CK9A 1Z3YA 5FJYA 1WY6A 1TR4A 2VGXA 4I2ZA 1Z5SC 3UKUG 1AWCB 2IY0C 3QOUA 1BDHA 4L2YA 4EZLA 4XKBA 3T5VA 3ZW3A 3NZLA 2X3MA 1U2ZA 4MCXA 3GZ2A 4U63A 5BV0A 3NZSA 4TXPA 2NC9A 4CGVA 2J8SD 2JVLA 3RU0A 3EU5A 3LY8A 3FEXA 4G8LA 4X4CA 1N4SA 3MKQB 3RAUA 1QQAA 1U3CA 3ZIMA 2VQ2A 3RRNB 5BPPA 2J7WA 4IYPA 2XQ0A 4JCXA 2C0LA 2P9IG 3BG1B 3UT8A 2J08A 5FIOA 3E32A 4EQZA 5BUZA 4CT0A 3QWVA 4YG4A 5EIDA 2FULA 3KEZA 1WG0A 3I3NA 2EILE 1VDYA 1IQRA 3OXGA 2LYJA 2HINA 1PRUA 3FWVA 4F6RD 2IEJA 3FDHA 3C3RA 3UTMA 1K1AA 5DRTA 1H2TC 4AY5A 2HCNA 1JH9A 1O1TA 4ZFHA 4I1MA 3KAEA 3HXEA 2OVBA 4FHJA 5B3SE 2VGXB 2Y4UA 3D3MA 5B1AE 2GGFA 3TWRA 4CDNA 2PXVA 5ENTD 3QC1A 2PM6A 2XCBA 3ZYMA 3TELA 2ILRA 1MZCA 4CGWA 2P9LG 2PUGA 2XENA 2JQEA 5FZQA 2XEVA 2L0IA 2LLWA 4JHJA 5LP0A 5DRYA 1ZZ8A 2ETAA 4UI9K 2MYOA 2DWZA 3ABKE 1OCCE 3R09A 3UM0A 3ZFWA 3DNVB 4KBQA 5CRUA 3NAWA 3ASGA 4OAUC 2L49A 2RFMA 3E37A 3CVUA 1EPUA 4KT6B 1FVFA 3ZUVB 2OV8A 4G2VA 2P2CP 5EILA 2FF4A 4DLQA 3J5QB 1HX8A 1SA4A 4DK5A 3CHSA 5CBOA 2PXKA 2LYSA 3HRAA 4GMRA 4C0EA 3NXHA 2OCCE 5ITZF 3EIQC 3VLEA 4FN3A 3TWQA 3UFDA 5KJNA 3DSSA 3L22A 3FUJA 3K9IA 3PZ4A 3FMYA 3PNLB 1QP0A 5LCWC 2CSFA 1N4RA 4ME2A 3ZXSA 2PXPA 3B7BA 2IOLA 3AAAC 2R2LA 5JJ7A 5JJTA 2V4LA 3ZKCA 3APCA 4RG6A 1BU9A 1ELWA 1IHGA 4L7TA 4J1XA 3AS8A 3C72A 2YHCA 4V3IA 3CIAA 4AV7A 3CHRA 3APDA 1Y7YA 5D0QD 4TXRA 3ONLA 2IQCA 4BTAA 2BNOA 4I2WA 1BLXB 1TN8A 3MJWA 3BQOA 4I6TA 4DLOA 1SW6A 5CCLA 1Z3XA 4YG1A 2MXDA 3FUEA 1HFAA 3EJNA 5EYLA 3HIZA 1Q2ZA 4ANUA 2OOEA 4JEHA 1CJGA 2IFUA 2MOWA 1BD8A 2V0PA 4QFVA 3ZYKA 2FJRA 5C2YA 4MBGA 5KJKA 3FYAA 4J7WA 4J6IA 4FJZA 2PXLA 4LNGA 3FU6A 3Q7FA 4N39A 5HS0A 1ZU2A 3NBNB 3B7HA 1P5QA 2VSNA 1PRAA 1KLXA 4HOSA 3D9MA 3PZ2A 3UT4A 1E7VA 4BSZB 5HQ8A 3ZPJA 4HRLA 4U04A 5GAHi 5EDSA 4YVOA 4WWOA 5ENNA 2KPJA 4GTVA 2PL2A 4XE0A 1E8YA 3FYMA 1V55E 4PU7A 5FINA 4GU5A 3CSTA 3TG4A 3SY2A 3EHRA 2WUSR 4WNFA 3UKRG 4YDWA 3TWTA 3EHQA 1OWLA 4ANXA 3MCXA 2XGSA 4Y6WA 3PUJA 2ICTA 5FZSA 5DSXA 3ASHA 4WUYA 4DPRA 4BESA 2PXDA 1QP4A 4HNAD 3PS6A 2XPZA 2FO7A 1EDUA 2X6FA 5T3RA 5G55A 4NRHB 2PXBA 3PE5A 4X4FA 2RD0A 3E34A 3UPVA 2VSXE 4FULA 5T4YA 2MHKA 3MLFA 2JCGA 3D9JA 4PS8A 3UM1A 2LSUA 4NURA 3V79K 3RRUA 4FU3A 4RQIA 3KSQA 3MGBA 3HZIB 2CFUA 2KZ8A 2QZAA 4ABNA 3RJVA 5EYPF 2ZGGA 1A5EA 3FTYA 3CHQA 4L23A 3PZDA 2WXGA 4ER5A 2LYQA 4EK9A 3AS5A 3FFLA 2DCPA 3R7QA 4HLLA 1A17A 5CHEE 3V2OA 4X8QA 1S70B 4Z58A 3JXCL 2CFZA 4HVBA 4KZ0A 4G24A 4A3TA 2KEKA 3CGHA 4AXHA 2ONDA 1NA0A 1K3ZD 4MCTA 4BFRA 1NP7A 5BV1A 3TWWA 2ETBA 4X4IA 1HH8A 2V8SE 1OCZE 3L6AA 4N2SA 3F51A 3ZNGA 2AUWA 1KPSB 2GRMA 2P9PG 1XNFA 4B8CB 1L5JA 4ER3A 3FP3A 3QFIA 4BSXA 3ML9A 1NL4A 5ANRA 3D9HA 2OFYA 5K98B 3BD1A 3ZN3A 4ILGA 1D8DA 2ZISA 3AU5A 3UUXA 2A6CA 3PXPA 2YINA 1LF8A 3FH7A 2WXFA 4XI9A 1SA5A 1JPLA 3ESKA 4U0SA 1DCQA 4BEPA 5GAGi 2MEZA 3Q9UC 5EIBE 4AOFA 3LXUX 4EZIA 4TRQA 1NERA 2R03A 1TN7A 4YG7B 4HRAA 2XRZA 3G2TA 2BNMA 2F8YA 3PVLA 3NDBB 4JPSA 3PEVB 1OCTC 5EX0A 4DJAA 3LQXA 1FT1A 2EIME 2GW1A 4PH4B 3VK0A 3SHFA 3SD5A 1JCQA 2DBAA 4B0ZA 1TNYA 5DTQA 3U9WA 2WB2A 4JHKA 2I2OA 3CECA 3FUKA 4DX1A 4U95D 4OB4A 5CMWA 4TV3A 1N11A 1H2UA 1H6PA 2X38A 2CROA 4BTBA 2GRLA 3E33A 3ISMC 5FQ6A 1O1SA 5EX3A 4ATZD 3OQMA 4O1OA 2XEHA 4GA1A 4LERA 1TYQG 1LD8A 2X6HA 3CVLA 3GYZA 2X6KA 4JVSA 2P9SG 4TXQA 3UX4A 2JEKA 4JC8A 5AQBA 1PC2A 3LDZA 4YDOA 2E0IA 4PS3A 2J9QA 1GW6A 3RO3A 3PEUB 4EECA 4MRUA 4GMJA 4J8FA 1L1MA 4YDYA 3D9KA 4BWRA 4GA2A 3G2SA 3DRAA 2NXPA 3ZGQA 1TNUA 3KZ3A 2WPVA 4L2LA 4WNGA 1ADRA 4HB5A 3LPZA 3QOWA 1MHQA 3CVNA 3RSEG 5J90A 2B0OE 3KD7A 3KXAA 1X57A 4JB8P 3SFXA 2PIJA 5FQ7A 4GPMA 3AS4A 4F8DA 3TG5A 2LYLA 4Q2JA 2Y1LE 3KSLA 3FTZA 5G05J 4NIKA 1WM5A 3CR3A 1JUQA 1YYHA 3PRZA 4IA8A 4D10C 4O60A 5LOZA 4FA6A 2LYKA 4AM9A 2BEDA 2DZOA 3P2BA 2D5VA 3CHMA 4M7CA 3SCFA 1WDYA 2IVBA 1TJFA 1ZAYA 3LCAA 2I1JA 3ZHMA 1FVHA 1TNBA 3HXCA 1JWLA 5ENRD 4N3BA 1N94A 3SBSA 2KC7A 5ENOD 4O8BA 1IC8A 2BUGA 1UXDA 5BT1A 3QKYA 4J0UA 4WWNA 4FLBA 3ME5A 4XX5A 3AG3E 4UWHA 4EQFA 3MYVA 5KBAA 1SQMA 2PUDA 1KZPA 3U64A 3B7RL 3UQ3A 4U8YD 1H6OA 4HFGA 2RG8A 4H7XA 2KXPC 4C0MA 2BTDA 3PREA 4ER7A 3DSUA 4CEMA 3BS3A 4ILIA 4I6RA 2PXFA 4U8HA 4UI9J 4I6UA 3LVQE 2PUAA 3L9TA 2QYJA 4KXKB 5ENQD 1ZVVA 1H2VC 2JABA 3UIPC 4O1PA 4LG6A 1DCEA 2LO6A 5CRVA 4UI9C 3CQCB 3TL5A 4EZKA 2GRRB 2L8NA 1QPZA 5BXUA 3R1FA 3I5PA 2M4HA 4KZCA 1IHBA 4WNDA 2PXQA 1E90A 4R7LA 1QP7A 2R02A 4Q96A 3DPDA 2KEIA 3PZ3A 4GTQA 1JFTA 2BJCA 1LCDA 3NF1A 3ZYQA 3SFZA 3G0TA 2VYIA 5HKPA 4N5QA 1PERL 2C0MA 2AXVA 1QZXA 5AARA 2H8RA 2IOSA 4IWRA 3FUDA 2L6BA 1RIOA 2XPYA 4XKCA 2XCJA 4CRWA 5JHAA 2H6HA 4JEUA 2AJAA 2FFHA 4UWKA 5HI7A 1LD7A 5G2NA 4L9PA 2IJGX 3GZ1A 4EPZA 5LFAA 4XEIG 3AG2E 2KM4A 4H7YA 4WAFA 1EYHA 2R17C 1JWGA 4GB9A 4WVLA 3V2XA 5CCMA 4RSYA 4X4DA 3IHYA 4A63B 3RRMB 4URKA 1ZZBA 3KS2A 5ARGA 3VLFA 3D1NI 2LCVA 1Y9QA 3NROA 2WM9A 4I6GA 3FY4A 1OWNA 2ZXWE 4A1SA
chains in the Genus database with same CATH topology
3ULQA 4HOUA 2WXJA 3RRUA 3JQ1A 2P58C 4FU3A 4WNEA 4XZ4A 1ZPQA 4GZDA 1BPOA 5BNWA 3MGBA 3HZIB 2CFUA 5A23A 3OXLA 3HDXA 3L16A 1CQTA 2KZ8A 3L17A 3ZVVA 4U07A 2LAHA 3CVQA 2PUEA 2MRIA 3E4BA 3OAWA 4ABNA 4GMLA 3RJVA 3H5TA 3NZUA 4I1AA 3CVXA 2B5AA 1OWOA 2OR1L 4F7AA 3JXDL 5FWQA 3FTYA 3CHQA 3S7FA 5G04C 3SCGA 3PZDA 2WXGA 3CVPA 3Q5MA 3AS5A 2LYQA 4GHJA 4GZCA 3FFLA 1HE8A 5T8IA 2WIUB 2DCPA 4BY6A 5JHBA 1X5BA 3B13A 2Q7FA 4GYYA 3MV3B 5EKQD 5KJLA 1R69A 1ZZ7A 2FEZA 3ASFA 4LUNU 1A17A 5CHEE 3R7QA 2WXIA 1XGWA 4Z58A 3MKQA 3T8MA 1MQSA 3JXCL 1HF0A 2CFZA 4FADA 4KZ0A 4JA7A 4HVBA 4I6EA 3UMVA 4G24A 1UJKA 2QY7A 4G11A 4A3TA 2KEKA 3TXMA 4FJYA 3CGHA 4AXHA 4CT4A 2L0TB 4LCTA 2ONDA 3U3WA 1NA0A 2EQXA 4HS2A 4U0UA 3FTUA 2R5SA 4L1BA 4UQXA 2J4DA 3LYAA 3GW4A 2M63A 4HORA 4MCTA 3FH8A 1WETA 4BFRA 1ZUGA 1NP7A 5A7LA 5BV1A 3FU0A 3PNTB 5AJDA 4PU8A 4RG9A 2X6IA 4X4IA 4DI3A 4Q69A 4N2QA 1GT0C 1HH8A 2AXUA 2V8SE 1E8WA 4XIFA 2PQNA 3U66A 3L6AA 4N2SA 2WXKA 5M72A 3F51A 3LEWA 2AUWA 4ANWA 4BWRA 2GRMA 3IVPA 1XNFA 2MQKA 4J1WA 4PUCA 4B8CB 1L5JA 4KVMA 1JWFA 1DVPA 3FP3A 4BSXA 3ML9A 1HG2A 3CK7A 5ANRA 3OXFA 5AIJA 4F53A 2OFYA 2CHWA 5K98B 3BD1A 3ZN3A 4AIFA 1ZZCA 2O4AA 2XRYA 1RZSA 4ILGA 2HSGA 4IRUA 5FTPA 1RZRA 3TAXA 3AU5A 2A5UA 4A1GA 1IQUA 3FUHA 4OVUA 2A6CA 3UUXA 4APOA 3PXPA 3CVYA 1X2LA 4I43A 2KCLA 2YINA 4PS7A 3S2AA 1LF8A 4GQMA 3FH7A 2WXFA 4J8SA 3FU5A 4XI9A 2CHZA 1E7UA 3HYMB 4GCOA 4N5CA 1IYGA 2UWJG 1JPLA 3CEQA 4YVQC 2XSDC 3ESKA 3CVWA 1WAO1 4OVVA 1ELKA 3MKRA 2WXLA 4IVZA 4ANVA 4CDRA 3CK9A 3HVEA 4F1SA 4U0SA 1Z3YA 3ESLA 4K0RA 5FJYA 4GZ5A 2MEZA 1WY6A 3TGOA 3HHMA 4I1OB 2VGXA 4I2ZA 4AOFA 4X4HA 4B8AA 3LXUX 2IF4A 1QQBA 4E6HA 4N3AA 2XPIA 3MV2B 4TRQA 1UTXA 1NERA 3LY7A 3QOUA 4PU3C 1BDHA 4L2YA 4G25A 4EZLA 5LCWJ 3SBTB 4XKBA 3T5VA 3VLDA 3LFPA 2VJ8A 3ZW3A 1VPWA 4GZ6A 4Z5DA 2R59A 5LX8A 4YG7B 1NEQA 2X3MA 3B7TA 1Z6TA 2VTBA 2VSOE 3S7BA 1H0AA 4MCXA 2FBNA 3GZ2A 4TUUA 2XRZA 2YNQA 1OWPA 4U63A 4LEUA 3G2TA 4OYSA 2BNMA 3D9NA 5BV0A 2XHEA 1AU7A 3NZSA 2NC9A 3S7JA 3URZA 4CGVA 3RU0A 2JVLA 3LY8A 5KCMA 3PVLA 1OUVA 3FEXA 1POUA 3QB2A 3PEVB 1OCTC 4JPSA 4GCNA 5EX0A 4DJAA 4CCAA 4X4CA 3RO2A 1UN9A 3I4GA 3MKQB 4JW1A 4ACKA 1QQAA 1U3CA 1U3DA 3ZIMA 3SCHA 4X4GA 2VQ2A 1PY1A 2GW1A 3O4ZA 3RRNB 4PH4B 4ATGA 3VK0A 4ANXA 2J09A 4Y42A 5BPPA 3SHFA 3SD5A 4IYPA 1O4XA 2XQ0A 2DBAA 3PE3A 4JCXA 2C0LA 3B7UX 4P29A 4B0ZA 4UWLA 4E85A 4F3VA 1PAQA 3LISA 3AU4A 3BG1B 4MS6A 3U9WA 3UT8A 1INZA 3QWWA 4JHKA 2I2OA 2J08A 2WB2A 3CECA 4HLEA 1WIZA 3CHOA 3MX3A 4ACLA 2WQ6A 3FUKA 2PE5A 4OB4A 4EBAA 2WXQA 2YHEA 4CT0A 5BUZA 3QWVA 4TV3A 5CMWA 4YG4A 2FULA 1H2UA 3L13A 2X38A 3KEZA 3I3NA 2KCKA 2CROA 1HF8A 4FHKA 4KYOB 4BTBA 3RK6A 2GRLA 1W3BA 1VDYA 1BDIA 1IQRA 1E8ZA 3OXGA 3EHNA 5FQ6A 2LYJA 2HYZA 3BG0B 3O9XA 4FC8A 4BX8A 4RVBA 2HINA 3CKBA 5EX3A 1PRUA 3EUSA 3OQMA 3FWVA 1PNRA 4GA1A 1QQEA 3FDHA 3G2VA 2J49A 2KZTA 4IULA 3QQ6A 3FH5A 1UJJA 4LERA 4JZYA 5ARFA 3F6WA 2DIWA 2X6HA 1H2TC 3CVLA 3FULA 3GYZA 3PH0C 4Q94A 4AY5A 2X6KA 2LSVA 3GN5A 1JH9A 4JVSA 3UX4A 2JEKA 3CHPA 4U0ZA 4JC8A 3RKVA 4NDWA 1E96B 3PE4A 3TXNA 1PC2A 1B0NA 2I6HA 1HZ4A 3JUIA 1KT0A 3LDZA 4G26A 4I1MA 2WXOA 3OQNA 3KAEA 2E0IA 2J07A 4WWPA 4Z5CA 1SQ8A 2OVFA 4PS3A 2AWIA 2J9QA 1GW6A 2EWTA 3ZHEA 2CG3A 3RO3A 2OVBA 3PEUB 2J4BA 3HVEB 4EECA 5KJNA 4MRUA 2O49A 4GMJA 4G23A 1L1MA 4J8FA 3D9KA 3IV0A 4FHJA 4B94A 4GA2A 4Y6CA 3SZ7A 3G2SA 2CHXA 2VGXB 3QYXA 2Y4UA 3D3MA 4JL0A 2GGFA 5A7DB 4BT9A 4CDNA 2NXPA 1UG3A 4G1TA 3QC1A 2PM6A 3RZZA 2XCBA 3EHMA 3ZGQA 3ZYMA 3KZ3A 2WPVA 4N3CA 5DBKA 2ILRA 3CVVA 3I4RB 4CGWA 2WVIA 4AJWA 4L2LA 4WNGA 1ADRA 2VTBB 4X4BA 1UW4B 2KATA 5E75A 3LPZA 2PUGA 2XJ3A 2Y3AA 2X6JA 5FZQA 2XEVA 2L0IA 4JHJA 3GBFA 1MHQA 5LP0A 3OP9A 1ZZ8A 3CVNA 3R7RA 2ZU6B 4UI9K 5J90A 2AVPA 2PUFA 1DW9A 3T5XA 3ZFWA 3DNVB 3KD7A 4KBQA 2LYPA 4HXIA 1EF1C 3KXAA 3FUIA 1X57A 2PIJA 5FQ7A 3ASGA 2WXRA 1E8XA 1DWKA 2L49A 4I17A 2KCVA 1YA0A 4YNDA 1EPUA 3AS4A 3CQGB 5BW8C 4F8DA 2WXMA 1OSLA 4GYOA 2LYRA 2LYLA 4YARA 3TG5A 3CSFA 3FTZA 1ZZ6A 3IBEA 5G05J 5C1DA 4KT6B 3SF4A 1WM5A 4A55A 1FVFA 4JCYA 3IHVA 1Y8MA 1FCHA 1JUQA 3CR3A 2OV8A 3PRZA 3QWPA 4G2VA 5FZRA 2FF4A 4DLQA 2JLBA 3G2WA 4Z59A 2I9CA 4EZJA 1PRVA 4IA8A 1HX8A 4D10C 4DK5A 3CHSA 5LOZA 4FA6A 2IONA 3CLJA 4KMOA 2L9BA 2LYSA 4EBAG 2R63A 2LYKA 2WQHA 3P1UA 4AM9A 1HU3A 4C0EA 3P2BA 4FBIA 3MA5A 4JQDA 2I1KA 3OMTA 2D5VA 4GAAA 1NZNA 3EIQC 3KJXA 3CHMA 3VLEA 4FN3A 3SCFA 3JYSA 2IVBA 1TJFA 1ZAYA 3LCAA 2I1JA 3UFDA 3QNKA 2NSZA 2KZTB 1XWRA 3ZHMA 3QDNA 4JHRA 5FQ4A 5FQ8A 5KJMA 1FVHA 3OQOA 3FTSA 3IKOB 3QJZA 3L22A 4HOQA 3FUJA 3K9IA 1JWLA 2HO1A 4N3BA 3GN5B 1NA3A 3QK0A 3SBSA 3G7DA 4B89A 3FMYA 3DBSA 3QF3A 2KC7A 3U4TA 3ONKA 3PNLB 1QP0A 4I8TA 1DNPA 4O8BA 5LCWC 2CSFA 5J08A 3Q15A 1H6KA 2QFCA 4ME2A 4XI0A 3ZXSA 1S7EA 1IC8A 2BUGA 1UXDA 2VSYA 5BT1A 2IOLA 2ICPA 1N52A 3ZHEB 2UY1A 3PDNA 1TEZA 5JJ6A 5JJ7A 4GPKA 5JJTA 2V4LA 2O38A 3FEYA 3QKYA 2L6JA 3ZKCA 3APCA 3FTWA 3FU3A 2XGOA 3MEKA 4FLBA 4J0UA 4RG6A 4WWNA 1ELWA 1IHGA 4J8EA 4XX5A 3CVUA 3FHEA 1R63A 2WXHA 4L7TA 4J1XA 3AS8A 4UWHA 4EQFA 3MYVA 3OTNA 1SQMA 2PUDA 3U64A 2YHCA 3B7RL 4NACA 4V3IA 1TJCA 3D9OA 3LY9A 3CIAA 3RIBA 3UQ3A 4AV7A 1LCCA 3CHRA 3APDA 1Y7YA 4HFGA 5D0QD 2LAIA 2RG8A 4Z5HA 1S0PA 4PU4C 1ELRA 3ONLA 2BNNA 4H7XA 3PUKA 2BTDA 2IQCA 3ENEA 3PREA 3QAQA 3TJPA 4BTAA 4C0MA 2BNOA 3L08A 4I2WA 3Q4AB 4CEMA 3JXBC 3BS3A 4ILHB 3MJWA 1KT1A 4ILIA 4GYWA 5D0OD 1ZZ9A 4I6TA 4DLOA 5CCLA 3LS8A 5AENA 4PDXA 4I6RA 1Z3XA 3ASDA 3NQPA 5AYWD 4YG1A 3QWGA 3FUEA 1HFAA 4U8HA 4AP2A 4UI9J 4AEZC 3SNXA 1Y6IA 3VTYA 3EJNA 3SGHA 4I6UA 2EF8A 2WXNA 1OWMA 3LVQE 2V5FA 1LMB3 3HIZA 4M3OA 2PPXA 2WMNA 4ANUA 2OOEA 3ML8A 2PUAA 4JEHA 1CJGA 1RPEL 2IFUA 4KXKB 2MOWA 3ZEFA 1UXCA 2AW6A 1ZVVA 2EBYA 1H2VC 2V0PA 2WMOA 4QFVA 5FT9A 3ZYKA 2FJRA 1SZAA 5C2YA 3IEGA 4HOTA 2IU1A 5KJKA 3FYAA 4I9CA 4J6IA 3EIJA 4FJZA 3FU6A 2IV1A 3LVRE 2LO6A 4N39A 3ZRHA 4UWGA 5A6CA 2Y4TA 2R1JL 1ZU2A 5E76A 3SI5A 3N71A 3B7HA 1LQCA 3B7SA 3GZSA 1P5QA 4UI9C 2VSNA 1PRAA 1EFAA 1KLXA 4KVOA 4HOSA 3L54A 3CQCB 3JCKC 3TL5A 3D9MA 4K03A 2XI8A 3UT4A 4EZKA 1E7VA 5HQ8A 2IVQA 3S8QA 2L8NA 1QPZA 3ZPJA 3G2UA 2XIUA 3R1FA 3I5PA 4KZCA 4U04A 5AJLA 4WNDA 3FTVA 4BT8A 2GZUA 3O48A 2HM8A 3BEEA 4IN3B 5EDSA 3LJ3A 1E90A 4BX9A 4R7LA 4UQYA 4YVOA 2PZIA 1JFSA 3ZHIA 1QP7A 4WWOA 4AVXA 5ENNA 4MLPA 1LLIA 3APFA 2KPJA 1HG5A 2A4ZA 4FP7A 1E3OC 4Q96A 1B89A 2PL2A 2KEIA 2UY1B 1E8YA 3DPDA 2PM7A 3FYMA 4XE0A 1RZRD 4PU7A 3R9AB 1JFTA 2BJCA 4GU5A 3CSTA 1LCDA 1SZ9A 3NF1A 3TG4A 3VTXA 4JXTA 4MKTA 3C98A 3ZYQA 2WUSR 4WNFA 1WH8A 3SFZA 4AY6A 4J8DA 4CDMA 4I6JA 2VYIA 2IU7A 1PERL 3EDTB 2C0MA 2AXVA 3F52A 2H8RA 2IOSA 4IWRA 1OWLA 1ZS4A 1RIOA 3CROL 2C2LA 4YBAA 2WXPA 2XPYA 3FUDA 2PUCA 3MCXA 4XKCA 2XGSA 3JQ0A 1H19A 4Y6WA 2IUOA 3L1PA 3PUJA 3BDNA 2ICTA 5DIZA 5FZSA 1YSEA 3D9IA 3UT7A 3ASHA 2XCJA 4WUYA 4CRWA 4DI4A 5JHAA 3D9PA 3CLCA 4JEUA 3FUNA 5G05C 1HO8A 4DPRA 3WXXA 4A3VA 1QNFA 4UWKA 3CK8A 5HI7A 1QP4A 5G2NA 2WQ7A 2IJGX 3GZ1A 3QARA 4EPZA 5LFAA 2VGYA 3CV0A 3Q47B 4W9RA 2LNIA 2XPZA 3PS6A 2FO7A 1EDUA 1ZBPA 2KM4A 2X6FA 5T3RA 2KEJA 4H7YA 1UN8A 3CKCA 4WAFA 1EYHA 4FLHA 4NRHB 5G55A 2R17C 1JWGA 4GB9A 4L23A 2PUBA 4C9BB 4I9EA 4O6FA 4LRZA 5ANLA 2FI7A 3Q49B 4APFA 4NQ0A 3ZYLA 5CCMA 4RSYA 1WH6A 4X4DA 3IHYA 3S7DA 5CMYA 3RRMB 4X4FA 2CG2A 2RD0A 4UQZA 4URKA 3TRBA 1ZZBA 4UWFA 1HS6A 3UPVA 2BF0X 2YQ8A 3KS2A 2VSXE 1QZ2A 2IVGA 4FULA 4JA9A 3D1NI 5ARGA 5T4YA 2MHKA 3VLFA 3MZLB 2LCVA 3FTXA 3MLFA 5G04J 2JCGA 1Y9QA 3D9JA 1HXIA 4PS8A 3D9LA 2XCCA 3FUFA 2E2EA 2XGMA 4X4EA 1N54A 2PQRA 2AXZA 2LSUA 4GZ3A 4GA0A 2WM9A 2HR2A 3G5GA 3FUMA 4I6GA 4NURA 3FY4A 3LKUA 1OWNA 4A1SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KXA A;  1UXC A;  2AW6 A;  1ZVV A;  1X57 A;  2EBY A;  4MCX A;  1ZPQ A;  2PIJ A;  2FJR A;  2BNM A;  1AU7 A;  3HZI B;  1DWK A;  2L49 A;  3FYA A;  2JVL A;  1CQT A;  4F8D A;  2KZ8 A;  1OSL A;  2LYR A;  2LYL A;  4YAR A;  2IV1 A;  1POU A;  2PUE A;  1OCT C;  1ZZ6 A;  3H5T A;  2R1J L;  4X4C A;  2B5A A;  3B7H A;  1LQC A;  1QQA A;  2OR1 L;  3SCH A;  4X4G A;  3JXD L;  4JCY A;  1PRA A;  1EFA A;  3SCG A;  2LYQ A;  4GHJ A;  3VK0 A;  4Z59 A;  4Y42 A;  2WIU B;  2XI8 A;  1PRV A;  4IA8 A;  1O4X A;  4JCX A;  2IVQ A;  1R69 A;  1ZZ7 A;  3S8Q A;  2L8N A;  1QPZ A;  3LIS A;  2LYS A;  2R63 A;  1BDI A;  2LYK A;  2XIU A;  3R1F A;  4Z58 A;  4FBI A;  3JXC L;  1HF0 A;  3CEC A;  4JQD A;  1WIZ A;  2GZU A;  3OMT A;  2D5V A;  2KEK A;  2PE5 A;  3KJX A;  4OB4 A;  4FN3 A;  3SCF A;  3U3W A;  2IVB A;  1JFS A;  3ZHI A;  1QP7 A;  1ZAY A;  3UFD A;  4YG4 A;  1XWR A;  3ZHM A;  4YG7 B;  1LLI A;  2KPJ A;  3OQO A;  2CRO A;  4MCT A;  1WET A;  1ZUG A;  2GRL A;  1E3O C;  5A7L A;  1JWL A;  2KEI A;  3GN5 B;  3FYM A;  4PU8 A;  1RZR D;  3G7D A;  4PU7 A;  3FMY A;  4X4I A;  2LYJ A;  3QF3 A;  1GT0 C;  3O9X A;  1JFT A;  2BJC A;  1QP0 A;  2HIN A;  4I8T A;  2AXU A;  1LCD A;  1PRU A;  3EUS A;  3OQM A;  4O8B A;  1PNR A;  2CSF A;  2WUS R;  1WH8 A;  1S7E A;  3F51 A;  1IC8 A;  1UXD A;  2AUW A;  3QQ6 A;  2IU7 A;  1PER L;  3F6W A;  2ICP A;  2AXV A;  2GRM A;  3IVP A;  2MQK A;  4J1W A;  3F52 A;  3GN5 A;  1JH9 A;  2H8R A;  4IWR A;  1ZS4 A;  1RIO A;  2O38 A;  3CRO L;  4YBA A;  3ZKC A;  2PUC A;  4NDW A;  2IUO A;  3L1P A;  3BDN A;  2ICT A;  1B0N A;  1YSE A;  2OFY A;  2XCJ A;  1R63 A;  3CLC A;  4J1X A;  5K98 B;  3BD1 A;  3OQN A;  1ZZC A;  4Z5C A;  1SQ8 A;  1RZS A;  2O4A A;  2HSG A;  2PUD A;  1RZR A;  1QP4 A;  2AWI A;  2EWT A;  2A6C A;  3PXP A;  1LCC A;  2O49 A;  2KEJ A;  1X2L A;  1Y7Y A;  1L1M A;  4GQM A;  4Z5H A;  4PU4 C;  3DNV B;  3QYX A;  2BNN A;  2PUB A;  2BNO A;  3RZZ A;  1WH6 A;  4X4D A;  3JXB C;  3BS3 A;  3KZ3 A;  2XSD C;  4X4F A;  4IVZ A;  1ZZ9 A;  4I6T A;  3TRB A;  1ZZB A;  1ADR A;  4I6R A;  4X4B A;  2MEZ A;  4YG1 A;  3QWG A;  2IVG A;  2PUG A;  2XJ3 A;  3D1N I;  4X4H A;  2LCV A;  2EF8 A;  3MLF A;  4I6U A;  2JCG A;  1Y9Q A;  3GBF A;  1LMB 3;  1QQB A;  3OP9 A;  2PPX A;  1ZZ8 A;  2PUA A;  4X4E A;  1UTX A;  1NER A;  4PU3 C;  1CJG A;  2AXZ A;  1BDH A;  1RPE L;  2PUF A;  3G5G A;  3LFP A;  1DW9 A;  1VPW A;  4Z5D A;  2LYP A;  1NEQ A; 
#chains in the Genus database with same CATH topology
 3ULQ A;  4EKI A;  4GZD A;  5BNW A;  3BU8 A;  3ZVV A;  4U07 A;  2RFA A;  3E4B A;  2PUE A;  1QBQ A;  3OAW A;  1D8E A;  3CVX A;  1OWO A;  3JXD L;  3IXE A;  3CVP A;  5JHB A;  2B6C A;  5ENP D;  3B13 A;  5KJL A;  2V3C C;  1MX2 A;  5D66 A;  2WXI A;  1XGW A;  3GUU A;  4FAD A;  2PXT A;  4DX2 A;  4LCT A;  3U3W A;  2EQX A;  4L1B A;  3GW4 A;  2M63 A;  3FH8 A;  4PU8 A;  4RG9 A;  4DI3 A;  4J8Y A;  4LNU D;  4U96 D;  1E8W A;  4XIF A;  2PQN A;  3LEW A;  2F8X K;  2LLV A;  2MQK A;  1DVP A;  3OXF A;  4Z68 A;  4DX7 D;  2XRY A;  4HRM B;  1QYM A;  3JXJ A;  5IY5 E;  3TAX A;  2A5U A;  1DUL A;  4OVU A;  4APO A;  3S2A A;  4PS7 A;  4J8S A;  3HYM B;  4GCO A;  1IYG A;  3CEQ A;  3EUV A;  2P9K G;  3SO8 A;  2P9N G;  3ESL A;  4I1O B;  2IF4 A;  4N3A A;  2XPI A;  1OXJ A;  3MV2 B;  1UTX A;  4PU3 C;  3AG4 E;  3VLD A;  2VJ8 A;  1VPW A;  4GZ6 A;  2R59 A;  5LX8 A;  3KL4 A;  2VTB A;  2VSO E;  3DEP A;  1H0A A;  2GRN B;  2FBN A;  3S7B A;  3W9G A;  4TUU A;  1OWP A;  3D9N A;  2XS8 A;  2XHE A;  1AU7 A;  3URZ A;  1OUV A;  3R9M A;  4GCN A;  3I4G A;  4ACK A;  4JW1 A;  3O4Z A;  2ETC A;  4ATG A;  3TWS A;  3PE3 A;  2OEV A;  4P29 A;  4EZJ A;  3ASN E;  4E85 A;  1PAQ A;  1S63 A;  4MS6 A;  3UIN C;  3QWW A;  4HLE A;  1WIZ A;  3MX3 A;  4ACL A;  5AAO A;  2PE5 A;  2KCK A;  1HF8 A;  1E8Z A;  3BG0 B;  2R05 A;  4RVB A;  3CKB A;  3EUS A;  4ZHB A;  4U8V D;  1QQE A;  1G3N B;  3G2V A;  4IUL A;  3QQ6 A;  2PNN A;  1UJJ A;  5ARF A;  4JZY A;  3F6W A;  3UWP A;  1YCS B;  2DIW A;  3FUL A;  1N4P A;  4U0Z A;  3TXN A;  3PE4 A;  4LNB A;  1B0N A;  2LXM A;  1HZ4 A;  3JUI A;  1N95 A;  2WXO A;  4Z5C A;  3ZHE A;  2CG3 A;  4K5C A;  3HG0 D;  2XXP A;  2J4B A;  2HCS A;  2O49 A;  4G23 A;  4B94 A;  4F3V A;  5A7D B;  4JL0 A;  1UG3 A;  4F1P A;  3RZZ A;  3EHM A;  4N3C A;  5DBK A;  3CVV A;  4HBD A;  2VTB B;  4X4B A;  1UW4 B;  2KAT A;  3UM3 A;  5E75 A;  3ZU7 B;  3UI2 A;  2X6J A;  3GBF A;  2XZT G;  3R7R A;  5H7P A;  4OAV B;  3MEJ A;  3FUI A;  3Q73 A;  2WXR A;  1DWK A;  4I17 A;  2KCV A;  5KJM A;  3CQG B;  5BW8 C;  2LYR A;  4YAR A;  3CSF A;  1ZZ6 A;  5C1D A;  4TUM A;  4JCY A;  4U7E B;  3IHV A;  1Y8M A;  3NB2 A;  3QWP A;  5FZR A;  3UXG A;  1N0Q A;  4Z59 A;  5EN5 D;  2ION A;  4EBA G;  2R63 A;  2WQH A;  4FBI A;  3MA5 A;  3SQV A;  3OMT A;  1NZN A;  3KJX A;  4ER0 A;  3M9L A;  3QNK A;  5FQ4 A;  5FQ8 A;  3OQO A;  3FTS A;  4HOQ A;  2XXQ A;  1FPP A;  1O1R A;  3DEO A;  2HO1 A;  1NA3 A;  3QK0 A;  4B89 A;  3DBS A;  5DTR A;  3U4T A;  2F0Y A;  2HFZ A;  5J08 A;  3Q15 A;  4XI0 A;  1IKN D;  1D9S A;  1K1B A;  2ICP A;  3ZHE B;  2O38 A;  2L6J A;  2XGO A;  4J8E A;  1R63 A;  2WXH A;  3KEA A;  3C3O A;  2ZIR A;  3LY9 A;  3GZD A;  3RIB A;  1LCC A;  2L1P A;  3T8K A;  2LAI A;  3ASO E;  1S0P A;  4APF A;  4PU4 C;  1ELR A;  2BNN A;  3TJP A;  3ENE A;  3QAQ A;  2H6G A;  3L08 A;  3Q4A B;  4ILH B;  1KT1 A;  3Q78 A;  4GYW A;  3LS8 A;  5AEN A;  3ASD A;  3NQP A;  3LJN A;  5CEC B;  4AEZ C;  1Y6I A;  3VTY A;  2EF8 A;  2WXN A;  2V5F A;  1LMB 3;  4M3O A;  2PPX A;  1RPE L;  2F37 A;  5B1B E;  1UXC A;  2AW6 A;  5FT9 A;  2WMO A;  1SZA A;  3IEG A;  4HOT A;  3LVR E;  2IV1 A;  2GRO B;  4K5A B;  2Y4T A;  1LQC A;  3B7S A;  3GZS A;  4HI8 A;  1EFA A;  4UUC A;  4K03 A;  2XI8 A;  3S8Q A;  3DSX A;  2XIU A;  3JXI A;  3DSV A;  1ZB1 A;  1N4Q A;  3FTV A;  2XXA A;  1NW3 A;  4DUI A;  4GTR A;  2GZU A;  3O48 A;  3BEE A;  4IN3 B;  3ULE G;  3LJ3 A;  3ZHI A;  4AVX A;  4MLP A;  1LLI A;  3APF A;  1E3O C;  4CCA A;  3R9A B;  3GZD C;  2PM7 A;  1RZR D;  5CBN A;  3VTX A;  4JXT A;  2Y0B G;  3C98 A;  3DWL G;  1WH8 A;  4CDM A;  4I6J A;  4C48 B;  3VWS A;  3EDT B;  3F52 A;  4FC8 A;  1ZS4 A;  3CRO L;  2C2L A;  2WXP A;  3L1P A;  5DIZ A;  1YSE A;  3D9P A;  4OBM A;  3FUN A;  5G05 C;  4EHM A;  1HO8 A;  2PXU A;  3QAR A;  3Q47 B;  4W9R A;  3JUE A;  1ZBP A;  2KEJ A;  2BKG A;  2FO1 E;  2PUB A;  1YMP A;  4I9E A;  4O6F A;  4QQI A;  4C9B B;  4NQ0 A;  3UM2 A;  4GTP A;  1WH6 A;  3TRB A;  4UWF A;  1HS6 A;  1K8K G;  2BF0 X;  1QZ2 A;  2IVG A;  5JMN D;  5G04 J;  1HXI A;  3X2Q E;  2XCC A;  3FUF A;  2E2E A;  2HR2 A;  3G5G A;  3FUM A;  1MFQ C;  4HOU A;  3JQ1 A;  4WNE A;  3A9Z A;  1BPO A;  2HE0 A;  2LXL A;  3HDX A;  3L16 A;  1CQT A;  3CVQ A;  3TEP A;  4GML A;  3NZU A;  2B5A A;  3DPY A;  2OR1 L;  5AN8 A;  5G04 C;  3SCG A;  1MX6 A;  4BY6 A;  1HE8 A;  3HXB A;  2QC9 A;  4GYY A;  3MV3 B;  1R69 A;  1ZZ7 A;  2FEZ A;  4LUN U;  4BET A;  2XEE A;  3T8M A;  1MQS A;  1HF0 A;  4JA7 A;  4I6E A;  1UJK A;  2QY7 A;  5DT2 A;  4FJY A;  2V4H C;  4CT4 A;  2L0T B;  4U0U A;  4UQX A;  3FTU A;  2R5S A;  4RLY A;  3ZXP A;  2J4D A;  3LYA A;  1SVX A;  1WET A;  3FU0 A;  3PNT B;  5AJD A;  4Q69 A;  4N2Q A;  1GT0 C;  2AXU A;  1OT8 A;  4ANW A;  4PUC A;  3TWU A;  4KVM A;  1N9A A;  3EU9 A;  3Q9N C;  4CYM D;  2OEW A;  4F53 A;  4AIF A;  1ZZC A;  3WG7 E;  1MX4 A;  2HSG A;  5FTP A;  1RZR A;  1X2L A;  4I43 A;  2KCL A;  3PZ1 A;  4GQM A;  2CHZ A;  4N5C A;  2UWJ G;  4YVQ C;  3TFL A;  3CVW A;  1WAO 1;  4CDR A;  3HVE A;  4F1S A;  5AQ7 A;  4K0R A;  2GRQ B;  4GTS A;  4GZ5 A;  3TGO A;  2GRP B;  3HHM A;  4X4H A;  3C5R A;  4B8A A;  1OY3 D;  1QQB A;  4E6H A;  4JD2 G;  3LY7 A;  5LCW J;  4G25 A;  3SBT B;  3LFP A;  1MYO A;  4Z5D A;  1NEQ A;  3B7T A;  1Z6T A;  3AG1 E;  2YNQ A;  4LEU A;  4OYS A;  3S7J A;  3QOX A;  5KCM A;  1POU A;  3QB2 A;  3W9F A;  2PXE A;  3RO2 A;  1UN9 A;  1U3D A;  3L82 A;  3SCH A;  4X4G A;  1PY1 A;  2J09 A;  4Y42 A;  3GZC A;  1O4X A;  3B7U X;  4UWL A;  3LIS A;  3AU4 A;  1INZ A;  1FT2 A;  3ABM E;  2WQ6 A;  3CHO A;  4EBA A;  2WXQ A;  2YHE A;  3J5P A;  3L13 A;  4FHK A;  4KYO B;  3RK6 A;  1W3B A;  1BDI A;  4BX8 A;  3EHN A;  3NOC D;  2HYZ A;  3O9X A;  2LNM A;  4DRX E;  1PNR A;  5CER B;  2J49 A;  2KZT A;  3V30 A;  3FH5 A;  1RW2 A;  2Y69 E;  4Q94 A;  3PH0 C;  2LSV A;  3GN5 A;  3CHP A;  2KBX A;  3RKV A;  4NDW A;  1E96 B;  4HI9 A;  2I6H A;  1KT0 A;  4G26 A;  3ZKJ A;  3OQN A;  2J07 A;  4WWP A;  1SQ8 A;  2OVF A;  2AWI A;  2EWT A;  3HVE B;  3V31 A;  1JCS A;  3IV0 A;  4Y6C A;  3SZ7 A;  2CHX A;  3QYX A;  4BT9 A;  3DST A;  4G1T A;  5CEA A;  1TNZ A;  3I4R B;  1OCR E;  2WVI A;  4AJW A;  5JA4 D;  2XJ3 A;  2Y3A A;  5BXO A;  2V5Q C;  3OP9 A;  4BER A;  5DTM A;  2ZU6 B;  2AVP A;  2PUF A;  3Q75 A;  2H6I A;  1AP7 A;  1DW9 A;  3T5X A;  2IO3 C;  2LYP A;  4HXI A;  1EF1 C;  3T9K A;  1E8X A;  4YND A;  1YA0 A;  2WXM A;  1OSL A;  4GYO A;  3IBE A;  3SF4 A;  2QYU A;  4A55 A;  1FCH A;  3TWV A;  2JLB A;  3G2W A;  1OCO E;  2I9C A;  1PRV A;  3CLJ A;  4KMO A;  2L9B A;  4EKG A;  3A9Y A;  5KNG A;  3P1U A;  1HU3 A;  3DSW A;  4JQD A;  2I1K A;  4GAA A;  3JYS A;  2DVW A;  2NSZ A;  2KZT B;  1XWR A;  3QDN A;  4JHR A;  3IKO B;  3QJZ A;  1LTX A;  3GN5 B;  3G7D A;  3QF3 A;  3ONK A;  4I8T A;  1DNP A;  1O5M A;  1KZO A;  1H6K A;  2QFC A;  3Q79 A;  1S7E A;  2VSY A;  2DYR E;  1N52 A;  2UY1 A;  3PDN A;  1TEZ A;  5JJ6 A;  4GPK A;  3FEY A;  3FTW A;  3FU3 A;  3MEK A;  2EIJ E;  3FHE A;  3BUA A;  3OTN A;  5HRY A;  3UIO C;  1TJC A;  3D9O A;  4Z5H A;  4GTT A;  4HOR A;  3PUK A;  2XZD G;  3JXB C;  2A5E A;  2RKK A;  4HQD A;  5D0O D;  1ZZ9 A;  1TN6 A;  4PDX A;  5AYW D;  2XS1 A;  3QWG A;  4AP2 A;  4K5B A;  3SNX A;  3SGH A;  1OWM A;  2WMN A;  3ML8 A;  3TWX A;  4YDE A;  1DC2 A;  3B95 A;  3OKZ A;  1S64 A;  3ZEF A;  2EIN E;  2EBY A;  3SFY A;  2J7U A;  2IU1 A;  4I9C A;  3EIJ A;  2H6F A;  3ZRH A;  5ENS D;  4UWG A;  5A6C A;  4LSZ E;  2R1J L;  5E76 A;  2DZN A;  3SI5 A;  3N71 A;  3E30 A;  4KVO A;  3L54 A;  3JCK C;  2YBD A;  2IVQ A;  5CED B;  3ZPX A;  3G2U A;  5AJL A;  5D2M C;  1N0R A;  4BT8 A;  2HM8 A;  4BX9 A;  4UQY A;  2PZI A;  1JFS A;  1TNO A;  1HG5 A;  2A4Z A;  4FP7 A;  1B89 A;  2UY1 B;  4GTO A;  4GTM A;  2LUH A;  1SZ9 A;  1RZ4 A;  2EIK E;  4MKT A;  4AY6 A;  4J8D A;  1HQ1 A;  2IU7 A;  5AQ9 A;  2NYJ A;  3HXD A;  1U2V G;  2BKK B;  1BI8 B;  4YBA A;  4G8K A;  1MJ0 A;  2PUC A;  3JQ0 A;  1H19 A;  2IUO A;  3BDN A;  1IXV A;  3UT7 A;  3D9I A;  2ODR D;  4DI4 A;  3CLC A;  1UOH A;  3WXX A;  4A3V A;  1QNF A;  3CK8 A;  5AQA A;  2WQ7 A;  2VGY A;  2DYS E;  3CV0 A;  2LNI A;  4ER6 A;  1UN8 A;  3CKC A;  4FLH A;  3SR4 A;  3DXK G;  4LRZ A;  2FI7 A;  3DM5 A;  3Q49 B;  5ANL A;  3ZYL A;  3NOG D;  3S7D A;  5CMY A;  2CG2 A;  4UQZ A;  2YQ8 A;  4JA9 A;  3MZL B;  3FTX A;  3D9L A;  5KNH D;  2XGM A;  4X4E A;  1N54 A;  2PQR A;  2AXZ A;  4GZ3 A;  4GA0 A;  2VGE A;  3LKU A;  4NAC A;  2WXJ A;  2P58 C;  4XZ4 A;  1ZPQ A;  5A23 A;  3OXL A;  3L17 A;  2LAH A;  2MRI A;  3H5T A;  4I1A A;  4F7A A;  5FWQ A;  3S7F A;  3Q5M A;  4GZC A;  3HXF A;  4GHJ A;  5T8I A;  2WIU B;  1X5B A;  5EKQ D;  2Q7F A;  3ASF A;  3A9X A;  3MKQ A;  4B93 B;  1NFI E;  3Q7A A;  3UMV A;  4G11 A;  3TXM A;  1V54 E;  3C3Q A;  5KWD A;  4HS2 A;  1BI7 B;  1ZUG A;  5A7L A;  1QB2 A;  4DE8 A;  2ZGD A;  2X6I A;  1X81 A;  3U66 A;  2WXK A;  5M72 A;  4CZ2 D;  2VEO A;  1JCR A;  3DXM G;  4DX6 D;  3IVP A;  4J1W A;  2IO2 C;  3ABL E;  1JWF A;  1NI1 A;  1HG2 A;  3CK7 A;  5AIJ A;  4HRN A;  2CHW A;  2O4A A;  4IRU A;  1RZS A;  4DE9 A;  5JUW A;  4A1G A;  1IQU A;  3FUH A;  3F6Q A;  3CVY A;  3SX0 A;  3FU5 A;  3ULY A;  1E7U A;  2P9U G;  3OWQ A;  2XSD C;  3AJI A;  4OVV A;  4DX5 D;  1ELK A;  3MKR A;  2WXL A;  4IVZ A;  4ANV A;  3CK9 A;  1Z3Y A;  5FJY A;  1WY6 A;  1TR4 A;  2VGX A;  4I2Z A;  1Z5S C;  3UKU G;  1AWC B;  2IY0 C;  3QOU A;  1BDH A;  4L2Y A;  4EZL A;  4XKB A;  3T5V A;  3ZW3 A;  3NZL A;  2X3M A;  1U2Z A;  4MCX A;  3GZ2 A;  4U63 A;  5BV0 A;  3NZS A;  4TXP A;  2NC9 A;  4CGV A;  2J8S D;  2JVL A;  3RU0 A;  3EU5 A;  3LY8 A;  3FEX A;  4G8L A;  4X4C A;  1N4S A;  3MKQ B;  3RAU A;  1QQA A;  1U3C A;  3ZIM A;  2VQ2 A;  3RRN B;  5BPP A;  2J7W A;  4IYP A;  2XQ0 A;  4JCX A;  2C0L A;  2P9I G;  3BG1 B;  3UT8 A;  2J08 A;  5FIO A;  3E32 A;  4EQZ A;  5BUZ A;  4CT0 A;  3QWV A;  4YG4 A;  5EID A;  2FUL A;  3KEZ A;  1WG0 A;  3I3N A;  2EIL E;  1VDY A;  1IQR A;  3OXG A;  2LYJ A;  2HIN A;  1PRU A;  3FWV A;  4F6R D;  2IEJ A;  3FDH A;  3C3R A;  3UTM A;  1K1A A;  5DRT A;  1H2T C;  4AY5 A;  2HCN A;  1JH9 A;  1O1T A;  4ZFH A;  4I1M A;  3KAE A;  3HXE A;  2OVB A;  4FHJ A;  5B3S E;  2VGX B;  2Y4U A;  3D3M A;  5B1A E;  2GGF A;  3TWR A;  4CDN A;  2PXV A;  5ENT D;  3QC1 A;  2PM6 A;  2XCB A;  3ZYM A;  3TEL A;  2ILR A;  1MZC A;  4CGW A;  2P9L G;  2PUG A;  2XEN A;  2JQE A;  5FZQ A;  2XEV A;  2L0I A;  2LLW A;  4JHJ A;  5LP0 A;  5DRY A;  1ZZ8 A;  2ETA A;  4UI9 K;  2MYO A;  2DWZ A;  3ABK E;  1OCC E;  3R09 A;  3UM0 A;  3ZFW A;  3DNV B;  4KBQ A;  5CRU A;  3NAW A;  3ASG A;  4OAU C;  2L49 A;  2RFM A;  3E37 A;  3CVU A;  1EPU A;  4KT6 B;  1FVF A;  3ZUV B;  2OV8 A;  4G2V A;  2P2C P;  5EIL A;  2FF4 A;  4DLQ A;  3J5Q B;  1HX8 A;  1SA4 A;  4DK5 A;  3CHS A;  5CBO A;  2PXK A;  2LYS A;  3HRA A;  4GMR A;  4C0E A;  3NXH A;  2OCC E;  5ITZ F;  3EIQ C;  3VLE A;  4FN3 A;  3TWQ A;  3UFD A;  5KJN A;  3DSS A;  3L22 A;  3FUJ A;  3K9I A;  3PZ4 A;  3FMY A;  3PNL B;  1QP0 A;  5LCW C;  2CSF A;  1N4R A;  4ME2 A;  3ZXS A;  2PXP A;  3B7B A;  2IOL A;  3AAA C;  2R2L A;  5JJ7 A;  5JJT A;  2V4L A;  3ZKC A;  3APC A;  4RG6 A;  1BU9 A;  1ELW A;  1IHG A;  4L7T A;  4J1X A;  3AS8 A;  3C72 A;  2YHC A;  4V3I A;  3CIA A;  4AV7 A;  3CHR A;  3APD A;  1Y7Y A;  5D0Q D;  4TXR A;  3ONL A;  2IQC A;  4BTA A;  2BNO A;  4I2W A;  1BLX B;  1TN8 A;  3MJW A;  3BQO A;  4I6T A;  4DLO A;  1SW6 A;  5CCL A;  1Z3X A;  4YG1 A;  2MXD A;  3FUE A;  1HFA A;  3EJN A;  5EYL A;  3HIZ A;  1Q2Z A;  4ANU A;  2OOE A;  4JEH A;  1CJG A;  2IFU A;  2MOW A;  1BD8 A;  2V0P A;  4QFV A;  3ZYK A;  2FJR A;  5C2Y A;  4MBG A;  5KJK A;  3FYA A;  4J7W A;  4J6I A;  4FJZ A;  2PXL A;  4LNG A;  3FU6 A;  3Q7F A;  4N39 A;  5HS0 A;  1ZU2 A;  3NBN B;  3B7H A;  1P5Q A;  2VSN A;  1PRA A;  1KLX A;  4HOS A;  3D9M A;  3PZ2 A;  3UT4 A;  1E7V A;  4BSZ B;  5HQ8 A;  3ZPJ A;  4HRL A;  4U04 A;  5GAH i;  5EDS A;  4YVO A;  4WWO A;  5ENN A;  2KPJ A;  4GTV A;  2PL2 A;  4XE0 A;  1E8Y A;  3FYM A;  1V55 E;  4PU7 A;  5FIN A;  4GU5 A;  3CST A;  3TG4 A;  3SY2 A;  3EHR A;  2WUS R;  4WNF A;  3UKR G;  4YDW A;  3TWT A;  3EHQ A;  1OWL A;  4ANX A;  3MCX A;  2XGS A;  4Y6W A;  3PUJ A;  2ICT A;  5FZS A;  5DSX A;  3ASH A;  4WUY A;  4DPR A;  4BES A;  2PXD A;  1QP4 A;  4HNA D;  3PS6 A;  2XPZ A;  2FO7 A;  1EDU A;  2X6F A;  5T3R A;  5G55 A;  4NRH B;  2PXB A;  3PE5 A;  4X4F A;  2RD0 A;  3E34 A;  3UPV A;  2VSX E;  4FUL A;  5T4Y A;  2MHK A;  3MLF A;  2JCG A;  3D9J A;  4PS8 A;  3UM1 A;  2LSU A;  4NUR A;  3V79 K;  3RRU A;  4FU3 A;  4RQI A;  3KSQ A;  3MGB A;  3HZI B;  2CFU A;  2KZ8 A;  2QZA A;  4ABN A;  3RJV A;  5EYP F;  2ZGG A;  1A5E A;  3FTY A;  3CHQ A;  4L23 A;  3PZD A;  2WXG A;  4ER5 A;  2LYQ A;  4EK9 A;  3AS5 A;  3FFL A;  2DCP A;  3R7Q A;  4HLL A;  1A17 A;  5CHE E;  3V2O A;  4X8Q A;  1S70 B;  4Z58 A;  3JXC L;  2CFZ A;  4HVB A;  4KZ0 A;  4G24 A;  4A3T A;  2KEK A;  3CGH A;  4AXH A;  2OND A;  1NA0 A;  1K3Z D;  4MCT A;  4BFR A;  1NP7 A;  5BV1 A;  3TWW A;  2ETB A;  4X4I A;  1HH8 A;  2V8S E;  1OCZ E;  3L6A A;  4N2S A;  3F51 A;  3ZNG A;  2AUW A;  1KPS B;  2GRM A;  2P9P G;  1XNF A;  4B8C B;  1L5J A;  4ER3 A;  3FP3 A;  3QFI A;  4BSX A;  3ML9 A;  1NL4 A;  5ANR A;  3D9H A;  2OFY A;  5K98 B;  3BD1 A;  3ZN3 A;  4ILG A;  1D8D A;  2ZIS A;  3AU5 A;  3UUX A;  2A6C A;  3PXP A;  2YIN A;  1LF8 A;  3FH7 A;  2WXF A;  4XI9 A;  1SA5 A;  1JPL A;  3ESK A;  4U0S A;  1DCQ A;  4BEP A;  5GAG i;  2MEZ A;  3Q9U C;  5EIB E;  4AOF A;  3LXU X;  4EZI A;  4TRQ A;  1NER A;  2R03 A;  1TN7 A;  4YG7 B;  4HRA A;  2XRZ A;  3G2T A;  2BNM A;  2F8Y A;  3PVL A;  3NDB B;  4JPS A;  3PEV B;  1OCT C;  5EX0 A;  4DJA A;  3LQX A;  1FT1 A;  2EIM E;  2GW1 A;  4PH4 B;  3VK0 A;  3SHF A;  3SD5 A;  1JCQ A;  2DBA A;  4B0Z A;  1TNY A;  5DTQ A;  3U9W A;  2WB2 A;  4JHK A;  2I2O A;  3CEC A;  3FUK A;  4DX1 A;  4U95 D;  4OB4 A;  5CMW A;  4TV3 A;  1N11 A;  1H2U A;  1H6P A;  2X38 A;  2CRO A;  4BTB A;  2GRL A;  3E33 A;  3ISM C;  5FQ6 A;  1O1S A;  5EX3 A;  4ATZ D;  3OQM A;  4O1O A;  2XEH A;  4GA1 A;  4LER A;  1TYQ G;  1LD8 A;  2X6H A;  3CVL A;  3GYZ A;  2X6K A;  4JVS A;  2P9S G;  4TXQ A;  3UX4 A;  2JEK A;  4JC8 A;  5AQB A;  1PC2 A;  3LDZ A;  4YDO A;  2E0I A;  4PS3 A;  2J9Q A;  1GW6 A;  3RO3 A;  3PEU B;  4EEC A;  4MRU A;  4GMJ A;  4J8F A;  1L1M A;  4YDY A;  3D9K A;  4BWR A;  4GA2 A;  3G2S A;  3DRA A;  2NXP A;  3ZGQ A;  1TNU A;  3KZ3 A;  2WPV A;  4L2L A;  4WNG A;  1ADR A;  4HB5 A;  3LPZ A;  3QOW A;  1MHQ A;  3CVN A;  3RSE G;  5J90 A;  2B0O E;  3KD7 A;  3KXA A;  1X57 A;  4JB8 P;  3SFX A;  2PIJ A;  5FQ7 A;  4GPM A;  3AS4 A;  4F8D A;  3TG5 A;  2LYL A;  4Q2J A;  2Y1L E;  3KSL A;  3FTZ A;  5G05 J;  4NIK A;  1WM5 A;  3CR3 A;  1JUQ A;  1YYH A;  3PRZ A;  4IA8 A;  4D10 C;  4O60 A;  5LOZ A;  4FA6 A;  2LYK A;  4AM9 A;  2BED A;  2DZO A;  3P2B A;  2D5V A;  3CHM A;  4M7C A;  3SCF A;  1WDY A;  2IVB A;  1TJF A;  1ZAY A;  3LCA A;  2I1J A;  3ZHM A;  1FVH A;  1TNB A;  3HXC A;  1JWL A;  5ENR D;  4N3B A;  1N94 A;  3SBS A;  2KC7 A;  5ENO D;  4O8B A;  1IC8 A;  2BUG A;  1UXD A;  5BT1 A;  3QKY A;  4J0U A;  4WWN A;  4FLB A;  3ME5 A;  4XX5 A;  3AG3 E;  4UWH A;  4EQF A;  3MYV A;  5KBA A;  1SQM A;  2PUD A;  1KZP A;  3U64 A;  3B7R L;  3UQ3 A;  4U8Y D;  1H6O A;  4HFG A;  2RG8 A;  4H7X A;  2KXP C;  4C0M A;  2BTD A;  3PRE A;  4ER7 A;  3DSU A;  4CEM A;  3BS3 A;  4ILI A;  4I6R A;  2PXF A;  4U8H A;  4UI9 J;  4I6U A;  3LVQ E;  2PUA A;  3L9T A;  2QYJ A;  4KXK B;  5ENQ D;  1ZVV A;  1H2V C;  2JAB A;  3UIP C;  4O1P A;  4LG6 A;  1DCE A;  2LO6 A;  5CRV A;  4UI9 C;  3CQC B;  3TL5 A;  4EZK A;  2GRR B;  2L8N A;  1QPZ A;  5BXU A;  3R1F A;  3I5P A;  2M4H A;  4KZC A;  1IHB A;  4WND A;  2PXQ A;  1E90 A;  4R7L A;  1QP7 A;  2R02 A;  4Q96 A;  3DPD A;  2KEI A;  3PZ3 A;  4GTQ A;  1JFT A;  2BJC A;  1LCD A;  3NF1 A;  3ZYQ A;  3SFZ A;  3G0T A;  2VYI A;  5HKP A;  4N5Q A;  1PER L;  2C0M A;  2AXV A;  1QZX A;  5AAR A;  2H8R A;  2IOS A;  4IWR A;  3FUD A;  2L6B A;  1RIO A;  2XPY A;  4XKC A;  2XCJ A;  4CRW A;  5JHA A;  2H6H A;  4JEU A;  2AJA A;  2FFH A;  4UWK A;  5HI7 A;  1LD7 A;  5G2N A;  4L9P A;  2IJG X;  3GZ1 A;  4EPZ A;  5LFA A;  4XEI G;  3AG2 E;  2KM4 A;  4H7Y A;  4WAF A;  1EYH A;  2R17 C;  1JWG A;  4GB9 A;  4WVL A;  3V2X A;  5CCM A;  4RSY A;  4X4D A;  3IHY A;  4A63 B;  3RRM B;  4URK A;  1ZZB A;  3KS2 A;  5ARG A;  3VLF A;  3D1N I;  2LCV A;  1Y9Q A;  3NRO A;  2WM9 A;  4I6G A;  3FY4 A;  1OWN A;  2ZXW E;  4A1S A; 
#chains in the Genus database with same CATH homology
 3ULQ A;  4HOU A;  2WXJ A;  3RRU A;  3JQ1 A;  2P58 C;  4FU3 A;  4WNE A;  4XZ4 A;  1ZPQ A;  4GZD A;  1BPO A;  5BNW A;  3MGB A;  3HZI B;  2CFU A;  5A23 A;  3OXL A;  3HDX A;  3L16 A;  1CQT A;  2KZ8 A;  3L17 A;  3ZVV A;  4U07 A;  2LAH A;  3CVQ A;  2PUE A;  2MRI A;  3E4B A;  3OAW A;  4ABN A;  4GML A;  3RJV A;  3H5T A;  3NZU A;  4I1A A;  3CVX A;  2B5A A;  1OWO A;  2OR1 L;  4F7A A;  3JXD L;  5FWQ A;  3FTY A;  3CHQ A;  3S7F A;  5G04 C;  3SCG A;  3PZD A;  2WXG A;  3CVP A;  3Q5M A;  3AS5 A;  2LYQ A;  4GHJ A;  4GZC A;  3FFL A;  1HE8 A;  5T8I A;  2WIU B;  2DCP A;  4BY6 A;  5JHB A;  1X5B A;  3B13 A;  2Q7F A;  4GYY A;  3MV3 B;  5EKQ D;  5KJL A;  1R69 A;  1ZZ7 A;  2FEZ A;  3ASF A;  4LUN U;  1A17 A;  5CHE E;  3R7Q A;  2WXI A;  1XGW A;  4Z58 A;  3MKQ A;  3T8M A;  1MQS A;  3JXC L;  1HF0 A;  2CFZ A;  4FAD A;  4KZ0 A;  4JA7 A;  4HVB A;  4I6E A;  3UMV A;  4G24 A;  1UJK A;  2QY7 A;  4G11 A;  4A3T A;  2KEK A;  3TXM A;  4FJY A;  3CGH A;  4AXH A;  4CT4 A;  2L0T B;  4LCT A;  2OND A;  3U3W A;  1NA0 A;  2EQX A;  4HS2 A;  4U0U A;  3FTU A;  2R5S A;  4L1B A;  4UQX A;  2J4D A;  3LYA A;  3GW4 A;  2M63 A;  4HOR A;  4MCT A;  3FH8 A;  1WET A;  4BFR A;  1ZUG A;  1NP7 A;  5A7L A;  5BV1 A;  3FU0 A;  3PNT B;  5AJD A;  4PU8 A;  4RG9 A;  2X6I A;  4X4I A;  4DI3 A;  4Q69 A;  4N2Q A;  1GT0 C;  1HH8 A;  2AXU A;  2V8S E;  1E8W A;  4XIF A;  2PQN A;  3U66 A;  3L6A A;  4N2S A;  2WXK A;  5M72 A;  3F51 A;  3LEW A;  2AUW A;  4ANW A;  4BWR A;  2GRM A;  3IVP A;  1XNF A;  2MQK A;  4J1W A;  4PUC A;  4B8C B;  1L5J A;  4KVM A;  1JWF A;  1DVP A;  3FP3 A;  4BSX A;  3ML9 A;  1HG2 A;  3CK7 A;  5ANR A;  3OXF A;  5AIJ A;  4F53 A;  2OFY A;  2CHW A;  5K98 B;  3BD1 A;  3ZN3 A;  4AIF A;  1ZZC A;  2O4A A;  2XRY A;  1RZS A;  4ILG A;  2HSG A;  4IRU A;  5FTP A;  1RZR A;  3TAX A;  3AU5 A;  2A5U A;  4A1G A;  1IQU A;  3FUH A;  4OVU A;  2A6C A;  3UUX A;  4APO A;  3PXP A;  3CVY A;  1X2L A;  4I43 A;  2KCL A;  2YIN A;  4PS7 A;  3S2A A;  1LF8 A;  4GQM A;  3FH7 A;  2WXF A;  4J8S A;  3FU5 A;  4XI9 A;  2CHZ A;  1E7U A;  3HYM B;  4GCO A;  4N5C A;  1IYG A;  2UWJ G;  1JPL A;  3CEQ A;  4YVQ C;  2XSD C;  3ESK A;  3CVW A;  1WAO 1;  4OVV A;  1ELK A;  3MKR A;  2WXL A;  4IVZ A;  4ANV A;  4CDR A;  3CK9 A;  3HVE A;  4F1S A;  4U0S A;  1Z3Y A;  3ESL A;  4K0R A;  5FJY A;  4GZ5 A;  2MEZ A;  1WY6 A;  3TGO A;  3HHM A;  4I1O B;  2VGX A;  4I2Z A;  4AOF A;  4X4H A;  4B8A A;  3LXU X;  2IF4 A;  1QQB A;  4E6H A;  4N3A A;  2XPI A;  3MV2 B;  4TRQ A;  1UTX A;  1NER A;  3LY7 A;  3QOU A;  4PU3 C;  1BDH A;  4L2Y A;  4G25 A;  4EZL A;  5LCW J;  3SBT B;  4XKB A;  3T5V A;  3VLD A;  3LFP A;  2VJ8 A;  3ZW3 A;  1VPW A;  4GZ6 A;  4Z5D A;  2R59 A;  5LX8 A;  4YG7 B;  1NEQ A;  2X3M A;  3B7T A;  1Z6T A;  2VTB A;  2VSO E;  3S7B A;  1H0A A;  4MCX A;  2FBN A;  3GZ2 A;  4TUU A;  2XRZ A;  2YNQ A;  1OWP A;  4U63 A;  4LEU A;  3G2T A;  4OYS A;  2BNM A;  3D9N A;  5BV0 A;  2XHE A;  1AU7 A;  3NZS A;  2NC9 A;  3S7J A;  3URZ A;  4CGV A;  3RU0 A;  2JVL A;  3LY8 A;  5KCM A;  3PVL A;  1OUV A;  3FEX A;  1POU A;  3QB2 A;  3PEV B;  1OCT C;  4JPS A;  4GCN A;  5EX0 A;  4DJA A;  4CCA A;  4X4C A;  3RO2 A;  1UN9 A;  3I4G A;  3MKQ B;  4JW1 A;  4ACK A;  1QQA A;  1U3C A;  1U3D A;  3ZIM A;  3SCH A;  4X4G A;  2VQ2 A;  1PY1 A;  2GW1 A;  3O4Z A;  3RRN B;  4PH4 B;  4ATG A;  3VK0 A;  4ANX A;  2J09 A;  4Y42 A;  5BPP A;  3SHF A;  3SD5 A;  4IYP A;  1O4X A;  2XQ0 A;  2DBA A;  3PE3 A;  4JCX A;  2C0L A;  3B7U X;  4P29 A;  4B0Z A;  4UWL A;  4E85 A;  4F3V A;  1PAQ A;  3LIS A;  3AU4 A;  3BG1 B;  4MS6 A;  3U9W A;  3UT8 A;  1INZ A;  3QWW A;  4JHK A;  2I2O A;  2J08 A;  2WB2 A;  3CEC A;  4HLE A;  1WIZ A;  3CHO A;  3MX3 A;  4ACL A;  2WQ6 A;  3FUK A;  2PE5 A;  4OB4 A;  4EBA A;  2WXQ A;  2YHE A;  4CT0 A;  5BUZ A;  3QWV A;  4TV3 A;  5CMW A;  4YG4 A;  2FUL A;  1H2U A;  3L13 A;  2X38 A;  3KEZ A;  3I3N A;  2KCK A;  2CRO A;  1HF8 A;  4FHK A;  4KYO B;  4BTB A;  3RK6 A;  2GRL A;  1W3B A;  1VDY A;  1BDI A;  1IQR A;  1E8Z A;  3OXG A;  3EHN A;  5FQ6 A;  2LYJ A;  2HYZ A;  3BG0 B;  3O9X A;  4FC8 A;  4BX8 A;  4RVB A;  2HIN A;  3CKB A;  5EX3 A;  1PRU A;  3EUS A;  3OQM A;  3FWV A;  1PNR A;  4GA1 A;  1QQE A;  3FDH A;  3G2V A;  2J49 A;  2KZT A;  4IUL A;  3QQ6 A;  3FH5 A;  1UJJ A;  4LER A;  4JZY A;  5ARF A;  3F6W A;  2DIW A;  2X6H A;  1H2T C;  3CVL A;  3FUL A;  3GYZ A;  3PH0 C;  4Q94 A;  4AY5 A;  2X6K A;  2LSV A;  3GN5 A;  1JH9 A;  4JVS A;  3UX4 A;  2JEK A;  3CHP A;  4U0Z A;  4JC8 A;  3RKV A;  4NDW A;  1E96 B;  3PE4 A;  3TXN A;  1PC2 A;  1B0N A;  2I6H A;  1HZ4 A;  3JUI A;  1KT0 A;  3LDZ A;  4G26 A;  4I1M A;  2WXO A;  3OQN A;  3KAE A;  2E0I A;  2J07 A;  4WWP A;  4Z5C A;  1SQ8 A;  2OVF A;  4PS3 A;  2AWI A;  2J9Q A;  1GW6 A;  2EWT A;  3ZHE A;  2CG3 A;  3RO3 A;  2OVB A;  3PEU B;  2J4B A;  3HVE B;  4EEC A;  5KJN A;  4MRU A;  2O49 A;  4GMJ A;  4G23 A;  1L1M A;  4J8F A;  3D9K A;  3IV0 A;  4FHJ A;  4B94 A;  4GA2 A;  4Y6C A;  3SZ7 A;  3G2S A;  2CHX A;  2VGX B;  3QYX A;  2Y4U A;  3D3M A;  4JL0 A;  2GGF A;  5A7D B;  4BT9 A;  4CDN A;  2NXP A;  1UG3 A;  4G1T A;  3QC1 A;  2PM6 A;  3RZZ A;  2XCB A;  3EHM A;  3ZGQ A;  3ZYM A;  3KZ3 A;  2WPV A;  4N3C A;  5DBK A;  2ILR A;  3CVV A;  3I4R B;  4CGW A;  2WVI A;  4AJW A;  4L2L A;  4WNG A;  1ADR A;  2VTB B;  4X4B A;  1UW4 B;  2KAT A;  5E75 A;  3LPZ A;  2PUG A;  2XJ3 A;  2Y3A A;  2X6J A;  5FZQ A;  2XEV A;  2L0I A;  4JHJ A;  3GBF A;  1MHQ A;  5LP0 A;  3OP9 A;  1ZZ8 A;  3CVN A;  3R7R A;  2ZU6 B;  4UI9 K;  5J90 A;  2AVP A;  2PUF A;  1DW9 A;  3T5X A;  3ZFW A;  3DNV B;  3KD7 A;  4KBQ A;  2LYP A;  4HXI A;  1EF1 C;  3KXA A;  3FUI A;  1X57 A;  2PIJ A;  5FQ7 A;  3ASG A;  2WXR A;  1E8X A;  1DWK A;  2L49 A;  4I17 A;  2KCV A;  1YA0 A;  4YND A;  1EPU A;  3AS4 A;  3CQG B;  5BW8 C;  4F8D A;  2WXM A;  1OSL A;  4GYO A;  2LYR A;  2LYL A;  4YAR A;  3TG5 A;  3CSF A;  3FTZ A;  1ZZ6 A;  3IBE A;  5G05 J;  5C1D A;  4KT6 B;  3SF4 A;  1WM5 A;  4A55 A;  1FVF A;  4JCY A;  3IHV A;  1Y8M A;  1FCH A;  1JUQ A;  3CR3 A;  2OV8 A;  3PRZ A;  3QWP A;  4G2V A;  5FZR A;  2FF4 A;  4DLQ A;  2JLB A;  3G2W A;  4Z59 A;  2I9C A;  4EZJ A;  1PRV A;  4IA8 A;  1HX8 A;  4D10 C;  4DK5 A;  3CHS A;  5LOZ A;  4FA6 A;  2ION A;  3CLJ A;  4KMO A;  2L9B A;  2LYS A;  4EBA G;  2R63 A;  2LYK A;  2WQH A;  3P1U A;  4AM9 A;  1HU3 A;  4C0E A;  3P2B A;  4FBI A;  3MA5 A;  4JQD A;  2I1K A;  3OMT A;  2D5V A;  4GAA A;  1NZN A;  3EIQ C;  3KJX A;  3CHM A;  3VLE A;  4FN3 A;  3SCF A;  3JYS A;  2IVB A;  1TJF A;  1ZAY A;  3LCA A;  2I1J A;  3UFD A;  3QNK A;  2NSZ A;  2KZT B;  1XWR A;  3ZHM A;  3QDN A;  4JHR A;  5FQ4 A;  5FQ8 A;  5KJM A;  1FVH A;  3OQO A;  3FTS A;  3IKO B;  3QJZ A;  3L22 A;  4HOQ A;  3FUJ A;  3K9I A;  1JWL A;  2HO1 A;  4N3B A;  3GN5 B;  1NA3 A;  3QK0 A;  3SBS A;  3G7D A;  4B89 A;  3FMY A;  3DBS A;  3QF3 A;  2KC7 A;  3U4T A;  3ONK A;  3PNL B;  1QP0 A;  4I8T A;  1DNP A;  4O8B A;  5LCW C;  2CSF A;  5J08 A;  3Q15 A;  1H6K A;  2QFC A;  4ME2 A;  4XI0 A;  3ZXS A;  1S7E A;  1IC8 A;  2BUG A;  1UXD A;  2VSY A;  5BT1 A;  2IOL A;  2ICP A;  1N52 A;  3ZHE B;  2UY1 A;  3PDN A;  1TEZ A;  5JJ6 A;  5JJ7 A;  4GPK A;  5JJT A;  2V4L A;  2O38 A;  3FEY A;  3QKY A;  2L6J A;  3ZKC A;  3APC A;  3FTW A;  3FU3 A;  2XGO A;  3MEK A;  4FLB A;  4J0U A;  4RG6 A;  4WWN A;  1ELW A;  1IHG A;  4J8E A;  4XX5 A;  3CVU A;  3FHE A;  1R63 A;  2WXH A;  4L7T A;  4J1X A;  3AS8 A;  4UWH A;  4EQF A;  3MYV A;  3OTN A;  1SQM A;  2PUD A;  3U64 A;  2YHC A;  3B7R L;  4NAC A;  4V3I A;  1TJC A;  3D9O A;  3LY9 A;  3CIA A;  3RIB A;  3UQ3 A;  4AV7 A;  1LCC A;  3CHR A;  3APD A;  1Y7Y A;  4HFG A;  5D0Q D;  2LAI A;  2RG8 A;  4Z5H A;  1S0P A;  4PU4 C;  1ELR A;  3ONL A;  2BNN A;  4H7X A;  3PUK A;  2BTD A;  2IQC A;  3ENE A;  3PRE A;  3QAQ A;  3TJP A;  4BTA A;  4C0M A;  2BNO A;  3L08 A;  4I2W A;  3Q4A B;  4CEM A;  3JXB C;  3BS3 A;  4ILH B;  3MJW A;  1KT1 A;  4ILI A;  4GYW A;  5D0O D;  1ZZ9 A;  4I6T A;  4DLO A;  5CCL A;  3LS8 A;  5AEN A;  4PDX A;  4I6R A;  1Z3X A;  3ASD A;  3NQP A;  5AYW D;  4YG1 A;  3QWG A;  3FUE A;  1HFA A;  4U8H A;  4AP2 A;  4UI9 J;  4AEZ C;  3SNX A;  1Y6I A;  3VTY A;  3EJN A;  3SGH A;  4I6U A;  2EF8 A;  2WXN A;  1OWM A;  3LVQ E;  2V5F A;  1LMB 3;  3HIZ A;  4M3O A;  2PPX A;  2WMN A;  4ANU A;  2OOE A;  3ML8 A;  2PUA A;  4JEH A;  1CJG A;  1RPE L;  2IFU A;  4KXK B;  2MOW A;  3ZEF A;  1UXC A;  2AW6 A;  1ZVV A;  2EBY A;  1H2V C;  2V0P A;  2WMO A;  4QFV A;  5FT9 A;  3ZYK A;  2FJR A;  1SZA A;  5C2Y A;  3IEG A;  4HOT A;  2IU1 A;  5KJK A;  3FYA A;  4I9C A;  4J6I A;  3EIJ A;  4FJZ A;  3FU6 A;  2IV1 A;  3LVR E;  2LO6 A;  4N39 A;  3ZRH A;  4UWG A;  5A6C A;  2Y4T A;  2R1J L;  1ZU2 A;  5E76 A;  3SI5 A;  3N71 A;  3B7H A;  1LQC A;  3B7S A;  3GZS A;  1P5Q A;  4UI9 C;  2VSN A;  1PRA A;  1EFA A;  1KLX A;  4KVO A;  4HOS A;  3L54 A;  3CQC B;  3JCK C;  3TL5 A;  3D9M A;  4K03 A;  2XI8 A;  3UT4 A;  4EZK A;  1E7V A;  5HQ8 A;  2IVQ A;  3S8Q A;  2L8N A;  1QPZ A;  3ZPJ A;  3G2U A;  2XIU A;  3R1F A;  3I5P A;  4KZC A;  4U04 A;  5AJL A;  4WND A;  3FTV A;  4BT8 A;  2GZU A;  3O48 A;  2HM8 A;  3BEE A;  4IN3 B;  5EDS A;  3LJ3 A;  1E90 A;  4BX9 A;  4R7L A;  4UQY A;  4YVO A;  2PZI A;  1JFS A;  3ZHI A;  1QP7 A;  4WWO A;  4AVX A;  5ENN A;  4MLP A;  1LLI A;  3APF A;  2KPJ A;  1HG5 A;  2A4Z A;  4FP7 A;  1E3O C;  4Q96 A;  1B89 A;  2PL2 A;  2KEI A;  2UY1 B;  1E8Y A;  3DPD A;  2PM7 A;  3FYM A;  4XE0 A;  1RZR D;  4PU7 A;  3R9A B;  1JFT A;  2BJC A;  4GU5 A;  3CST A;  1LCD A;  1SZ9 A;  3NF1 A;  3TG4 A;  3VTX A;  4JXT A;  4MKT A;  3C98 A;  3ZYQ A;  2WUS R;  4WNF A;  1WH8 A;  3SFZ A;  4AY6 A;  4J8D A;  4CDM A;  4I6J A;  2VYI A;  2IU7 A;  1PER L;  3EDT B;  2C0M A;  2AXV A;  3F52 A;  2H8R A;  2IOS A;  4IWR A;  1OWL A;  1ZS4 A;  1RIO A;  3CRO L;  2C2L A;  4YBA A;  2WXP A;  2XPY A;  3FUD A;  2PUC A;  3MCX A;  4XKC A;  2XGS A;  3JQ0 A;  1H19 A;  4Y6W A;  2IUO A;  3L1P A;  3PUJ A;  3BDN A;  2ICT A;  5DIZ A;  5FZS A;  1YSE A;  3D9I A;  3UT7 A;  3ASH A;  2XCJ A;  4WUY A;  4CRW A;  4DI4 A;  5JHA A;  3D9P A;  3CLC A;  4JEU A;  3FUN A;  5G05 C;  1HO8 A;  4DPR A;  3WXX A;  4A3V A;  1QNF A;  4UWK A;  3CK8 A;  5HI7 A;  1QP4 A;  5G2N A;  2WQ7 A;  2IJG X;  3GZ1 A;  3QAR A;  4EPZ A;  5LFA A;  2VGY A;  3CV0 A;  3Q47 B;  4W9R A;  2LNI A;  2XPZ A;  3PS6 A;  2FO7 A;  1EDU A;  1ZBP A;  2KM4 A;  2X6F A;  5T3R A;  2KEJ A;  4H7Y A;  1UN8 A;  3CKC A;  4WAF A;  1EYH A;  4FLH A;  4NRH B;  5G55 A;  2R17 C;  1JWG A;  4GB9 A;  4L23 A;  2PUB A;  4C9B B;  4I9E A;  4O6F A;  4LRZ A;  5ANL A;  2FI7 A;  3Q49 B;  4APF A;  4NQ0 A;  3ZYL A;  5CCM A;  4RSY A;  1WH6 A;  4X4D A;  3IHY A;  3S7D A;  5CMY A;  3RRM B;  4X4F A;  2CG2 A;  2RD0 A;  4UQZ A;  4URK A;  3TRB A;  1ZZB A;  4UWF A;  1HS6 A;  3UPV A;  2BF0 X;  2YQ8 A;  3KS2 A;  2VSX E;  1QZ2 A;  2IVG A;  4FUL A;  4JA9 A;  3D1N I;  5ARG A;  5T4Y A;  2MHK A;  3VLF A;  3MZL B;  2LCV A;  3FTX A;  3MLF A;  5G04 J;  2JCG A;  1Y9Q A;  3D9J A;  1HXI A;  4PS8 A;  3D9L A;  2XCC A;  3FUF A;  2E2E A;  2XGM A;  4X4E A;  1N54 A;  2PQR A;  2AXZ A;  2LSU A;  4GZ3 A;  4GA0 A;  2WM9 A;  2HR2 A;  3G5G A;  3FUM A;  4I6G A;  4NUR A;  3FY4 A;  3LKU A;  1OWN A;  4A1S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...