2AW6A

Structure of a bacterial peptide pheromone/receptor complex and its mechanism of gene regulation
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
287
structure length
287
Chain Sequence
MFKIGSVLKQIRQELNYHQIDLYSGIMSKSVYIKVEADSRPISVEELSKFSERLGVNFFEILNRAGMNTKSVNETGKEKLLISKIFTNPDLFDKNFQRIEPKRLTSLQYFSIYLGYISIAHHYNIEVPTFNKTITSDLKHLYDKRTTFFGIDYEIVSNLLNVLPYEEVSSIIKPMYPIVDSFGKDYDLTIQTVLKNALTISIMNRNLKEAQYYINQFEHLKTIKNISINGYYDLEINYLKQIYQFLTDKNIDSYLNAVNIINIFKIIGKEDIHRSLVEELTKISAKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of peptide sex pheromone receptor PrgX and PrgX/pheromone complexes and regulation of conjugation in Enterococcus faecalis.
pubmed doi rcsb
source organism Enterococcus faecalis
molecule tags Transcription
molecule keywords PrgX
total genus 103
structure length 287
sequence length 287
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01381 HTH_3 Helix-turn-helix
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 2aw6A01
1.25.40.400 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2aw6A02
3CROL 2EBYA 4JCYA 1JH9A 1YSEA 4MCXA 3JXDL 2O49A 3OMTA 4I6RA 1LLIA 1WH6A 1DWKA 2HINA 2B5AA 2IVGA 2LYPA 4YG7B 3D1NI 1ZS4A 1UTXA 4IA8A 3G5GA 1JFSA 2O4AA 2IU7A 4FBIA 3SCFA 4X4BA 2AXZA 3RZZA 4I6UA 4O8BA 1RPEL 2FJRA 4OB4A 1QPZA 1RIOA 2OR1L 1NERA 1POUA 2WUSR 4JQDA 2AUWA 1WH8A 1PRAA 2LYRA 4GHJA 1R69A 3R1FA 3SCHA 2KEJA 2CSFA 3BS3A 4X4GA 2D5VA 2KEKA 3ZHIA 1PRUA 2JCGA 2LYLA 3PXPA 1Y9QA 2R63A 2WIUB 3H5TA 1ZAYA 2PUDA 1RZSA 3QF3A 4Y42A 4Z58A 4IVZA 1S7EA 2KPJA 3L1PA 1WIZA 3KXAA 1O4XA 2LYKA 4MCTA 1AU7A 1CQTA 3F52A 3QQ6A 5K98B 1QP0A 4YG1A 2PUGA 3LFPA 3B7HA 4X4FA 2XI8A 3OQOA 3GBFA 4IWRA 2O38A 3FMYA 1X57A 2IUOA 4X4DA 2EWTA 3HZIB 4I8TA 4FN3A 2AW6A 1OCTC 3S8QA 2JVLA 3LISA 4Z5CA 2XIUA 1X2LA 1IC8A 3GN5B 3OQNA 4I6TA 1BDIA 3DNVB 3MLFA 3OP9A 3QWGA 4YARA 1Y7YA 1E3OC 3KZ3A 2PUCA 1XWRA 4YG4A 2MQKA 2XCJA 2IVQA 3ZKCA 3FYAA 2GRMA 3BD1A 3TRBA 2LYSA 1PERL 3VK0A 2BNMA 3EUSA 5A7LA 1CJGA 4X4CA 2PE5A 2L49A 1EFAA 2BJCA 1ZVVA 2EF8A 2LYQA 4J1WA 2BNOA 1ZZ9A 2LCVA 2GZUA 2KZ8A 3BDNA 4Z59A 1ZZCA 1R63A 1UXDA 3F51A 3CECA 1HF0A 2PPXA 4YBAA 1ADRA 3CLCA 2LYJA 2AXUA 2A6CA 1ZZ8A 2AXVA 2XJ3A 2R1JL 1ZZBA 1JWLA 2IV1A 3GN5A 1QP4A 4PU3C 2ICTA 2BNNA 1ZZ6A 1SQ8A 4PU7A 1QP7A 1QQAA 1L1MA 3ZHMA 4Z5DA 3KJXA 3OQMA 4X4IA 2H8RA 3IVPA 2CROA 1LCDA 4PU8A 1UXCA 4PU4C 4Z5HA 3JXCL 3U3WA 2XSDC 1OSLA 3FYMA 2OFYA 2PIJA 1NEQA 1B0NA 1JFTA 4JCXA 1VPWA 3UFDA 3F6WA 1PNRA 1WETA 2PUBA 4NDWA 1PRVA 4F8DA 2PUAA 2AWIA 1GT0C 3QYXA 2L8NA 2PUEA 1LQCA 1LMB3 1ZPQA 3O9XA 1ZUGA 1RZRD 2IVBA 1LCCA 2MEZA 2GRLA 3JXBC 1DW9A 1BDHA 2ICPA 2KEIA 1RZRA 4GQMA 4X4HA 3G7DA 4X4EA 1QQBA 2HSGA 4J1XA 3SCGA 1ZZ7A 2PUFA
chains in the Genus database with same CATH superfamily
3CROL 1WG0A 3Q47B 4U63A 2KXPC 3FTZA 2IVGA 3D1NI 3PRZA 1E90A 1EDUA 4N5CA 2IU7A 3SCFA 2R17C 1RZ4A 1Y6IA 3C3OA 3UX4A 2CSFA 3NOGD 1ELWA 1ZAYA 3KEAA 4Y42A 3UXGA 4JC8A 1S7EA 3DEOA 3QDNA 2HE0A 3U64A 5LFAA 3E4BA 4HOQA 5K98B 2HM8A 3C72A 2DIWA 4O1OA 3JQ0A 4JHJA 3FU5A 4CT4A 3GZCA 2L9BA 2XGOA 3QWGA 4ILHB 3C98A 4JW1A 3FTSA 4HQDA 2XCJA 3AS5A 4XX5A 2PE5A 3UKUG 3L22A 1NL4A 4RQIA 3LS8A 5H7PA 2WB2A 1L5JA 3ZNGA 2Q7FA 3CIAA 2WXNA 2DYRE 3Q79A 2OCCE 4WVLA 5KJLA 3D9OA 4K5CA 3UI2A 3C3QA 3GZDC 3ZYLA 1N0QA 1OXJA 1Y8MA 2CHXA 4U8VD 5AQ9A 3FUHA 3DXKG 3LEWA 2LSVA 3RAUA 3TWTA 3NOCD 2ZIRA 4XKCA 3FH7A 1H2VC 3SFXA 1PY1A 3QYXA 3G2VA 1HU3A 1UW4B 4KVOA 1TN6A 3AAAC 4G2VA 3UM3A 1ZZ7A 4WNFA 4I1AA 2PNNA 3EDTB 4JEUA 3FH8A 4CEMA 2MXDA 4IA8A 3CHPA 3HDXA 2J49A 2XEEA 4FBIA 2V4HC 2XS1A 4O8BA 2MOWA 5G04C 3Q9UC 1O5MA 3AG2E 5CMYA 3RRUA 3ZXSA 1MX6A 4K5AB 3PUKA 3QJZA 5T8IA 4DLQA 3I4RB 3S7FA 4PH4B 2V5QC 2KPJA 3ESLA 3UT8A 3WG7E 4X4FA 4Q96A 3GZSA 4MKTA 3L13A 5FZQA 2OV8A 4RG9A 1UJJA 1N95A 4CGWA 3I3NA 3PZDA 1U3DA 1Y7YA 3DSWA 3RO2A 1XWRA 2YHEA 4Q2JA 2IVQA 5FINA 1UN9A 4PS8A 4JPSA 1HQ1A 2PXDA 3G2TA 4PS3A 1QZ2A 5FZSA 5J90A 3CSTA 1E8WA 2X6HA 1UN8A 4WUYA 5B1BE 4DI4A 1S70B 2LYJA 2AXUA 1LF8A 3QAQA 3CVLA 4ATZD 2NXPA 1D8EA 2EILE 4X4IA 3KAEA 5LP0A 1FVHA 4ACKA 2UWJG 3MEKA 4DJAA 3DSSA 3EHQA 4GMJA 5CEAA 1JFTA 3SR4A 1NZNA 4JCXA 4PUCA 5EILA 3OWQA 4CDNA 3B7BA 2PUAA 2ODRD 4G26A 4J7WA 4GTOA 3AG3E 1AWCB 3JUEA 3HRAA 5G05J 3D9MA 2X6IA 3DBSA 1JH9A 1A17A 1LLIA 4AXHA 1MX4A 2VSNA 5JUWA 2XZDG 1JFSA 2O4AA 5ANLA 2ZXWE 1E7VA 4EQFA 5C2YA 3QWWA 2C2LA 2CFZA 4WNEA 4A1SA 4MBGA 4CDRA 1DCEA 2M63A 3B7RL 5BUZA 4LRZA 5CRVA 2JLBA 2QYJA 2F8XK 3G0TA 1NP7A 4XEIG 2IUOA 1OCZE 1IXVA 4PS7A 3L6AA 4G1TA 3S8QA 5LOZA 3CKCA 2PXQA 3D9IA 4CYMD 3PEVB 5LCWJ 3SF4A 2X6KA 3F6QA 2OEWA 5CHEE 4DPRA 2PUCA 3ZYQA 2IO2C 3KSLA 2ETBA 1IKND 3MA5A 4JXTA 3R09A 3FP3A 4BX9A 1ZZ9A 4BETA 1YMPA 1AP7A 4KXKB 2GRRB 3CECA 2XENA 4TRQA 2GRPB 1DCQA 4AM9A 1H19A 1KZOA 2Y0BG 4FLHA 2LUHA 3U3WA 1BI8B 1N9AA 2PIJA 4WNDA 1KT1A 2GRQB 4Y6WA 5D0OD 1GT0C 1JPLA 5HRYA 2P58C 2M4HA 2KEIA 4GQMA 4X4HA 1P5QA 2FULA 2PUFA 3U66A 2O49A 4I6RA 3MYVA 3DEPA 1OCOE 1WAO1 2CG2A 3EHMA 1RW2A 3UKRG 1FPPA 4C9BB 1SW6A 1POUA 3I5PA 4IYPA 3V79K 2VTBA 3ZHIA 2PUDA 2LYLA 3IBEA 2R63A 1OT8A 3S7BA 2WXPA 3GZDA 4YG1A 3KD7A 4AIFA 4GTVA 4EBAG 2LXLA 4C0EA 2I6HA 3MGBA 4BSZB 3PS6A 4HLLA 3CVWA 3SCGA 1E3OC 2EIJE 1EPUA 3CVNA 1MFQC 4UWLA 3FYAA 2XPZA 4DI3A 3VK0A 4DRXE 4J0UA 1O1TA 3ZFWA 2PM7A 4YDEA 3TFLA 1HF0A 3FHEA 4L23A 1ADRA 3LY8A 4OAVB 5AARA 4XI9A 5FQ6A 1SZ9A 5D2MC 4EK9A 5G55A 3UT7A 2VGYA 4I17A 3ONKA 3GYZA 3IVPA 1MJ0A 1UXCA 3ASNE 2KZTB 5DTMA 2WXOA 1B0NA 1EF1C 3IKOB 3TJPA 1VPWA 2J4DA 2ETAA 3PE4A 3TXMA 3CHSA 1LQCA 3ZIMA 5T4YA 2VSYA 3ABLE 3CV0A 5KNGA 2LLVA 2XXAA 4P29A 5ANRA 5DRYA 1ELRA 2KATA 3J5PA 2HSGA 3Q75A 4HI8A 3FY4A 2HR2A 4WNGA 4LG6A 2ZGDA 1Z5SC 2DZNA 4BT9A 5G04J 4G8LA 2B5AA 3PH0C 3Q7AA 3ONLA 4A63B 5ENRD 2L6BA 4X4BA 4YNDA 2KC7A 4APFA 4GCOA 4F1PA 1QPZA 3Q15A 4ER6A 2DYSE 2D5VA 3ABME 4RLYA 2P9SG 2YHCA 4UWHA 3DPYA 4ILIA 3VLDA 4AJWA 5BT1A 4GPKA 1QP0A 2HFZA 4GMRA 3QARA 2E0IA 5CCMA 2XI8A 3IV0A 3MJWA 4I8TA 4GTRA 4ER0A 4XZ4A 5T3RA 4EBAA 4GZ5A 5HQ8A 1A5EA 4U96D 4JVSA 4I6TA 1GW6A 4ZFHA 1OCRE 3E32A 3ZKCA 3FFLA 3E33A 4TUMA 4U95D 2V0PA 2BF0X 3HIZA 3RRNB 1SA4A 2WQ6A 1HO8A 3CVVA 4U0SA 3ME5A 3DSVA 3CSFA 1OWMA 2R1JL 3MEJA 3JUIA 1QP4A 1HX8A 3UQ3A 5J08A 2Y4UA 2WXRA 3R7RA 2WVIA 4FJYA 3L17A 2BUGA 3PZ2A 1O1SA 3F6WA 1PNRA 1WETA 3EHNA 2HYZA 3KL4A 2P9LG 2WMOA 1LMB3 2VTBB 4IULA 3ASFA 4EKIA 2GRLA 2IFUA 5HI7A 3ZHEB 4DX2A 5ARFA 1QQBA 3CHQA 3LCAA 4O6FA 4GTTA 5JA4D 5AENA 3OMTA 5EN5D 1MQSA 1DWKA 4URKA 1H6KA 3OAWA 3TWQA 3ZKJA 3MKQA 4JQDA 1QB2A 3ENEA 3QOWA 3Q78A 1BI7B 2KEKA 3MCXA 5CRUA 2P2CP 1ZU2A 5AN8A 4BEPA 3ZGQA 4ER7A 3UINC 3PUJA 1K1BA 3L16A 1X57A 2HCNA 5JJTA 4F53A 3SHFA 3BEEA 4KZCA 4Z5CA 3TAXA 5BW8C 3ZXPA 2F8YA 4L9PA 3LXUX 1N54A 3C3RA 2XRZA 3LQXA 3BG0B 4TXQA 1CJGA 1WM5A 2UY1B 3SQVA 4J1WA 2GZUA 4ZHBA 3HXCA 1OY3D 3SGHA 1QBQA 2A6CA 2XHEA 2XJ3A 2J08A 2VGXB 2H6IA 3GN5A 1N4PA 3Q49B 3QB2A 4JD2G 3TELA 5ENTD 1NW3A 3TWUA 3MX3A 4HS2A 3EIJA 3ZN3A 4ANVA 1U3CA 2QZAA 2L0IA 3URZA 5CMWA 1S63A 3ZYKA 3FU0A 1H6PA 1LCCA 1TYQG 1Z6TA 4UI9C 4LNUD 3EUVA 3BG1B 2EBYA 2J7UA 5D0QD 3KSQA 3PE5A 3G5GA 5D66A 5GAHi 3LJNA 2MYOA 3LVQE 2AXZA 3CHOA 3KS2A 2R59A 5A7DB 5KNHD 2KEJA 4CZ2D 4X4GA 1BU9A 2JCGA 2HO1A 3L1PA 4AY6A 2ETCA 4GTMA 4APOA 4HORA 3QFIA 3GBFA 3FUDA 4IN3B 2E2EA 2YINA 4Y6CA 4DE9A 4IRUA 4I1OB 3SO8A 3FH5A 4EZLA 3APCA 4YVOA 3UM1A 1PERL 4JA7A 1EFAA 2J07A 2XXQA 2VGEA 3NB2A 4Z59A 1ZZCA 5FQ8A 4KMOA 4LNGA 1Q2ZA 5HS0A 3T5XA 4HXIA 1N4QA 2CG3A 4W9RA 2I1JA 2WPVA 3ZHMA 2IEJA 5A23A 2WM9A 4Z5HA 4PU4C 1OUVA 4G23A 1INZA 3CK9A 3JXIA 3S7DA 1KZPA 2ZU6B 2OFYA 1KT0A 3V2OA 2PXTA 5DTQA 5JHAA 4FP7A 1E8XA 5FT9A 1V54E 2KCVA 5ENPD 5ENNA 2VGXA 2WXGA 3JXBC 3CK7A 4X4EA 1JUQA 2YQ8A 4C0MA 1ZS4A 3FUMA 4JZYA 3I4GA 1KLXA 3SY2A 4RVBA 3LVRE 2KM4A 4EZJA 5AIJA 5EIBE 2WXJA 3HVEB 2X3MA 1NA3A 2VJ8A 1R69A 2X6JA 3SCHA 2PQRA 5ARGA 3ZPJA 2BEDA 3QOXA 5JJ7A 3IHYA 3H5TA 2MRIA 3RO3A 3X2QE 4IVZA 4NURA 5DT2A 4G8KA 3U4TA 3FEXA 3OTNA 1S0PA 2EWTA 1TNOA 3G2WA 3UPVA 4GZCA 2VSOE 3QWVA 3D9JA 1NI1A 2LLWA 2MQKA 2I2OA 3AG4E 3BD1A 3EUSA 3MKQB 3T9KA 2V3CC 3JQ1A 3ULYA 1HG5A 4Z68A 2XCCA 4I2ZA 2Y1LE 3UIPC 3CVXA 4J8YA 4U0UA 4KVMA 1SVXA 3DSTA 3APFA 3APDA 4PU3C 2FBNA 3DRAA 4AOFA 1N4RA 2LAIA 3UT4A 3FUNA 4A3TA 5KJMA 3B7UX 4X8QA 2PM6A 1KPSB 2DVWA 1HH8A 2A5UA 4U7EB 3R9AB 4EECA 3FYMA 2PXEA 1NEQA 3O4ZA 5EKQD 3QOUA 4TUUA 4L1BA 4HLEA 2WXFA 4F8DA 2OVFA 1TJFA 1ZUGA 1BPOA 1RZRD 3Q7FA 2IVBA 4DX7D 4J8SA 2KCLA 2XGMA 4QQIA 2LAHA 4H7YA 3PNLB 4J1XA 3TXNA 2WQ7A 3NDBB 3EU9A 3SBTB 3B95A 1TR4A 4MLPA 1S64A 2FO1E 5KJKA 2DBAA 3DPDA 2QYUA 4GPMA 2F0YA 3SNXA 1WH8A 4ER3A 1PRUA 4LCTA 4DE8A 3QKYA 1FT2A 1O4XA 3CK8A 2NYJA 2EINE 3F52A 4BESA 2R05A 3TGOA 5KBAA 2J7WA 2O38A 3CQCB 4AV7A 2NC9A 4PDXA 4CDMA 3V2XA 5CEDB 2LNMA 5AJDA 4DK5A 5AJLA 1TJCA 4BTAA 5FZRA 2PXPA 2XCBA 3NQPA 3E30A 3R7QA 4X4CA 4ANXA 5FWQA 1R63A 4OYSA 1TEZA 3ABKE 3IHVA 3RIBA 4G25A 2Y69E 4BY6A 1UOHA 1TNBA 3FUIA 3L9TA 3SI5A 3FTUA 2IV1A 4HVBA 2IY0C 4PU8A 4JA9A 3UFDA 4GB9A 1PRVA 3CLJA 2WQHA 4MRUA 4ANUA 3DWLG 1DW9A 5DIZA 4N3AA 3ZYMA 3VLEA 4XI0A 1YSEA 4U8HA 2GW1A 3EIQC 2WXLA 4LEUA 3FTXA 4GU5A 2XXPA 4K0RA 4RSYA 4TV3A 1RPEL 2FJRA 1IHBA 3PZ1A 3U9WA 3D3MA 4BWRA 2LYRA 4B8CB 2P9KG 4UI9K 3RK6A 1TN8A 3TWVA 2PUGA 3T8MA 3OQOA 3G2SA 3D9HA 5B3SE 2PXKA 2JVLA 3LDZA 3TWXA 4BT8A 3JYSA 4A55A 2PXUA 4GZ6A 1TN7A 4CT0A 4N2QA 4GA1A 5EYPF 2OEVA 2GRNB 2DZOA 4M7CA 3NZLA 2R5SA 3UMVA 3LY9A 2LYSA 5LCWC 2EF8A 4HOSA 2BNOA 3DSXA 2LCVA 4B93B 5LX8A 4GA2A 3F51A 3UIOC 4ACLA 2VEOA 1ZZ8A 3DXMG 2PXFA 1W3BA 1SQ8A 3JXJA 3LY7A 3MV2B 1E8ZA 4AVXA 4MS6A 2P9UG 5ENQD 2DWZA 1B89A 3ZPXA 2PUEA 3FU3A 1WDYA 5IY5E 1ZPQA 2KBXA 3UTMA 3DSUA 3ASGA 4K5BA 5AYWD 2XQ0A 2EIME 3SBSA 1BDHA 4ER5A 3G7DA 2VYIA 3JCKC 4Z58A 5FQ7A 4JCYA 3FTYA 3SD5A 1TNZA 4MCXA 3P1UA 5E76A 1SA5A 3C5RA 3O48A 3QWPA 3RU0A 4N2SA 1WH6A 4U8YD 4J8EA 1OWLA 4HB5A 3HVEA 3RZZA 1Z3YA 5CECB 4OB4A 3B7SA 3CVPA 4FULA 2IOSA 3R1FA 3PVLA 2XPYA 2A5EA 2AJAA 5EIDA 3W9GA 4HRLA 3QQ6A 2P9IG 3J5QB 2H6GA 3L82A 1OCTC 4D10C 4GCNA 3UM0A 2RD0A 3OQNA 2NSZA 4RG6A 4R7LA 2BKGA 2A4ZA 3ML8A 5B1AE 1HFAA 4B94A 1LD8A 4LUNU 2WXQA 2GRMA 5BXOA 3D9NA 1HF8A 3E34A 2WXHA 2IO3C 2LO6A 2RFMA 1N4SA 2FI7A 5EYLA 5JMND 2J09A 3ZU7B 1SZAA 2I1KA 2J8SD 1G3NB 1QQAA 5DRTA 3ZUVB 5KWDA 2H8RA 1N52A 1N0RA 3CGHA 1D8DA 2XSDC 2I9CA 1E8YA 5BPPA 4AP2A 3B13A 3M9LA 5G05C 2L8NA 3O9XA 3IXEA 3N71A 2XEVA 4I43A 3CR3A 4HRMB 3B7TA 2YNQA 4HBDA 3AU4A 2RFAA 5AQAA 4FHKA 4CGVA 3L08A 4UWGA 4N3CA 3E37A 3TG4A 2PXVA 4HOTA 3TG5A 2HCSA 2ZGGA 3VTYA 1NERA 5DBKA 1VDYA 4GHJA 4K03A 2EIKE 3ZEFA 4F7AA 2UY1A 3FTWA 3AS4A 2OOEA 3S2AA 2WIUB 1RZSA 3AG1E 5ITZF 2C0MA 1AU7A 2LYKA 3P2BA 1LD7A 1MZCA 2R2LA 3K9IA 3HXEA 2XEHA 3QNKA 3Q4AB 4IWRA 4M3OA 4NACA 2L0TB 4FN3A 3CVQA 4HFGA 4TXPA 4BTBA 4AY5A 3AS8A 1IQRA 4EKGA 4ANWA 4V3IA 3MKRA 4KZ0A 1HG2A 4FADA 3A9YA 3KZ3A 2V5FA 3ZRHA 5JJ6A 3IEGA 3DM5A 4GTSA 2L49A 1QYMA 2BJCA 2LYQA 1FVFA 1H2UA 3SFZA 3BDNA 4QFVA 4ME2A 1UXDA 3PZ4A 4EPZA 3AJIA 4GYOA 1LTXA 4UQZA 1E7UA 4I6EA 5FQ4A 3UWPA 4NIKA 4FU3A 1ZBPA 5EX0A 3CVUA 3ASHA 2CFUA 4EZIA 3V30A 3BU8A 4JHRA 3R9MA 3UUXA 1OWPA 3GZ1A 1WY6A 5ENSD 2C0LA 4G24A 2FF4A 2H6FA 5BXUA 1QNFA 3ULEG 1JWGA 4HI9A 2ONDA 4L2YA 4N39A 3L54A 2HINA 4LSZE 2LYPA 3V31A 3ASDA 3HYMB 3PE3A 1OWNA 4WWPA 3FUJA 5G2NA 4Q94A 1JCSA 3TWSA 4BX8A 4KBQA 3OXGA 1Y9QA 1U2VG 1DC2A 2EQXA 3TWRA 3VLFA 3ZHEA 3MV3B 1HXIA 1CQTA 3LKUA 1QQEA 3FWVA 4I1MA 3ULQA 2V8SE 4YDWA 1K8KG 3FMYA 2WMNA 5CBOA 3LISA 4LNBA 4BERA 4AEZC 2QC9A 5E75A 1X2LA 1IC8A 2ILRA 4GZ3A 3ISMC 1BDIA 1IYGA 1NFIE 2JQEA 2WXMA 4FLBA 3TRBA 1V55E 1ELKA 4L2LA 3CVYA 3LPZA 4N5QA 1FT1A 1YCSB 2VSXE 4DX1A 2KCKA 1DNPA 3ML9A 3CLCA 2WXIA 1ZZBA 2IOLA 4Z5DA 4GTQA 1QZXA 1TNYA 4TXRA 4GA0A 4I2WA 4J8FA 4L7TA 4A3VA 4BSXA 3NF1A 5JHBA 4UWFA 2X6FA 4LERA 3G2UA 3OKZA 3PEUB 4OBMA 2FEZA 4NQ0A 1XGWA 2VQ2A 4HRAA 2MEZA 1DVPA 1DULA 2R03A 2ICPA 1N11A 3KEZA 5EX3A 5M72A 4BFRA 3ZW3A 4I9CA 1JCQA 3GZ2A 3CKBA 5BNWA 3W9FA 3LYAA 2YBDA 1RIOA 2OR1L 2WUSR 2AVPA 1JWFA 4XE0A 1XNFA 3GUUA 2WXKA 3WXXA 3PREA 3QF3A 2IJGX 1MX2A 3OXFA 3RKVA 3KXAA 3LFPA 3B7HA 1U2ZA 4KYOB 3HZIB 2LNIA 2Y3AA 2XIUA 2B0OE 2BKKB 5DTRA 3OXLA 2QY7A 2J9QA 3OP9A 4YARA 2B6CA 4DX5D 1UG3A 5GAGi 1FCHA 2BNMA 3D9PA 4ABNA 4ILGA 1IQUA 2IQCA 5KJNA 4WWOA 2PXLA 2IONA 1TNUA 5AAOA 2XZTG 3RRMB 1EYHA 1YYHA 4F1SA 3EHRA 1O1RA 1JWLA 1YA0A 3NAWA 2ICTA 4GYWA 4PU7A 1ZZ6A 5DSXA 1QP7A 1K1AA 2CROA 1LCDA 3NBNB 3PNTB 3SZ7A 4U07A 5CBNA 4H7XA 1OWOA 3LJ3A 3FU6A 1BD8A 2PUBA 4UWKA 2IF4A 4NDWA 2F37A 1SQMA 4B89A 2GROB 3CQGB 4UQXA 2Y4TA 4GYYA 3A9ZA 1RZRA 3BUAA 1HZ4A 4KT6B 3SFYA 4JHKA 5ENOD 3NZSA 4OVUA 3JXDL 3Q5MA 4YDOA 2PQNA 4JB8P 4YG7B 2LSUA 3PZ3A 4GMLA 1UTXA 4G11A 4F6RD 4ATGA 5C1DA 4I6UA 4B8AA 3MZLB 2AUWA 4HRNA 1PRAA 5CCLA 3BS3A 3PXPA 3ESKA 4CCAA 4EHMA 3QC1A 4DUIA 4GTPA 1D9SA 2P9NG 3RJVA 3QK0A 4I6JA 3RSEG 1E96B 1IHGA 3TWWA 2AW6A 1HS6A 4E6HA 3PDNA 3FTVA 4HNAD 3GN5B 2V4LA 4EZKA 3DNVB 2XRYA 2BTDA 4YG4A 1X81A 2DCPA 5FJYA 4O1PA 2XPIA 2FO7A 1ZVVA 4HOUA 2GGFA 3VTXA 3EJNA 3D9LA 5FTPA 4JEHA 4YBAA 5HKPA 1BLXB 3FUEA 4OAUC 2AXVA 3NXHA 2QFCA 1L1MA 2RG8A 3OQMA 5EDSA 1OCCE 1K3ZD 3CHMA 4J8DA 2R02A 5AQBA 1H0AA 2KZTA 3Q73A 2XS8A 4I9EA 2XGSA 3EU5A 3CEQA 1PAQA 3FUKA 4F3VA 4E85A 3FDHA 3HXBA 1UJKA 3CHRA 3HXDA 2L1PA 4I6GA 3TEPA 4NRHB 4Q69A 1X5BA 2MHKA 2J4BA 4J6IA 1Z3XA 4XKBA 4YDYA 3GW4A 3S7JA 4O60A 2IU1A 2PZIA 4OVVA 4FHJA 3ASOE 3A9XA 3Q9NC 2RKKA 3AU5A 4B0ZA 3NZUA 1WIZA 4GAAA 4MCTA 3T5VA 4A1GA 3T8KA 2L6JA 4X4DA 4DX6D 3ZVVA 4GZDA 4XIFA 3UM2A 3NROA 3MLFA 2OVBA 4DLOA 4FJZA 5BV1A 5A6CA 1H6OA 5KCMA 3FUFA 4UQYA 4EQZA 3HG0D 5BV0A 5A7LA 5FIOA 2PXBA 2X38A 3VWSA 2JEKA 2CHZA 1HE8A 2KZ8A 4FC8A 2CHWA 1PC2A 2ZISA 3SX0A 2H6HA 4UI9J 1H2TC 1ZB1A 2PL2A 1NA0A 2PPXA 4U04A 5AQ7A 2JABA 1MYOA 2BNNA 2P9PG 3KJXA 4WWNA 3D9KA 4FA6A 1JCRA 3JXCL 4N3BA 1OSLA 5CERB 4JL0A 3HHMA 3TL5A 4UUCA 2AWIA 3BQOA 1N94A 3HXFA 3FULA 4C48B 2LXMA 4WAFA 4CRWA 3FEYA 1MHQA 4U0ZA 4YVQC 2FFHA
chains in the Genus database with same CATH topology
3CROL 4WNGA 2ONDA 3Q47B 4L2YA 4U63A 4N39A 3L54A 3FTZA 3SBTB 4BT9A 2HINA 5G04J 2B5AA 2IVGA 2LYPA 3D1NI 3PRZA 3PH0C 1E90A 3ONLA 1EDUA 4N5CA 4MLPA 3ASDA 3HYMB 2IU7A 3PE3A 3SCFA 4X4BA 1OWNA 4YNDA 2KC7A 2R17C 2DBAA 3DPDA 4GCOA 4WWPA 4APFA 5KJKA 1QPZA 3FUJA 1Y6IA 3Q15A 5G2NA 3SNXA 1WH8A 4Q94A 3UX4A 4BX8A 2CSFA 2D5VA 4KBQA 3OXGA 1PRUA 1ELWA 2YHCA 1ZAYA 1Y9QA 4LCTA 3QKYA 4UWHA 4Y42A 2EQXA 4JC8A 1S7EA 3QDNA 3U64A 3VLFA 1O4XA 3CK8A 4ILIA 3MV3B 1HXIA 1CQTA 3E4BA 3LKUA 4HOQA 3F52A 5K98B 1QQEA 1QP0A 2HM8A 3FWVA 4AJWA 5BT1A 4GPKA 3QARA 2E0IA 5CCMA 4I1MA 2XI8A 3ULQA 2V8SE 3TGOA 3IV0A 3MJWA 2O38A 3FMYA 2DIWA 3CQCB 4AV7A 4I8TA 2NC9A 5T3RA 3JQ0A 4PDXA 2WMNA 4XZ4A 4CDMA 4JHJA 4EBAA 3LISA 4GZ5A 5HQ8A 3FU5A 4AEZC 5E75A 1X2LA 4CT4A 1IC8A 2L9BA 2XGOA 2ILRA 4GZ3A 4JVSA 4I6TA 1BDIA 1GW6A 5AJDA 5AJLA 4DK5A 3QWGA 4ILHB 1IYGA 3C98A 4JW1A 3FTSA 1TJCA 2XCJA 2WXMA 3ZKCA 4FLBA 4BTAA 3TRBA 5FZRA 3FFLA 2XCBA 1ELKA 3NQPA 3AS5A 3R7QA 4X4CA 2PE5A 4XX5A 4L2LA 4ANXA 3L22A 2V0PA 3LS8A 2BF0X 3HIZA 5FWQA 3RRNB 2WB2A 2WQ6A 1HO8A 3LPZA 1L5JA 1R63A 2Q7FA 3CIAA 2WXNA 3CVVA 3CVYA 4OYSA 2VSXE 4U0SA 1TEZA 2KCKA 3IHVA 1DNPA 3RIBA 3ML9A 4G25A 3CLCA 5KJLA 4BY6A 3D9OA 3CSFA 1OWMA 2WXIA 3FUIA 3SI5A 3FTUA 2R1JL 1ZZBA 3JUIA 2IV1A 1QP4A 1HX8A 3UQ3A 3ZYLA 2Y4UA 5J08A 2WXRA 2WQ7A 3R7RA 4HVBA 2IOLA 4Z5DA 1Y8MA 2WVIA 2CHXA 4FJYA 4PU8A 4JA9A 3FUHA 3ZHEA 4GA0A 3L17A 3LEWA 2LSVA 2BUGA 4J8FA 4I2WA 4L7TA 3NF1A 4A3VA 4UWFA 4BSXA 2X6FA 5JHBA 4LERA 3UFDA 3F6WA 3G2UA 1PNRA 1WETA 3EHNA 4XKCA 4B0ZA 4GB9A 3FH7A 1H2VC 1PRVA 3PEUB 1PY1A 2HYZA 2FEZA 3QYXA 3G2VA 2WMOA 1XGWA 2VQ2A 1LMB3 1HU3A 3CLJA 4NQ0A 2WQHA 1UW4B 4MRUA 2VTBB 4IULA 3ASFA 4KVOA 2MEZA 4ANUA 2GRLA 1DVPA 2IFUA 1DW9A 5DIZA 5HI7A 2ICPA 3KEZA 4G2VA 4N3AA 3ZHEB 5ARFA 5EX3A 1QQBA 3CHQA 3LCAA 3ZYMA 5M72A 4O6FA 1ZZ7A 4WNFA 5AENA 3VLEA 4XI0A 4BFRA 1YSEA 4I1AA 3OMTA 3EDTB 4U8HA 1MQSA 2GW1A 3EIQC 4JEUA 3FH8A 4I9CA 1DWKA 3ZW3A 1H6KA 4URKA 2WXLA 4LEUA 4CEMA 3OAWA 4IA8A 3GZ2A 3CKBA 3FTXA 5BNWA 3CHPA 3HDXA 2J49A 3LYAA 4GU5A 4FBIA 4K0RA 3MKQA 4RSYA 4TV3A 1RPEL 4O8BA 2MOWA 2FJRA 5G04C 1RIOA 2OR1L 2WUSR 4JQDA 3RRUA 5CMYA 3U9WA 3ZXSA 2AVPA 3D3MA 1JWFA 2LYRA 4BWRA 3PUKA 3QJZA 3ENEA 5T8IA 4XE0A 4B8CB 1XNFA 4UI9K 4DLQA 2WXKA 2KEKA 3WXXA 3PREA 3RK6A 3MCXA 3QF3A 3I4RB 2IJGX 3S7FA 1ZU2A 4PH4B 3OXFA 3RKVA 2KPJA 3KXAA 3ESLA 2PUGA 3ZGQA 3UT8A 3LFPA 3B7HA 3T8MA 4X4FA 3OQOA 3G2SA 3GZSA 4MKTA 4Q96A 3PUJA 3L16A 1X57A 4KYOB 3L13A 3HZIB 5JJTA 4F53A 2LNIA 5FZQA 3SHFA 3BEEA 4KZCA 2JVLA 2OV8A 4Z5CA 2XIUA 1UJJA 2Y3AA 3JYSA 3LDZA 3OXLA 2QY7A 4GZ6A 4BT8A 4A55A 5LFAA 4CT0A 4N2QA 4CGWA 2J9QA 4GA1A 5BW8C 3I3NA 3TAXA 3PZDA 3OP9A 4YARA 1U3DA 1Y7YA 3RO2A 1XWRA 2YHEA 3LXUX 1N54A 2IVQA 2R5SA 3UMVA 3LY9A 2LYSA 1UG3A 2XRZA 1FCHA 5LCWC 2BNMA 3D9PA 3BG0B 1CJGA 1WM5A 2UY1B 4ABNA 1UN9A 4PS8A 4ILGA 2EF8A 4JPSA 1IQUA 2IQCA 3G2TA 4J1WA 2BNOA 1QZ2A 4PS3A 2LCVA 5FZSA 4WWOA 5KJNA 2GZUA 3CSTA 5J90A 5LX8A 2IONA 1E8WA 2X6HA 4GA2A 3F51A 1UN8A 4WUYA 4DI4A 3SGHA 4ACLA 3RRMB 2LYJA 2AXUA 2A6CA 1ZZ8A 2XHEA 1EYHA 2XJ3A 2J08A 4F1SA 2VGXB 1LF8A 1JWLA 3GN5A 1YA0A 3QAQA 3Q49B 1W3BA 2ICTA 4PU7A 1ZZ6A 1SQ8A 1QP7A 2NXPA 3CVLA 4GYWA 3QB2A 3LY7A 4X4IA 3KAEA 2CROA 1LCDA 1FVHA 3PNTB 2UWJG 3MEKA 4U07A 3SZ7A 4ACKA 5LP0A 4DJAA 3MV2B 1E8ZA 4GMJA 4H7XA 4AVXA 4MS6A 3MX3A 4HS2A 1JFTA 1OWOA 1NZNA 4JCXA 3EIJA 4PUCA 3LJ3A 3ZN3A 4ANVA 3FU6A 4CDNA 2PUBA 4UWKA 2IF4A 4NDWA 1B89A 2PUAA 1SQMA 4G26A 2PUEA 1U3CA 3FU3A 4B89A 2L0IA 1ZPQA 3URZA 5CMWA 3CQGB 3ASGA 3ZYKA 3FU0A 4UQXA 2XQ0A 2Y4TA 1LCCA 4GYYA 5AYWD 3SBSA 1Z6TA 4UI9C 1BDHA 5G05J 1RZRA 3G7DA 1HZ4A 4KT6B 3D9MA 2VYIA 2X6IA 3JCKC 4JHKA 4Z58A 3NZSA 4OVUA 5FQ7A 3BG1B 4JCYA 2EBYA 3FTYA 3DBSA 1JH9A 4MCXA 3P1UA 3JXDL 3Q5MA 5E76A 3SD5A 3QWPA 3O48A 4N2SA 1A17A 3RU0A 1LLIA 1WH6A 4AXHA 2PQNA 4YG7B 2LSUA 4J8EA 2VSNA 4GMLA 5D0QD 1UTXA 1OWLA 3G5GA 1JFSA 2O4AA 4G11A 5ANLA 4ATGA 3HVEA 5C1DA 3LVQE 2AXZA 3RZZA 4I6UA 1E7VA 1Z3YA 4OB4A 3CHOA 3KS2A 3B7SA 4B8AA 4EQFA 2R59A 3MZLB 5A7DB 2AUWA 3CVPA 4FULA 1PRAA 2IOSA 5C2YA 3R1FA 3PVLA 5CCLA 2KEJA 2XPYA 3QWWA 2C2LA 2CFZA 4WNEA 4A1SA 3BS3A 4X4GA 2JCGA 3PXPA 3ESKA 4CDRA 4CCAA 2HO1A 2M63A 3B7RL 5BUZA 4LRZA 3QC1A 3L1PA 2JLBA 4AY6A 3RJVA 3QK0A 4I6JA 3QQ6A 5FT9A 4APOA 4HORA 1NP7A 3GBFA 1E96B 3FUDA 1IHGA 2IUOA 4IN3B 4PS7A 2E2EA 2AW6A 1OCTC 1HS6A 2YINA 3S8QA 3L6AA 4G1TA 4Y6CA 3CKCA 5LOZA 4E6HA 3PDNA 4IRUA 4D10C 4GCNA 3FTVA 3D9IA 4I1OB 2RD0A 3GN5B 3FH5A 3PEVB 3OQNA 2NSZA 2V4LA 4RG6A 3APCA 3SF4A 4EZKA 3DNVB 2XRYA 4EZLA 2BTDA 2X6KA 5LCWJ 5CHEE 4R7LA 4DPRA 2PUCA 2A4ZA 3ML8A 3ZYQA 4YG4A 1HFAA 4B94A 4LUNU 3MA5A 4YVOA 2WXQA 2GRMA 4JXTA 1PERL 2DCPA 5FJYA 3D9NA 4JA7A 3FP3A 4HOSA 1HF8A 2XPIA 1EFAA 2FO7A 2J07A 1ZVVA 4BX9A 4HOUA 2WXHA 1ZZ9A 2GGFA 2LO6A 3EJNA 3VTXA 3D9LA 5FTPA 4Z59A 4JEHA 1ZZCA 5FQ8A 4KMOA 4KXKB 2FI7A 3CECA 4YBAA 3T5XA 3FUEA 4HXIA 2J09A 2CG3A 4TRQA 2AXVA 4W9RA 1SZAA 2I1KA 2QFCA 2I1JA 2WPVA 3ZHMA 4AM9A 1QQAA 1H19A 1L1MA 2RG8A 5A23A 3OQMA 2H8RA 2WM9A 1N52A 4Z5HA 4PU4C 1OUVA 4G23A 4FLHA 5EDSA 3CK9A 1INZA 3CGHA 3U3WA 3S7DA 2XSDC 2ZU6B 3CHMA 4J8DA 2OFYA 2PIJA 1KT0A 4WNDA 1KT1A 1H0AA 4Y6WA 2KZTA 2I9CA 5D0OD 1E8YA 5BPPA 4I9EA 2XGSA 1GT0C 3B13A 5G05C 4AP2A 5JHAA 2L8NA 3CEQA 3O9XA 1PAQA 3N71A 3FUKA 4F3VA 4FP7A 4E85A 2XEVA 1E8XA 1JPLA 3FDHA 2KCVA 1UJKA 2P58C 3CHRA 3CR3A 2VGXA 2WXGA 3JXBC 4I43A 5ENNA 3CK7A 2KEIA 4I6GA 4GQMA 4X4HA 4X4EA 1JUQA 1P5QA 4NRHB 3B7TA 2YNQA 2FULA 2YQ8A 4C0MA 2PUFA 3UUXA 3AU4A 4Q69A 2O49A 1X5BA 3U66A 2MHKA 2J4BA 4I6RA 4J6IA 1Z3XA 4FHKA 3MYVA 4CGVA 3L08A 4UWGA 1ZS4A 4N3CA 3FUMA 4JZYA 3I4GA 3TG4A 1KLXA 1WAO1 2CG2A 3EHMA 4RVBA 4HOTA 3LVRE 2KM4A 4XKBA 3TG5A 4EZJA 3GW4A 3S7JA 5AIJA 2WXJA 4C9BB 3VTYA 3HVEB 1NERA 1POUA 1NA3A 2X3MA 5DBKA 3I5PA 2VJ8A 2IU1A 1VDYA 4GHJA 2PZIA 1R69A 2X6JA 3SCHA 4FHJA 4K03A 2PQRA 4IYPA 4OVVA 5ARGA 3ZPJA 3ZEFA 4F7AA 2UY1A 3FTWA 5JJ7A 3AS4A 3IHYA 3ZHIA 2OOEA 2VTBA 2PUDA 2LYLA 3IBEA 3S2AA 2R63A 2WIUB 3H5TA 2MRIA 1RZSA 3RO3A 4IVZA 4NURA 3AU5A 2C0MA 1AU7A 1WIZA 3NZUA 2WXPA 2LYKA 4MCTA 3P2BA 4GAAA 3S7BA 3T5VA 4YG1A 3K9IA 4A1GA 3U4TA 3KD7A 3QNKA 2L6JA 3FEXA 3OTNA 3Q4AB 4IWRA 5A6CA 4X4DA 4M3OA 4NACA 1S0PA 2L0TB 2EWTA 4AIFA 4EBAG 4FN3A 3CVQA 4HFGA 3ZVVA 3G2WA 3UPVA 4GZCA 4C0EA 4GZDA 4XIFA 2I6HA 2VSOE 3MGBA 3QWVA 4BTBA 4AY5A 3D9JA 3AS8A 3PS6A 1IQRA 4ANWA 4V3IA 3CVWA 3MKRA 3MLFA 4KZ0A 1E3OC 1HG2A 4FADA 3KZ3A 1EPUA 2V5FA 3CVNA 3ZRHA 2OVBA 5JJ6A 2MQKA 3IEGA 4FJZA 4UWLA 4DLOA 5BV1A 5KCMA 2I2OA 3FYAA 2XPZA 3BD1A 3FUFA 4RG9A 4UQYA 4DI3A 3VK0A 5BV0A 3EUSA 5A7LA 3MKQB 4J0UA 2L49A 2BJCA 2X38A 2LYQA 1FVFA 3JQ1A 3ZFWA 3VLDA 2PM7A 2JEKA 1H2UA 2CHZA 1HE8A 2KZ8A 1HG5A 3FY4A 2XCCA 4FC8A 3BDNA 2CHWA 4QFVA 3SFZA 4ME2A 4I2ZA 1PC2A 1UXDA 4EPZA 4UI9J 1H2TC 2PL2A 3CVXA 1HF0A 1NA0A 2PPXA 3FHEA 4L23A 4GYOA 4U04A 4UQZA 1ADRA 3LY8A 4KVMA 4U0UA 1E7UA 4I6EA 5FQ4A 3APFA 4XI9A 4FU3A 5FQ6A 1ZBPA 1SZ9A 5G55A 3APDA 4PU3C 2FBNA 5EX0A 3ASHA 2CFUA 3UT7A 2VGYA 2BNNA 4I17A 3CVUA 4AOFA 3ONKA 3KJXA 3GYZA 2LAIA 4WWNA 3IVPA 3UT4A 3D9KA 1UXCA 3FUNA 4A3TA 5KJMA 3B7UX 2PM6A 4FA6A 2KZTB 3JXCL 1HH8A 2A5UA 2WXOA 1OSLA 4JHRA 4N3BA 3R9AB 3FYMA 4EECA 1NEQA 1B0NA 1EF1C 3IKOB 3TJPA 3O4ZA 1VPWA 2J4DA 3PE4A 3QOUA 4JL0A 3HHMA 1OWPA 4L1BA 4TUUA 5EKQD 3TXMA 3GZ1A 3TL5A 4HLEA 2WXFA 4F8DA 3CHSA 2AWIA 2OVFA 1WY6A 1TJFA 2C0LA 1LQCA 3ZIMA 5T4YA 1ZUGA 1BPOA 2VSYA 3FULA 1RZRD 3CV0A 2IVBA 4G24A 4P29A 4J8SA 5ANRA 2FF4A 2KCLA 2XGMA 4U0ZA 1ELRA 2KATA 2LAHA 3PNLB 1QNFA 4H7YA 4CRWA 4WAFA 1JWGA 3FEYA 2HSGA 4J1XA 1MHQA 3SCGA 4YVQC 2HR2A 3TXNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CRO L;  2EBY A;  4JCY A;  1JH9 A;  1YSE A;  4MCX A;  3JXD L;  2O49 A;  3OMT A;  4I6R A;  1LLI A;  1WH6 A;  1DWK A;  2HIN A;  2B5A A;  2IVG A;  2LYP A;  4YG7 B;  3D1N I;  1ZS4 A;  1UTX A;  4IA8 A;  3G5G A;  1JFS A;  2O4A A;  2IU7 A;  4FBI A;  3SCF A;  4X4B A;  2AXZ A;  3RZZ A;  4I6U A;  4O8B A;  1RPE L;  2FJR A;  4OB4 A;  1QPZ A;  1RIO A;  2OR1 L;  1NER A;  1POU A;  2WUS R;  4JQD A;  2AUW A;  1WH8 A;  1PRA A;  2LYR A;  4GHJ A;  1R69 A;  3R1F A;  3SCH A;  2KEJ A;  2CSF A;  3BS3 A;  4X4G A;  2D5V A;  2KEK A;  3ZHI A;  1PRU A;  2JCG A;  2LYL A;  3PXP A;  1Y9Q A;  2R63 A;  2WIU B;  3H5T A;  1ZAY A;  2PUD A;  1RZS A;  3QF3 A;  4Y42 A;  4Z58 A;  4IVZ A;  1S7E A;  2KPJ A;  3L1P A;  1WIZ A;  3KXA A;  1O4X A;  2LYK A;  4MCT A;  1AU7 A;  1CQT A;  3F52 A;  3QQ6 A;  5K98 B;  1QP0 A;  4YG1 A;  2PUG A;  3LFP A;  3B7H A;  4X4F A;  2XI8 A;  3OQO A;  3GBF A;  4IWR A;  2O38 A;  3FMY A;  1X57 A;  2IUO A;  4X4D A;  2EWT A;  3HZI B;  4I8T A;  4FN3 A;  2AW6 A;  1OCT C;  3S8Q A;  2JVL A;  3LIS A;  4Z5C A;  2XIU A;  1X2L A;  1IC8 A;  3GN5 B;  3OQN A;  4I6T A;  1BDI A;  3DNV B;  3MLF A;  3OP9 A;  3QWG A;  4YAR A;  1Y7Y A;  1E3O C;  3KZ3 A;  2PUC A;  1XWR A;  4YG4 A;  2MQK A;  2XCJ A;  2IVQ A;  3ZKC A;  3FYA A;  2GRM A;  3BD1 A;  3TRB A;  2LYS A;  1PER L;  3VK0 A;  2BNM A;  3EUS A;  5A7L A;  1CJG A;  4X4C A;  2PE5 A;  2L49 A;  1EFA A;  2BJC A;  1ZVV A;  2EF8 A;  2LYQ A;  4J1W A;  2BNO A;  1ZZ9 A;  2LCV A;  2GZU A;  2KZ8 A;  3BDN A;  4Z59 A;  1ZZC A;  1R63 A;  1UXD A;  3F51 A;  3CEC A;  1HF0 A;  2PPX A;  4YBA A;  1ADR A;  3CLC A;  2LYJ A;  2AXU A;  2A6C A;  1ZZ8 A;  2AXV A;  2XJ3 A;  2R1J L;  1ZZB A;  1JWL A;  2IV1 A;  3GN5 A;  1QP4 A;  4PU3 C;  2ICT A;  2BNN A;  1ZZ6 A;  1SQ8 A;  4PU7 A;  1QP7 A;  1QQA A;  1L1M A;  3ZHM A;  4Z5D A;  3KJX A;  3OQM A;  4X4I A;  2H8R A;  3IVP A;  2CRO A;  1LCD A;  4PU8 A;  1UXC A;  4PU4 C;  4Z5H A;  3JXC L;  3U3W A;  2XSD C;  1OSL A;  3FYM A;  2OFY A;  2PIJ A;  1NEQ A;  1B0N A;  1JFT A;  4JCX A;  1VPW A;  3UFD A;  3F6W A;  1PNR A;  1WET A;  2PUB A;  4NDW A;  1PRV A;  4F8D A;  2PUA A;  2AWI A;  1GT0 C;  3QYX A;  2L8N A;  2PUE A;  1LQC A;  1LMB 3;  1ZPQ A;  3O9X A;  1ZUG A;  1RZR D;  2IVB A;  1LCC A;  2MEZ A;  2GRL A;  3JXB C;  1DW9 A;  1BDH A;  2ICP A;  2KEI A;  1RZR A;  4GQM A;  4X4H A;  3G7D A;  4X4E A;  1QQB A;  2HSG A;  4J1X A;  3SCG A;  1ZZ7 A;  2PUF A; 
#chains in the Genus database with same CATH topology
 3CRO L;  1WG0 A;  3Q47 B;  4U63 A;  2KXP C;  3FTZ A;  2IVG A;  3D1N I;  3PRZ A;  1E90 A;  1EDU A;  4N5C A;  2IU7 A;  3SCF A;  2R17 C;  1RZ4 A;  1Y6I A;  3C3O A;  3UX4 A;  2CSF A;  3NOG D;  1ELW A;  1ZAY A;  3KEA A;  4Y42 A;  3UXG A;  4JC8 A;  1S7E A;  3DEO A;  3QDN A;  2HE0 A;  3U64 A;  5LFA A;  3E4B A;  4HOQ A;  5K98 B;  2HM8 A;  3C72 A;  2DIW A;  4O1O A;  3JQ0 A;  4JHJ A;  3FU5 A;  4CT4 A;  3GZC A;  2L9B A;  2XGO A;  3QWG A;  4ILH B;  3C98 A;  4JW1 A;  3FTS A;  4HQD A;  2XCJ A;  3AS5 A;  4XX5 A;  2PE5 A;  3UKU G;  3L22 A;  1NL4 A;  4RQI A;  3LS8 A;  5H7P A;  2WB2 A;  1L5J A;  3ZNG A;  2Q7F A;  3CIA A;  2WXN A;  2DYR E;  3Q79 A;  2OCC E;  4WVL A;  5KJL A;  3D9O A;  4K5C A;  3UI2 A;  3C3Q A;  3GZD C;  3ZYL A;  1N0Q A;  1OXJ A;  1Y8M A;  2CHX A;  4U8V D;  5AQ9 A;  3FUH A;  3DXK G;  3LEW A;  2LSV A;  3RAU A;  3TWT A;  3NOC D;  2ZIR A;  4XKC A;  3FH7 A;  1H2V C;  3SFX A;  1PY1 A;  3QYX A;  3G2V A;  1HU3 A;  1UW4 B;  4KVO A;  1TN6 A;  3AAA C;  4G2V A;  3UM3 A;  1ZZ7 A;  4WNF A;  4I1A A;  2PNN A;  3EDT B;  4JEU A;  3FH8 A;  4CEM A;  2MXD A;  4IA8 A;  3CHP A;  3HDX A;  2J49 A;  2XEE A;  4FBI A;  2V4H C;  2XS1 A;  4O8B A;  2MOW A;  5G04 C;  3Q9U C;  1O5M A;  3AG2 E;  5CMY A;  3RRU A;  3ZXS A;  1MX6 A;  4K5A B;  3PUK A;  3QJZ A;  5T8I A;  4DLQ A;  3I4R B;  3S7F A;  4PH4 B;  2V5Q C;  2KPJ A;  3ESL A;  3UT8 A;  3WG7 E;  4X4F A;  4Q96 A;  3GZS A;  4MKT A;  3L13 A;  5FZQ A;  2OV8 A;  4RG9 A;  1UJJ A;  1N95 A;  4CGW A;  3I3N A;  3PZD A;  1U3D A;  1Y7Y A;  3DSW A;  3RO2 A;  1XWR A;  2YHE A;  4Q2J A;  2IVQ A;  5FIN A;  1UN9 A;  4PS8 A;  4JPS A;  1HQ1 A;  2PXD A;  3G2T A;  4PS3 A;  1QZ2 A;  5FZS A;  5J90 A;  3CST A;  1E8W A;  2X6H A;  1UN8 A;  4WUY A;  5B1B E;  4DI4 A;  1S70 B;  2LYJ A;  2AXU A;  1LF8 A;  3QAQ A;  3CVL A;  4ATZ D;  2NXP A;  1D8E A;  2EIL E;  4X4I A;  3KAE A;  5LP0 A;  1FVH A;  4ACK A;  2UWJ G;  3MEK A;  4DJA A;  3DSS A;  3EHQ A;  4GMJ A;  5CEA A;  1JFT A;  3SR4 A;  1NZN A;  4JCX A;  4PUC A;  5EIL A;  3OWQ A;  4CDN A;  3B7B A;  2PUA A;  2ODR D;  4G26 A;  4J7W A;  4GTO A;  3AG3 E;  1AWC B;  3JUE A;  3HRA A;  5G05 J;  3D9M A;  2X6I A;  3DBS A;  1JH9 A;  1A17 A;  1LLI A;  4AXH A;  1MX4 A;  2VSN A;  5JUW A;  2XZD G;  1JFS A;  2O4A A;  5ANL A;  2ZXW E;  1E7V A;  4EQF A;  5C2Y A;  3QWW A;  2C2L A;  2CFZ A;  4WNE A;  4A1S A;  4MBG A;  4CDR A;  1DCE A;  2M63 A;  3B7R L;  5BUZ A;  4LRZ A;  5CRV A;  2JLB A;  2QYJ A;  2F8X K;  3G0T A;  1NP7 A;  4XEI G;  2IUO A;  1OCZ E;  1IXV A;  4PS7 A;  3L6A A;  4G1T A;  3S8Q A;  5LOZ A;  3CKC A;  2PXQ A;  3D9I A;  4CYM D;  3PEV B;  5LCW J;  3SF4 A;  2X6K A;  3F6Q A;  2OEW A;  5CHE E;  4DPR A;  2PUC A;  3ZYQ A;  2IO2 C;  3KSL A;  2ETB A;  1IKN D;  3MA5 A;  4JXT A;  3R09 A;  3FP3 A;  4BX9 A;  1ZZ9 A;  4BET A;  1YMP A;  1AP7 A;  4KXK B;  2GRR B;  3CEC A;  2XEN A;  4TRQ A;  2GRP B;  1DCQ A;  4AM9 A;  1H19 A;  1KZO A;  2Y0B G;  4FLH A;  2LUH A;  3U3W A;  1BI8 B;  1N9A A;  2PIJ A;  4WND A;  1KT1 A;  2GRQ B;  4Y6W A;  5D0O D;  1GT0 C;  1JPL A;  5HRY A;  2P58 C;  2M4H A;  2KEI A;  4GQM A;  4X4H A;  1P5Q A;  2FUL A;  2PUF A;  3U66 A;  2O49 A;  4I6R A;  3MYV A;  3DEP A;  1OCO E;  1WAO 1;  2CG2 A;  3EHM A;  1RW2 A;  3UKR G;  1FPP A;  4C9B B;  1SW6 A;  1POU A;  3I5P A;  4IYP A;  3V79 K;  2VTB A;  3ZHI A;  2PUD A;  2LYL A;  3IBE A;  2R63 A;  1OT8 A;  3S7B A;  2WXP A;  3GZD A;  4YG1 A;  3KD7 A;  4AIF A;  4GTV A;  4EBA G;  2LXL A;  4C0E A;  2I6H A;  3MGB A;  4BSZ B;  3PS6 A;  4HLL A;  3CVW A;  3SCG A;  1E3O C;  2EIJ E;  1EPU A;  3CVN A;  1MFQ C;  4UWL A;  3FYA A;  2XPZ A;  4DI3 A;  3VK0 A;  4DRX E;  4J0U A;  1O1T A;  3ZFW A;  2PM7 A;  4YDE A;  3TFL A;  1HF0 A;  3FHE A;  4L23 A;  1ADR A;  3LY8 A;  4OAV B;  5AAR A;  4XI9 A;  5FQ6 A;  1SZ9 A;  5D2M C;  4EK9 A;  5G55 A;  3UT7 A;  2VGY A;  4I17 A;  3ONK A;  3GYZ A;  3IVP A;  1MJ0 A;  1UXC A;  3ASN E;  2KZT B;  5DTM A;  2WXO A;  1B0N A;  1EF1 C;  3IKO B;  3TJP A;  1VPW A;  2J4D A;  2ETA A;  3PE4 A;  3TXM A;  3CHS A;  1LQC A;  3ZIM A;  5T4Y A;  2VSY A;  3ABL E;  3CV0 A;  5KNG A;  2LLV A;  2XXA A;  4P29 A;  5ANR A;  5DRY A;  1ELR A;  2KAT A;  3J5P A;  2HSG A;  3Q75 A;  4HI8 A;  3FY4 A;  2HR2 A;  4WNG A;  4LG6 A;  2ZGD A;  1Z5S C;  2DZN A;  4BT9 A;  5G04 J;  4G8L A;  2B5A A;  3PH0 C;  3Q7A A;  3ONL A;  4A63 B;  5ENR D;  2L6B A;  4X4B A;  4YND A;  2KC7 A;  4APF A;  4GCO A;  4F1P A;  1QPZ A;  3Q15 A;  4ER6 A;  2DYS E;  2D5V A;  3ABM E;  4RLY A;  2P9S G;  2YHC A;  4UWH A;  3DPY A;  4ILI A;  3VLD A;  4AJW A;  5BT1 A;  4GPK A;  1QP0 A;  2HFZ A;  4GMR A;  3QAR A;  2E0I A;  5CCM A;  2XI8 A;  3IV0 A;  3MJW A;  4I8T A;  4GTR A;  4ER0 A;  4XZ4 A;  5T3R A;  4EBA A;  4GZ5 A;  5HQ8 A;  1A5E A;  4U96 D;  4JVS A;  4I6T A;  1GW6 A;  4ZFH A;  1OCR E;  3E32 A;  3ZKC A;  3FFL A;  3E33 A;  4TUM A;  4U95 D;  2V0P A;  2BF0 X;  3HIZ A;  3RRN B;  1SA4 A;  2WQ6 A;  1HO8 A;  3CVV A;  4U0S A;  3ME5 A;  3DSV A;  3CSF A;  1OWM A;  2R1J L;  3MEJ A;  3JUI A;  1QP4 A;  1HX8 A;  3UQ3 A;  5J08 A;  2Y4U A;  2WXR A;  3R7R A;  2WVI A;  4FJY A;  3L17 A;  2BUG A;  3PZ2 A;  1O1S A;  3F6W A;  1PNR A;  1WET A;  3EHN A;  2HYZ A;  3KL4 A;  2P9L G;  2WMO A;  1LMB 3;  2VTB B;  4IUL A;  3ASF A;  4EKI A;  2GRL A;  2IFU A;  5HI7 A;  3ZHE B;  4DX2 A;  5ARF A;  1QQB A;  3CHQ A;  3LCA A;  4O6F A;  4GTT A;  5JA4 D;  5AEN A;  3OMT A;  5EN5 D;  1MQS A;  1DWK A;  4URK A;  1H6K A;  3OAW A;  3TWQ A;  3ZKJ A;  3MKQ A;  4JQD A;  1QB2 A;  3ENE A;  3QOW A;  3Q78 A;  1BI7 B;  2KEK A;  3MCX A;  5CRU A;  2P2C P;  1ZU2 A;  5AN8 A;  4BEP A;  3ZGQ A;  4ER7 A;  3UIN C;  3PUJ A;  1K1B A;  3L16 A;  1X57 A;  2HCN A;  5JJT A;  4F53 A;  3SHF A;  3BEE A;  4KZC A;  4Z5C A;  3TAX A;  5BW8 C;  3ZXP A;  2F8Y A;  4L9P A;  3LXU X;  1N54 A;  3C3R A;  2XRZ A;  3LQX A;  3BG0 B;  4TXQ A;  1CJG A;  1WM5 A;  2UY1 B;  3SQV A;  4J1W A;  2GZU A;  4ZHB A;  3HXC A;  1OY3 D;  3SGH A;  1QBQ A;  2A6C A;  2XHE A;  2XJ3 A;  2J08 A;  2VGX B;  2H6I A;  3GN5 A;  1N4P A;  3Q49 B;  3QB2 A;  4JD2 G;  3TEL A;  5ENT D;  1NW3 A;  3TWU A;  3MX3 A;  4HS2 A;  3EIJ A;  3ZN3 A;  4ANV A;  1U3C A;  2QZA A;  2L0I A;  3URZ A;  5CMW A;  1S63 A;  3ZYK A;  3FU0 A;  1H6P A;  1LCC A;  1TYQ G;  1Z6T A;  4UI9 C;  4LNU D;  3EUV A;  3BG1 B;  2EBY A;  2J7U A;  5D0Q D;  3KSQ A;  3PE5 A;  3G5G A;  5D66 A;  5GAH i;  3LJN A;  2MYO A;  3LVQ E;  2AXZ A;  3CHO A;  3KS2 A;  2R59 A;  5A7D B;  5KNH D;  2KEJ A;  4CZ2 D;  4X4G A;  1BU9 A;  2JCG A;  2HO1 A;  3L1P A;  4AY6 A;  2ETC A;  4GTM A;  4APO A;  4HOR A;  3QFI A;  3GBF A;  3FUD A;  4IN3 B;  2E2E A;  2YIN A;  4Y6C A;  4DE9 A;  4IRU A;  4I1O B;  3SO8 A;  3FH5 A;  4EZL A;  3APC A;  4YVO A;  3UM1 A;  1PER L;  4JA7 A;  1EFA A;  2J07 A;  2XXQ A;  2VGE A;  3NB2 A;  4Z59 A;  1ZZC A;  5FQ8 A;  4KMO A;  4LNG A;  1Q2Z A;  5HS0 A;  3T5X A;  4HXI A;  1N4Q A;  2CG3 A;  4W9R A;  2I1J A;  2WPV A;  3ZHM A;  2IEJ A;  5A23 A;  2WM9 A;  4Z5H A;  4PU4 C;  1OUV A;  4G23 A;  1INZ A;  3CK9 A;  3JXI A;  3S7D A;  1KZP A;  2ZU6 B;  2OFY A;  1KT0 A;  3V2O A;  2PXT A;  5DTQ A;  5JHA A;  4FP7 A;  1E8X A;  5FT9 A;  1V54 E;  2KCV A;  5ENP D;  5ENN A;  2VGX A;  2WXG A;  3JXB C;  3CK7 A;  4X4E A;  1JUQ A;  2YQ8 A;  4C0M A;  1ZS4 A;  3FUM A;  4JZY A;  3I4G A;  1KLX A;  3SY2 A;  4RVB A;  3LVR E;  2KM4 A;  4EZJ A;  5AIJ A;  5EIB E;  2WXJ A;  3HVE B;  2X3M A;  1NA3 A;  2VJ8 A;  1R69 A;  2X6J A;  3SCH A;  2PQR A;  5ARG A;  3ZPJ A;  2BED A;  3QOX A;  5JJ7 A;  3IHY A;  3H5T A;  2MRI A;  3RO3 A;  3X2Q E;  4IVZ A;  4NUR A;  5DT2 A;  4G8K A;  3U4T A;  3FEX A;  3OTN A;  1S0P A;  2EWT A;  1TNO A;  3G2W A;  3UPV A;  4GZC A;  2VSO E;  3QWV A;  3D9J A;  1NI1 A;  2LLW A;  2MQK A;  2I2O A;  3AG4 E;  3BD1 A;  3EUS A;  3MKQ B;  3T9K A;  2V3C C;  3JQ1 A;  3ULY A;  1HG5 A;  4Z68 A;  2XCC A;  4I2Z A;  2Y1L E;  3UIP C;  3CVX A;  4J8Y A;  4U0U A;  4KVM A;  1SVX A;  3DST A;  3APF A;  3APD A;  4PU3 C;  2FBN A;  3DRA A;  4AOF A;  1N4R A;  2LAI A;  3UT4 A;  3FUN A;  4A3T A;  5KJM A;  3B7U X;  4X8Q A;  2PM6 A;  1KPS B;  2DVW A;  1HH8 A;  2A5U A;  4U7E B;  3R9A B;  4EEC A;  3FYM A;  2PXE A;  1NEQ A;  3O4Z A;  5EKQ D;  3QOU A;  4TUU A;  4L1B A;  4HLE A;  2WXF A;  4F8D A;  2OVF A;  1TJF A;  1ZUG A;  1BPO A;  1RZR D;  3Q7F A;  2IVB A;  4DX7 D;  4J8S A;  2KCL A;  2XGM A;  4QQI A;  2LAH A;  4H7Y A;  3PNL B;  4J1X A;  3TXN A;  2WQ7 A;  3NDB B;  3EU9 A;  3SBT B;  3B95 A;  1TR4 A;  4MLP A;  1S64 A;  2FO1 E;  5KJK A;  2DBA A;  3DPD A;  2QYU A;  4GPM A;  2F0Y A;  3SNX A;  1WH8 A;  4ER3 A;  1PRU A;  4LCT A;  4DE8 A;  3QKY A;  1FT2 A;  1O4X A;  3CK8 A;  2NYJ A;  2EIN E;  3F52 A;  4BES A;  2R05 A;  3TGO A;  5KBA A;  2J7W A;  2O38 A;  3CQC B;  4AV7 A;  2NC9 A;  4PDX A;  4CDM A;  3V2X A;  5CED B;  2LNM A;  5AJD A;  4DK5 A;  5AJL A;  1TJC A;  4BTA A;  5FZR A;  2PXP A;  2XCB A;  3NQP A;  3E30 A;  3R7Q A;  4X4C A;  4ANX A;  5FWQ A;  1R63 A;  4OYS A;  1TEZ A;  3ABK E;  3IHV A;  3RIB A;  4G25 A;  2Y69 E;  4BY6 A;  1UOH A;  1TNB A;  3FUI A;  3L9T A;  3SI5 A;  3FTU A;  2IV1 A;  4HVB A;  2IY0 C;  4PU8 A;  4JA9 A;  3UFD A;  4GB9 A;  1PRV A;  3CLJ A;  2WQH A;  4MRU A;  4ANU A;  3DWL G;  1DW9 A;  5DIZ A;  4N3A A;  3ZYM A;  3VLE A;  4XI0 A;  1YSE A;  4U8H A;  2GW1 A;  3EIQ C;  2WXL A;  4LEU A;  3FTX A;  4GU5 A;  2XXP A;  4K0R A;  4RSY A;  4TV3 A;  1RPE L;  2FJR A;  1IHB A;  3PZ1 A;  3U9W A;  3D3M A;  4BWR A;  2LYR A;  4B8C B;  2P9K G;  4UI9 K;  3RK6 A;  1TN8 A;  3TWV A;  2PUG A;  3T8M A;  3OQO A;  3G2S A;  3D9H A;  5B3S E;  2PXK A;  2JVL A;  3LDZ A;  3TWX A;  4BT8 A;  3JYS A;  4A55 A;  2PXU A;  4GZ6 A;  1TN7 A;  4CT0 A;  4N2Q A;  4GA1 A;  5EYP F;  2OEV A;  2GRN B;  2DZO A;  4M7C A;  3NZL A;  2R5S A;  3UMV A;  3LY9 A;  2LYS A;  5LCW C;  2EF8 A;  4HOS A;  2BNO A;  3DSX A;  2LCV A;  4B93 B;  5LX8 A;  4GA2 A;  3F51 A;  3UIO C;  4ACL A;  2VEO A;  1ZZ8 A;  3DXM G;  2PXF A;  1W3B A;  1SQ8 A;  3JXJ A;  3LY7 A;  3MV2 B;  1E8Z A;  4AVX A;  4MS6 A;  2P9U G;  5ENQ D;  2DWZ A;  1B89 A;  3ZPX A;  2PUE A;  3FU3 A;  1WDY A;  5IY5 E;  1ZPQ A;  2KBX A;  3UTM A;  3DSU A;  3ASG A;  4K5B A;  5AYW D;  2XQ0 A;  2EIM E;  3SBS A;  1BDH A;  4ER5 A;  3G7D A;  2VYI A;  3JCK C;  4Z58 A;  5FQ7 A;  4JCY A;  3FTY A;  3SD5 A;  1TNZ A;  4MCX A;  3P1U A;  5E76 A;  1SA5 A;  3C5R A;  3O48 A;  3QWP A;  3RU0 A;  4N2S A;  1WH6 A;  4U8Y D;  4J8E A;  1OWL A;  4HB5 A;  3HVE A;  3RZZ A;  1Z3Y A;  5CEC B;  4OB4 A;  3B7S A;  3CVP A;  4FUL A;  2IOS A;  3R1F A;  3PVL A;  2XPY A;  2A5E A;  2AJA A;  5EID A;  3W9G A;  4HRL A;  3QQ6 A;  2P9I G;  3J5Q B;  2H6G A;  3L82 A;  1OCT C;  4D10 C;  4GCN A;  3UM0 A;  2RD0 A;  3OQN A;  2NSZ A;  4RG6 A;  4R7L A;  2BKG A;  2A4Z A;  3ML8 A;  5B1A E;  1HFA A;  4B94 A;  1LD8 A;  4LUN U;  2WXQ A;  2GRM A;  5BXO A;  3D9N A;  1HF8 A;  3E34 A;  2WXH A;  2IO3 C;  2LO6 A;  2RFM A;  1N4S A;  2FI7 A;  5EYL A;  5JMN D;  2J09 A;  3ZU7 B;  1SZA A;  2I1K A;  2J8S D;  1G3N B;  1QQA A;  5DRT A;  3ZUV B;  5KWD A;  2H8R A;  1N52 A;  1N0R A;  3CGH A;  1D8D A;  2XSD C;  2I9C A;  1E8Y A;  5BPP A;  4AP2 A;  3B13 A;  3M9L A;  5G05 C;  2L8N A;  3O9X A;  3IXE A;  3N71 A;  2XEV A;  4I43 A;  3CR3 A;  4HRM B;  3B7T A;  2YNQ A;  4HBD A;  3AU4 A;  2RFA A;  5AQA A;  4FHK A;  4CGV A;  3L08 A;  4UWG A;  4N3C A;  3E37 A;  3TG4 A;  2PXV A;  4HOT A;  3TG5 A;  2HCS A;  2ZGG A;  3VTY A;  1NER A;  5DBK A;  1VDY A;  4GHJ A;  4K03 A;  2EIK E;  3ZEF A;  4F7A A;  2UY1 A;  3FTW A;  3AS4 A;  2OOE A;  3S2A A;  2WIU B;  1RZS A;  3AG1 E;  5ITZ F;  2C0M A;  1AU7 A;  2LYK A;  3P2B A;  1LD7 A;  1MZC A;  2R2L A;  3K9I A;  3HXE A;  2XEH A;  3QNK A;  3Q4A B;  4IWR A;  4M3O A;  4NAC A;  2L0T B;  4FN3 A;  3CVQ A;  4HFG A;  4TXP A;  4BTB A;  4AY5 A;  3AS8 A;  1IQR A;  4EKG A;  4ANW A;  4V3I A;  3MKR A;  4KZ0 A;  1HG2 A;  4FAD A;  3A9Y A;  3KZ3 A;  2V5F A;  3ZRH A;  5JJ6 A;  3IEG A;  3DM5 A;  4GTS A;  2L49 A;  1QYM A;  2BJC A;  2LYQ A;  1FVF A;  1H2U A;  3SFZ A;  3BDN A;  4QFV A;  4ME2 A;  1UXD A;  3PZ4 A;  4EPZ A;  3AJI A;  4GYO A;  1LTX A;  4UQZ A;  1E7U A;  4I6E A;  5FQ4 A;  3UWP A;  4NIK A;  4FU3 A;  1ZBP A;  5EX0 A;  3CVU A;  3ASH A;  2CFU A;  4EZI A;  3V30 A;  3BU8 A;  4JHR A;  3R9M A;  3UUX A;  1OWP A;  3GZ1 A;  1WY6 A;  5ENS D;  2C0L A;  4G24 A;  2FF4 A;  2H6F A;  5BXU A;  1QNF A;  3ULE G;  1JWG A;  4HI9 A;  2OND A;  4L2Y A;  4N39 A;  3L54 A;  2HIN A;  4LSZ E;  2LYP A;  3V31 A;  3ASD A;  3HYM B;  3PE3 A;  1OWN A;  4WWP A;  3FUJ A;  5G2N A;  4Q94 A;  1JCS A;  3TWS A;  4BX8 A;  4KBQ A;  3OXG A;  1Y9Q A;  1U2V G;  1DC2 A;  2EQX A;  3TWR A;  3VLF A;  3ZHE A;  3MV3 B;  1HXI A;  1CQT A;  3LKU A;  1QQE A;  3FWV A;  4I1M A;  3ULQ A;  2V8S E;  4YDW A;  1K8K G;  3FMY A;  2WMN A;  5CBO A;  3LIS A;  4LNB A;  4BER A;  4AEZ C;  2QC9 A;  5E75 A;  1X2L A;  1IC8 A;  2ILR A;  4GZ3 A;  3ISM C;  1BDI A;  1IYG A;  1NFI E;  2JQE A;  2WXM A;  4FLB A;  3TRB A;  1V55 E;  1ELK A;  4L2L A;  3CVY A;  3LPZ A;  4N5Q A;  1FT1 A;  1YCS B;  2VSX E;  4DX1 A;  2KCK A;  1DNP A;  3ML9 A;  3CLC A;  2WXI A;  1ZZB A;  2IOL A;  4Z5D A;  4GTQ A;  1QZX A;  1TNY A;  4TXR A;  4GA0 A;  4I2W A;  4J8F A;  4L7T A;  4A3V A;  4BSX A;  3NF1 A;  5JHB A;  4UWF A;  2X6F A;  4LER A;  3G2U A;  3OKZ A;  3PEU B;  4OBM A;  2FEZ A;  4NQ0 A;  1XGW A;  2VQ2 A;  4HRA A;  2MEZ A;  1DVP A;  1DUL A;  2R03 A;  2ICP A;  1N11 A;  3KEZ A;  5EX3 A;  5M72 A;  4BFR A;  3ZW3 A;  4I9C A;  1JCQ A;  3GZ2 A;  3CKB A;  5BNW A;  3W9F A;  3LYA A;  2YBD A;  1RIO A;  2OR1 L;  2WUS R;  2AVP A;  1JWF A;  4XE0 A;  1XNF A;  3GUU A;  2WXK A;  3WXX A;  3PRE A;  3QF3 A;  2IJG X;  1MX2 A;  3OXF A;  3RKV A;  3KXA A;  3LFP A;  3B7H A;  1U2Z A;  4KYO B;  3HZI B;  2LNI A;  2Y3A A;  2XIU A;  2B0O E;  2BKK B;  5DTR A;  3OXL A;  2QY7 A;  2J9Q A;  3OP9 A;  4YAR A;  2B6C A;  4DX5 D;  1UG3 A;  5GAG i;  1FCH A;  2BNM A;  3D9P A;  4ABN A;  4ILG A;  1IQU A;  2IQC A;  5KJN A;  4WWO A;  2PXL A;  2ION A;  1TNU A;  5AAO A;  2XZT G;  3RRM B;  1EYH A;  1YYH A;  4F1S A;  3EHR A;  1O1R A;  1JWL A;  1YA0 A;  3NAW A;  2ICT A;  4GYW A;  4PU7 A;  1ZZ6 A;  5DSX A;  1QP7 A;  1K1A A;  2CRO A;  1LCD A;  3NBN B;  3PNT B;  3SZ7 A;  4U07 A;  5CBN A;  4H7X A;  1OWO A;  3LJ3 A;  3FU6 A;  1BD8 A;  2PUB A;  4UWK A;  2IF4 A;  4NDW A;  2F37 A;  1SQM A;  4B89 A;  2GRO B;  3CQG B;  4UQX A;  2Y4T A;  4GYY A;  3A9Z A;  1RZR A;  3BUA A;  1HZ4 A;  4KT6 B;  3SFY A;  4JHK A;  5ENO D;  3NZS A;  4OVU A;  3JXD L;  3Q5M A;  4YDO A;  2PQN A;  4JB8 P;  4YG7 B;  2LSU A;  3PZ3 A;  4GML A;  1UTX A;  4G11 A;  4F6R D;  4ATG A;  5C1D A;  4I6U A;  4B8A A;  3MZL B;  2AUW A;  4HRN A;  1PRA A;  5CCL A;  3BS3 A;  3PXP A;  3ESK A;  4CCA A;  4EHM A;  3QC1 A;  4DUI A;  4GTP A;  1D9S A;  2P9N G;  3RJV A;  3QK0 A;  4I6J A;  3RSE G;  1E96 B;  1IHG A;  3TWW A;  2AW6 A;  1HS6 A;  4E6H A;  3PDN A;  3FTV A;  4HNA D;  3GN5 B;  2V4L A;  4EZK A;  3DNV B;  2XRY A;  2BTD A;  4YG4 A;  1X81 A;  2DCP A;  5FJY A;  4O1P A;  2XPI A;  2FO7 A;  1ZVV A;  4HOU A;  2GGF A;  3VTX A;  3EJN A;  3D9L A;  5FTP A;  4JEH A;  4YBA A;  5HKP A;  1BLX B;  3FUE A;  4OAU C;  2AXV A;  3NXH A;  2QFC A;  1L1M A;  2RG8 A;  3OQM A;  5EDS A;  1OCC E;  1K3Z D;  3CHM A;  4J8D A;  2R02 A;  5AQB A;  1H0A A;  2KZT A;  3Q73 A;  2XS8 A;  4I9E A;  2XGS A;  3EU5 A;  3CEQ A;  1PAQ A;  3FUK A;  4F3V A;  4E85 A;  3FDH A;  3HXB A;  1UJK A;  3CHR A;  3HXD A;  2L1P A;  4I6G A;  3TEP A;  4NRH B;  4Q69 A;  1X5B A;  2MHK A;  2J4B A;  4J6I A;  1Z3X A;  4XKB A;  4YDY A;  3GW4 A;  3S7J A;  4O60 A;  2IU1 A;  2PZI A;  4OVV A;  4FHJ A;  3ASO E;  3A9X A;  3Q9N C;  2RKK A;  3AU5 A;  4B0Z A;  3NZU A;  1WIZ A;  4GAA A;  4MCT A;  3T5V A;  4A1G A;  3T8K A;  2L6J A;  4X4D A;  4DX6 D;  3ZVV A;  4GZD A;  4XIF A;  3UM2 A;  3NRO A;  3MLF A;  2OVB A;  4DLO A;  4FJZ A;  5BV1 A;  5A6C A;  1H6O A;  5KCM A;  3FUF A;  4UQY A;  4EQZ A;  3HG0 D;  5BV0 A;  5A7L A;  5FIO A;  2PXB A;  2X38 A;  3VWS A;  2JEK A;  2CHZ A;  1HE8 A;  2KZ8 A;  4FC8 A;  2CHW A;  1PC2 A;  2ZIS A;  3SX0 A;  2H6H A;  4UI9 J;  1H2T C;  1ZB1 A;  2PL2 A;  1NA0 A;  2PPX A;  4U04 A;  5AQ7 A;  2JAB A;  1MYO A;  2BNN A;  2P9P G;  3KJX A;  4WWN A;  3D9K A;  4FA6 A;  1JCR A;  3JXC L;  4N3B A;  1OSL A;  5CER B;  4JL0 A;  3HHM A;  3TL5 A;  4UUC A;  2AWI A;  3BQO A;  1N94 A;  3HXF A;  3FUL A;  4C48 B;  2LXM A;  4WAF A;  4CRW A;  3FEY A;  1MHQ A;  4U0Z A;  4YVQ C;  2FFH A; 
#chains in the Genus database with same CATH homology
 3CRO L;  4WNG A;  2OND A;  3Q47 B;  4L2Y A;  4U63 A;  4N39 A;  3L54 A;  3FTZ A;  3SBT B;  4BT9 A;  2HIN A;  5G04 J;  2B5A A;  2IVG A;  2LYP A;  3D1N I;  3PRZ A;  3PH0 C;  1E90 A;  3ONL A;  1EDU A;  4N5C A;  4MLP A;  3ASD A;  3HYM B;  2IU7 A;  3PE3 A;  3SCF A;  4X4B A;  1OWN A;  4YND A;  2KC7 A;  2R17 C;  2DBA A;  3DPD A;  4GCO A;  4WWP A;  4APF A;  5KJK A;  1QPZ A;  3FUJ A;  1Y6I A;  3Q15 A;  5G2N A;  3SNX A;  1WH8 A;  4Q94 A;  3UX4 A;  4BX8 A;  2CSF A;  2D5V A;  4KBQ A;  3OXG A;  1PRU A;  1ELW A;  2YHC A;  1ZAY A;  1Y9Q A;  4LCT A;  3QKY A;  4UWH A;  4Y42 A;  2EQX A;  4JC8 A;  1S7E A;  3QDN A;  3U64 A;  3VLF A;  1O4X A;  3CK8 A;  4ILI A;  3MV3 B;  1HXI A;  1CQT A;  3E4B A;  3LKU A;  4HOQ A;  3F52 A;  5K98 B;  1QQE A;  1QP0 A;  2HM8 A;  3FWV A;  4AJW A;  5BT1 A;  4GPK A;  3QAR A;  2E0I A;  5CCM A;  4I1M A;  2XI8 A;  3ULQ A;  2V8S E;  3TGO A;  3IV0 A;  3MJW A;  2O38 A;  3FMY A;  2DIW A;  3CQC B;  4AV7 A;  4I8T A;  2NC9 A;  5T3R A;  3JQ0 A;  4PDX A;  2WMN A;  4XZ4 A;  4CDM A;  4JHJ A;  4EBA A;  3LIS A;  4GZ5 A;  5HQ8 A;  3FU5 A;  4AEZ C;  5E75 A;  1X2L A;  4CT4 A;  1IC8 A;  2L9B A;  2XGO A;  2ILR A;  4GZ3 A;  4JVS A;  4I6T A;  1BDI A;  1GW6 A;  5AJD A;  5AJL A;  4DK5 A;  3QWG A;  4ILH B;  1IYG A;  3C98 A;  4JW1 A;  3FTS A;  1TJC A;  2XCJ A;  2WXM A;  3ZKC A;  4FLB A;  4BTA A;  3TRB A;  5FZR A;  3FFL A;  2XCB A;  1ELK A;  3NQP A;  3AS5 A;  3R7Q A;  4X4C A;  2PE5 A;  4XX5 A;  4L2L A;  4ANX A;  3L22 A;  2V0P A;  3LS8 A;  2BF0 X;  3HIZ A;  5FWQ A;  3RRN B;  2WB2 A;  2WQ6 A;  1HO8 A;  3LPZ A;  1L5J A;  1R63 A;  2Q7F A;  3CIA A;  2WXN A;  3CVV A;  3CVY A;  4OYS A;  2VSX E;  4U0S A;  1TEZ A;  2KCK A;  3IHV A;  1DNP A;  3RIB A;  3ML9 A;  4G25 A;  3CLC A;  5KJL A;  4BY6 A;  3D9O A;  3CSF A;  1OWM A;  2WXI A;  3FUI A;  3SI5 A;  3FTU A;  2R1J L;  1ZZB A;  3JUI A;  2IV1 A;  1QP4 A;  1HX8 A;  3UQ3 A;  3ZYL A;  2Y4U A;  5J08 A;  2WXR A;  2WQ7 A;  3R7R A;  4HVB A;  2IOL A;  4Z5D A;  1Y8M A;  2WVI A;  2CHX A;  4FJY A;  4PU8 A;  4JA9 A;  3FUH A;  3ZHE A;  4GA0 A;  3L17 A;  3LEW A;  2LSV A;  2BUG A;  4J8F A;  4I2W A;  4L7T A;  3NF1 A;  4A3V A;  4UWF A;  4BSX A;  2X6F A;  5JHB A;  4LER A;  3UFD A;  3F6W A;  3G2U A;  1PNR A;  1WET A;  3EHN A;  4XKC A;  4B0Z A;  4GB9 A;  3FH7 A;  1H2V C;  1PRV A;  3PEU B;  1PY1 A;  2HYZ A;  2FEZ A;  3QYX A;  3G2V A;  2WMO A;  1XGW A;  2VQ2 A;  1LMB 3;  1HU3 A;  3CLJ A;  4NQ0 A;  2WQH A;  1UW4 B;  4MRU A;  2VTB B;  4IUL A;  3ASF A;  4KVO A;  2MEZ A;  4ANU A;  2GRL A;  1DVP A;  2IFU A;  1DW9 A;  5DIZ A;  5HI7 A;  2ICP A;  3KEZ A;  4G2V A;  4N3A A;  3ZHE B;  5ARF A;  5EX3 A;  1QQB A;  3CHQ A;  3LCA A;  3ZYM A;  5M72 A;  4O6F A;  1ZZ7 A;  4WNF A;  5AEN A;  3VLE A;  4XI0 A;  4BFR A;  1YSE A;  4I1A A;  3OMT A;  3EDT B;  4U8H A;  1MQS A;  2GW1 A;  3EIQ C;  4JEU A;  3FH8 A;  4I9C A;  1DWK A;  3ZW3 A;  1H6K A;  4URK A;  2WXL A;  4LEU A;  4CEM A;  3OAW A;  4IA8 A;  3GZ2 A;  3CKB A;  3FTX A;  5BNW A;  3CHP A;  3HDX A;  2J49 A;  3LYA A;  4GU5 A;  4FBI A;  4K0R A;  3MKQ A;  4RSY A;  4TV3 A;  1RPE L;  4O8B A;  2MOW A;  2FJR A;  5G04 C;  1RIO A;  2OR1 L;  2WUS R;  4JQD A;  3RRU A;  5CMY A;  3U9W A;  3ZXS A;  2AVP A;  3D3M A;  1JWF A;  2LYR A;  4BWR A;  3PUK A;  3QJZ A;  3ENE A;  5T8I A;  4XE0 A;  4B8C B;  1XNF A;  4UI9 K;  4DLQ A;  2WXK A;  2KEK A;  3WXX A;  3PRE A;  3RK6 A;  3MCX A;  3QF3 A;  3I4R B;  2IJG X;  3S7F A;  1ZU2 A;  4PH4 B;  3OXF A;  3RKV A;  2KPJ A;  3KXA A;  3ESL A;  2PUG A;  3ZGQ A;  3UT8 A;  3LFP A;  3B7H A;  3T8M A;  4X4F A;  3OQO A;  3G2S A;  3GZS A;  4MKT A;  4Q96 A;  3PUJ A;  3L16 A;  1X57 A;  4KYO B;  3L13 A;  3HZI B;  5JJT A;  4F53 A;  2LNI A;  5FZQ A;  3SHF A;  3BEE A;  4KZC A;  2JVL A;  2OV8 A;  4Z5C A;  2XIU A;  1UJJ A;  2Y3A A;  3JYS A;  3LDZ A;  3OXL A;  2QY7 A;  4GZ6 A;  4BT8 A;  4A55 A;  5LFA A;  4CT0 A;  4N2Q A;  4CGW A;  2J9Q A;  4GA1 A;  5BW8 C;  3I3N A;  3TAX A;  3PZD A;  3OP9 A;  4YAR A;  1U3D A;  1Y7Y A;  3RO2 A;  1XWR A;  2YHE A;  3LXU X;  1N54 A;  2IVQ A;  2R5S A;  3UMV A;  3LY9 A;  2LYS A;  1UG3 A;  2XRZ A;  1FCH A;  5LCW C;  2BNM A;  3D9P A;  3BG0 B;  1CJG A;  1WM5 A;  2UY1 B;  4ABN A;  1UN9 A;  4PS8 A;  4ILG A;  2EF8 A;  4JPS A;  1IQU A;  2IQC A;  3G2T A;  4J1W A;  2BNO A;  1QZ2 A;  4PS3 A;  2LCV A;  5FZS A;  4WWO A;  5KJN A;  2GZU A;  3CST A;  5J90 A;  5LX8 A;  2ION A;  1E8W A;  2X6H A;  4GA2 A;  3F51 A;  1UN8 A;  4WUY A;  4DI4 A;  3SGH A;  4ACL A;  3RRM B;  2LYJ A;  2AXU A;  2A6C A;  1ZZ8 A;  2XHE A;  1EYH A;  2XJ3 A;  2J08 A;  4F1S A;  2VGX B;  1LF8 A;  1JWL A;  3GN5 A;  1YA0 A;  3QAQ A;  3Q49 B;  1W3B A;  2ICT A;  4PU7 A;  1ZZ6 A;  1SQ8 A;  1QP7 A;  2NXP A;  3CVL A;  4GYW A;  3QB2 A;  3LY7 A;  4X4I A;  3KAE A;  2CRO A;  1LCD A;  1FVH A;  3PNT B;  2UWJ G;  3MEK A;  4U07 A;  3SZ7 A;  4ACK A;  5LP0 A;  4DJA A;  3MV2 B;  1E8Z A;  4GMJ A;  4H7X A;  4AVX A;  4MS6 A;  3MX3 A;  4HS2 A;  1JFT A;  1OWO A;  1NZN A;  4JCX A;  3EIJ A;  4PUC A;  3LJ3 A;  3ZN3 A;  4ANV A;  3FU6 A;  4CDN A;  2PUB A;  4UWK A;  2IF4 A;  4NDW A;  1B89 A;  2PUA A;  1SQM A;  4G26 A;  2PUE A;  1U3C A;  3FU3 A;  4B89 A;  2L0I A;  1ZPQ A;  3URZ A;  5CMW A;  3CQG B;  3ASG A;  3ZYK A;  3FU0 A;  4UQX A;  2XQ0 A;  2Y4T A;  1LCC A;  4GYY A;  5AYW D;  3SBS A;  1Z6T A;  4UI9 C;  1BDH A;  5G05 J;  1RZR A;  3G7D A;  1HZ4 A;  4KT6 B;  3D9M A;  2VYI A;  2X6I A;  3JCK C;  4JHK A;  4Z58 A;  3NZS A;  4OVU A;  5FQ7 A;  3BG1 B;  4JCY A;  2EBY A;  3FTY A;  3DBS A;  1JH9 A;  4MCX A;  3P1U A;  3JXD L;  3Q5M A;  5E76 A;  3SD5 A;  3QWP A;  3O48 A;  4N2S A;  1A17 A;  3RU0 A;  1LLI A;  1WH6 A;  4AXH A;  2PQN A;  4YG7 B;  2LSU A;  4J8E A;  2VSN A;  4GML A;  5D0Q D;  1UTX A;  1OWL A;  3G5G A;  1JFS A;  2O4A A;  4G11 A;  5ANL A;  4ATG A;  3HVE A;  5C1D A;  3LVQ E;  2AXZ A;  3RZZ A;  4I6U A;  1E7V A;  1Z3Y A;  4OB4 A;  3CHO A;  3KS2 A;  3B7S A;  4B8A A;  4EQF A;  2R59 A;  3MZL B;  5A7D B;  2AUW A;  3CVP A;  4FUL A;  1PRA A;  2IOS A;  5C2Y A;  3R1F A;  3PVL A;  5CCL A;  2KEJ A;  2XPY A;  3QWW A;  2C2L A;  2CFZ A;  4WNE A;  4A1S A;  3BS3 A;  4X4G A;  2JCG A;  3PXP A;  3ESK A;  4CDR A;  4CCA A;  2HO1 A;  2M63 A;  3B7R L;  5BUZ A;  4LRZ A;  3QC1 A;  3L1P A;  2JLB A;  4AY6 A;  3RJV A;  3QK0 A;  4I6J A;  3QQ6 A;  5FT9 A;  4APO A;  4HOR A;  1NP7 A;  3GBF A;  1E96 B;  3FUD A;  1IHG A;  2IUO A;  4IN3 B;  4PS7 A;  2E2E A;  2AW6 A;  1OCT C;  1HS6 A;  2YIN A;  3S8Q A;  3L6A A;  4G1T A;  4Y6C A;  3CKC A;  5LOZ A;  4E6H A;  3PDN A;  4IRU A;  4D10 C;  4GCN A;  3FTV A;  3D9I A;  4I1O B;  2RD0 A;  3GN5 B;  3FH5 A;  3PEV B;  3OQN A;  2NSZ A;  2V4L A;  4RG6 A;  3APC A;  3SF4 A;  4EZK A;  3DNV B;  2XRY A;  4EZL A;  2BTD A;  2X6K A;  5LCW J;  5CHE E;  4R7L A;  4DPR A;  2PUC A;  2A4Z A;  3ML8 A;  3ZYQ A;  4YG4 A;  1HFA A;  4B94 A;  4LUN U;  3MA5 A;  4YVO A;  2WXQ A;  2GRM A;  4JXT A;  1PER L;  2DCP A;  5FJY A;  3D9N A;  4JA7 A;  3FP3 A;  4HOS A;  1HF8 A;  2XPI A;  1EFA A;  2FO7 A;  2J07 A;  1ZVV A;  4BX9 A;  4HOU A;  2WXH A;  1ZZ9 A;  2GGF A;  2LO6 A;  3EJN A;  3VTX A;  3D9L A;  5FTP A;  4Z59 A;  4JEH A;  1ZZC A;  5FQ8 A;  4KMO A;  4KXK B;  2FI7 A;  3CEC A;  4YBA A;  3T5X A;  3FUE A;  4HXI A;  2J09 A;  2CG3 A;  4TRQ A;  2AXV A;  4W9R A;  1SZA A;  2I1K A;  2QFC A;  2I1J A;  2WPV A;  3ZHM A;  4AM9 A;  1QQA A;  1H19 A;  1L1M A;  2RG8 A;  5A23 A;  3OQM A;  2H8R A;  2WM9 A;  1N52 A;  4Z5H A;  4PU4 C;  1OUV A;  4G23 A;  4FLH A;  5EDS A;  3CK9 A;  1INZ A;  3CGH A;  3U3W A;  3S7D A;  2XSD C;  2ZU6 B;  3CHM A;  4J8D A;  2OFY A;  2PIJ A;  1KT0 A;  4WND A;  1KT1 A;  1H0A A;  4Y6W A;  2KZT A;  2I9C A;  5D0O D;  1E8Y A;  5BPP A;  4I9E A;  2XGS A;  1GT0 C;  3B13 A;  5G05 C;  4AP2 A;  5JHA A;  2L8N A;  3CEQ A;  3O9X A;  1PAQ A;  3N71 A;  3FUK A;  4F3V A;  4FP7 A;  4E85 A;  2XEV A;  1E8X A;  1JPL A;  3FDH A;  2KCV A;  1UJK A;  2P58 C;  3CHR A;  3CR3 A;  2VGX A;  2WXG A;  3JXB C;  4I43 A;  5ENN A;  3CK7 A;  2KEI A;  4I6G A;  4GQM A;  4X4H A;  4X4E A;  1JUQ A;  1P5Q A;  4NRH B;  3B7T A;  2YNQ A;  2FUL A;  2YQ8 A;  4C0M A;  2PUF A;  3UUX A;  3AU4 A;  4Q69 A;  2O49 A;  1X5B A;  3U66 A;  2MHK A;  2J4B A;  4I6R A;  4J6I A;  1Z3X A;  4FHK A;  3MYV A;  4CGV A;  3L08 A;  4UWG A;  1ZS4 A;  4N3C A;  3FUM A;  4JZY A;  3I4G A;  3TG4 A;  1KLX A;  1WAO 1;  2CG2 A;  3EHM A;  4RVB A;  4HOT A;  3LVR E;  2KM4 A;  4XKB A;  3TG5 A;  4EZJ A;  3GW4 A;  3S7J A;  5AIJ A;  2WXJ A;  4C9B B;  3VTY A;  3HVE B;  1NER A;  1POU A;  1NA3 A;  2X3M A;  5DBK A;  3I5P A;  2VJ8 A;  2IU1 A;  1VDY A;  4GHJ A;  2PZI A;  1R69 A;  2X6J A;  3SCH A;  4FHJ A;  4K03 A;  2PQR A;  4IYP A;  4OVV A;  5ARG A;  3ZPJ A;  3ZEF A;  4F7A A;  2UY1 A;  3FTW A;  5JJ7 A;  3AS4 A;  3IHY A;  3ZHI A;  2OOE A;  2VTB A;  2PUD A;  2LYL A;  3IBE A;  3S2A A;  2R63 A;  2WIU B;  3H5T A;  2MRI A;  1RZS A;  3RO3 A;  4IVZ A;  4NUR A;  3AU5 A;  2C0M A;  1AU7 A;  1WIZ A;  3NZU A;  2WXP A;  2LYK A;  4MCT A;  3P2B A;  4GAA A;  3S7B A;  3T5V A;  4YG1 A;  3K9I A;  4A1G A;  3U4T A;  3KD7 A;  3QNK A;  2L6J A;  3FEX A;  3OTN A;  3Q4A B;  4IWR A;  5A6C A;  4X4D A;  4M3O A;  4NAC A;  1S0P A;  2L0T B;  2EWT A;  4AIF A;  4EBA G;  4FN3 A;  3CVQ A;  4HFG A;  3ZVV A;  3G2W A;  3UPV A;  4GZC A;  4C0E A;  4GZD A;  4XIF A;  2I6H A;  2VSO E;  3MGB A;  3QWV A;  4BTB A;  4AY5 A;  3D9J A;  3AS8 A;  3PS6 A;  1IQR A;  4ANW A;  4V3I A;  3CVW A;  3MKR A;  3MLF A;  4KZ0 A;  1E3O C;  1HG2 A;  4FAD A;  3KZ3 A;  1EPU A;  2V5F A;  3CVN A;  3ZRH A;  2OVB A;  5JJ6 A;  2MQK A;  3IEG A;  4FJZ A;  4UWL A;  4DLO A;  5BV1 A;  5KCM A;  2I2O A;  3FYA A;  2XPZ A;  3BD1 A;  3FUF A;  4RG9 A;  4UQY A;  4DI3 A;  3VK0 A;  5BV0 A;  3EUS A;  5A7L A;  3MKQ B;  4J0U A;  2L49 A;  2BJC A;  2X38 A;  2LYQ A;  1FVF A;  3JQ1 A;  3ZFW A;  3VLD A;  2PM7 A;  2JEK A;  1H2U A;  2CHZ A;  1HE8 A;  2KZ8 A;  1HG5 A;  3FY4 A;  2XCC A;  4FC8 A;  3BDN A;  2CHW A;  4QFV A;  3SFZ A;  4ME2 A;  4I2Z A;  1PC2 A;  1UXD A;  4EPZ A;  4UI9 J;  1H2T C;  2PL2 A;  3CVX A;  1HF0 A;  1NA0 A;  2PPX A;  3FHE A;  4L23 A;  4GYO A;  4U04 A;  4UQZ A;  1ADR A;  3LY8 A;  4KVM A;  4U0U A;  1E7U A;  4I6E A;  5FQ4 A;  3APF A;  4XI9 A;  4FU3 A;  5FQ6 A;  1ZBP A;  1SZ9 A;  5G55 A;  3APD A;  4PU3 C;  2FBN A;  5EX0 A;  3ASH A;  2CFU A;  3UT7 A;  2VGY A;  2BNN A;  4I17 A;  3CVU A;  4AOF A;  3ONK A;  3KJX A;  3GYZ A;  2LAI A;  4WWN A;  3IVP A;  3UT4 A;  3D9K A;  1UXC A;  3FUN A;  4A3T A;  5KJM A;  3B7U X;  2PM6 A;  4FA6 A;  2KZT B;  3JXC L;  1HH8 A;  2A5U A;  2WXO A;  1OSL A;  4JHR A;  4N3B A;  3R9A B;  3FYM A;  4EEC A;  1NEQ A;  1B0N A;  1EF1 C;  3IKO B;  3TJP A;  3O4Z A;  1VPW A;  2J4D A;  3PE4 A;  3QOU A;  4JL0 A;  3HHM A;  1OWP A;  4L1B A;  4TUU A;  5EKQ D;  3TXM A;  3GZ1 A;  3TL5 A;  4HLE A;  2WXF A;  4F8D A;  3CHS A;  2AWI A;  2OVF A;  1WY6 A;  1TJF A;  2C0L A;  1LQC A;  3ZIM A;  5T4Y A;  1ZUG A;  1BPO A;  2VSY A;  3FUL A;  1RZR D;  3CV0 A;  2IVB A;  4G24 A;  4P29 A;  4J8S A;  5ANR A;  2FF4 A;  2KCL A;  2XGM A;  4U0Z A;  1ELR A;  2KAT A;  2LAH A;  3PNL B;  1QNF A;  4H7Y A;  4CRW A;  4WAF A;  1JWG A;  3FEY A;  2HSG A;  4J1X A;  1MHQ A;  3SCG A;  4YVQ C;  2HR2 A;  3TXN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...