2AWAA

Crystal structure of dna polymerase iii, beta chain (ec 2.7.7.7) (np_344555.1) from streptococcus pneumoniae tigr4 at 2.50 a resolution
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
377
structure length
377
Chain Sequence
MIHFSINKNLFLQALNTTKRAISSKNAIPILSTVKIDVTNEGITLIGSNGQISIENFISQKNEDAGLLITSLGSILLEASFFINVVSSLPDVTLDFKEIEQNQIVLTSGKSEITLKGKDSEQYPRIQEISASTPLILETKLLKKIINETAFAASTQESRPILTGVHFVLSQHKELKTVATDSHRLSQKKLTLEKNSDDFDVVIPSRSLREFSAVFTDDIETVEIFFANNQILFRSENISFYTRLLEGNYPDTDRLIPTDFNTTITFNVVNLRQSMERARLLSSATQNGTVKLEIKDGVVSAHVHSPEVGKVNEEIDTDQVTGEDLTISFNPTYLIDSLKALNSEKVTISFISAVRPFTLVPADTDEDFMQLITPVRT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of DNA polymerase III, beta chain (EC 2.7.7.7) (np_344555.1) from STREPTOCOCCUS PNEUMONIAE TIGR4 at 2.50 A resolution
rcsb
molecule keywords DNA polymerase III, beta chain
molecule tags Transferase
source organism Streptococcus pneumoniae
total genus 94
structure length 377
sequence length 377
chains with identical sequence B, C, D
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2005-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00712 DNA_pol3_beta DNA polymerase III beta subunit, N-terminal domain
A PF02767 DNA_pol3_beta_2 DNA polymerase III beta subunit, central domain
A PF02768 DNA_pol3_beta_3 DNA polymerase III beta subunit, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.150.10 Alpha Beta Roll DNA Polymerase III; Chain A, domain 2 DNA Polymerase III, subunit A, domain 2 2awaA01
3.70.10.10 Alpha Beta Box Proliferating Cell Nuclear Antigen Proliferating Cell Nuclear Antigen 2awaA02
2Z0LA 3P91A 4N95A 4L6PA 3L0WA 4TR6A 5FVEA 2ZVMA 3A1JC 3LX2A 3AIXA 1AXCA 5E0TA 4ZTDA 3Q4KA 3RB9A 4K3MA 3PWEA 4K74A 1DMLA 4OVHA 1IZ5A 3G65B 3P87A 2HIKC 3FDSC 3A1JA 4K3OA 3LX1A 3AIZC 4TRTA 3D1GA 4TR7A 2ZVLA 4PNVA 3F1VA 3D1FA 3K4XA 1CZDA 3U5ZF 1UL1A 2HIKA 2IZOC 1ISQA 4MJRA 3AIZA 5HACA 2POLA 3V60B 4YHRA 1RXMA 1YYPA 5IY4A 1UNNA 3QSBA 4L60A 3TBLA 2NTIC 1MMIA 5AUJA 1PLQA 4N9AA 2IO4A 2XURA 4N94A 3V62B 1JQJA 5E0UA 5H0TA 5FRQA 5AGVA 1RXZA 4TR8A 2IX2B 3L0XA 3GGRB 1RWZA 3P16A 2HIIC 5DA7A 4N99A 4MJQA 4MJPA 1U76A 2NTIA 2OD8A 3FDSD 4K3LA 5IXAA 1B77A 3Q4LA 3F1WA 3AIXB 4K3SA 2AWAA 5B7OA 3WGWA 2HIIA 1OK7A 4RKIA 3D1EA 5AH2A 1T6LA 3G65C 4TSZA 3HI8A 3A1JB 2IX2C 1IZ4A 4K3KA 5JNED 4PNWA 3V61B 1B8HA 4S3IA 1PLRA 3U60F 1VYMA 5IWDA 1GE8A 4PNUA 3G65A 5AGUA 2HIKB 3PGEB 3BEPA 5A6DA 3Q4JA 1UD9A 2ZVWA 5E0VA 3GPMA 4D2GA 1W60A 1SXJF 4HK1A 3I2MX 3QSBB 1VYJA 3IFVA 3A2FB 3L10A 4K3PA 4CS5A 2IZOB 1U7BA 3P83A 3U61F 2IO4B 4N98A 2IJXA 5AH4A 2ZVVA 4K3RA 4RJFA 3GGRC 5DAIA 2NTIB 3GPNA 1JQLA 4OVGA 2ZVKA 3HSLX 4N97A 4OVFA 4K3QA 3T0PA 2IX2A 1VPKA 3VKXA 4N96A 3GGRA 5CFKA 2HIIB 2AVTA
chains in the Genus database with same CATH superfamily
2Z0LA 3P91A 4N95A 4L6PA 3L0WA 4TR6A 5FVEA 2ZVMA 3A1JC 3LX2A 3AIXA 1AXCA 5E0TA 4ZTDA 3Q4KA 3RB9A 4K3MA 3PWEA 4K74A 1DMLA 4OVHA 1IZ5A 3G65B 3P87A 2HIKC 3FDSC 3A1JA 4K3OA 3LX1A 3AIZC 4TRTA 3D1GA 4TR7A 2ZVLA 4PNVA 3F1VA 3D1FA 3K4XA 1CZDA 3U5ZF 1UL1A 2HIKA 3PGEA 3L10B 2IZOC 1ISQA 4MJRA 3AIZA 5HACA 2POLA 3V60B 4YHRA 1RXMA 1YYPA 5IY4A 1UNNA 3QSBA 4L60A 3TBLA 2NTIC 1MMIA 5AUJA 1PLQA 4N9AA 2IO4A 2XURA 4N94A 3V62B 1JQJA 5E0UA 5H0TA 5FRQA 5AGVA 1RXZA 4TR8A 2IX2B 3L0XA 3GGRB 1RWZA 3P16A 2HIIC 5DA7A 4N99A 4MJQA 4MJPA 1U76A 2NTIA 2OD8A 3FDSD 4K3LA 3L0WB 5IXAA 1B77A 3Q4LA 3F1WA 3AIXB 4K3SA 2AWAA 5B7OA 3WGWA 2HIIA 1OK7A 4RKIA 3D1EA 5AH2A 1T6LA 3G65C 4TSZA 3HI8A 3A1JB 2IX2C 1IZ4A 4K3KA 5JNED 4PNWA 3V61B 1B8HA 4S3IA 1PLRA 3U60F 1VYMA 5IWDA 1GE8A 4PNUA 3G65A 5AGUA 2HIKB 3PGEB 3BEPA 5A6DA 3Q4JA 1UD9A 2ZVWA 5E0VA 3GPMA 4D2GA 1W60A 1SXJF 4HK1A 3I2MX 3QSBB 1VYJA 3IFVA 3A2FB 3L10A 4K3PA 4CS5A 2IZOB 1U7BA 3P83A 3U61F 2IO4B 4N98A 2IJXA 5AH4A 2ZVVA 4K3RA 4RJFA 3L0XB 3GGRC 5DAIA 2NTIB 3GPNA 1JQLA 4OVGA 2ZVKA 3HSLX 4N97A 4OVFA 4K3QA 3T0PA 2IX2A 1VPKA 3VKXA 4N96A 3GGRA 5CFKA 2HIIB 2AVTA
chains in the Genus database with same CATH topology
2Z0LA 3P91A 4N95A 4L6PA 3L0WA 4TR6A 5FVEA 2ZVMA 3A1JC 3LX2A 3AIXA 1AXCA 5E0TA 4ZTDA 3Q4KA 3RB9A 4K3MA 3PWEA 4K74A 1DMLA 4OVHA 1IZ5A 3G65B 3P87A 2HIKC 3FDSC 3A1JA 4K3OA 3LX1A 3AIZC 4TRTA 3D1GA 4TR7A 2ZVLA 4PNVA 3F1VA 3D1FA 3K4XA 1CZDA 3U5ZF 1UL1A 2HIKA 2IZOC 1ISQA 4MJRA 3AIZA 5HACA 2POLA 3V60B 4YHRA 1RXMA 1YYPA 5IY4A 1UNNA 3QSBA 4L60A 3TBLA 2NTIC 1MMIA 5AUJA 1PLQA 4N9AA 2IO4A 2XURA 4N94A 3V62B 1JQJA 5E0UA 5H0TA 5FRQA 5AGVA 1RXZA 4TR8A 2IX2B 3L0XA 3GGRB 1RWZA 3P16A 2HIIC 5DA7A 4N99A 4MJQA 4MJPA 1U76A 2NTIA 2OD8A 3FDSD 4K3LA 5IXAA 1B77A 3Q4LA 3F1WA 3AIXB 4K3SA 2AWAA 5B7OA 3WGWA 2HIIA 1OK7A 4RKIA 3D1EA 5AH2A 1T6LA 3G65C 4TSZA 3HI8A 3A1JB 2IX2C 1IZ4A 4K3KA 5JNED 4PNWA 3V61B 1B8HA 4S3IA 1PLRA 3U60F 1VYMA 5IWDA 1GE8A 4PNUA 3G65A 5AGUA 2HIKB 3PGEB 3BEPA 5A6DA 3Q4JA 1UD9A 2ZVWA 5E0VA 3GPMA 4D2GA 1W60A 1SXJF 4HK1A 3I2MX 3QSBB 1VYJA 3IFVA 3A2FB 3L10A 4K3PA 4CS5A 2IZOB 1U7BA 3P83A 3U61F 2IO4B 4N98A 2IJXA 5AH4A 2ZVVA 4K3RA 4RJFA 3GGRC 5DAIA 2NTIB 3GPNA 1JQLA 4OVGA 2ZVKA 3HSLX 4N97A 4OVFA 4K3QA 3T0PA 2IX2A 1VPKA 3VKXA 4N96A 3GGRA 5CFKA 2HIIB 2AVTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z0L A;  3P91 A;  4N95 A;  4L6P A;  3L0W A;  4TR6 A;  5FVE A;  2ZVM A;  3A1J C;  3LX2 A;  3AIX A;  1AXC A;  5E0T A;  4ZTD A;  3Q4K A;  3RB9 A;  4K3M A;  3PWE A;  4K74 A;  1DML A;  4OVH A;  1IZ5 A;  3G65 B;  3P87 A;  2HIK C;  3FDS C;  3A1J A;  4K3O A;  3LX1 A;  3AIZ C;  4TRT A;  3D1G A;  4TR7 A;  2ZVL A;  4PNV A;  3F1V A;  3D1F A;  3K4X A;  1CZD A;  3U5Z F;  1UL1 A;  2HIK A;  2IZO C;  1ISQ A;  4MJR A;  3AIZ A;  5HAC A;  2POL A;  3V60 B;  4YHR A;  1RXM A;  1YYP A;  5IY4 A;  1UNN A;  3QSB A;  4L60 A;  3TBL A;  2NTI C;  1MMI A;  5AUJ A;  1PLQ A;  4N9A A;  2IO4 A;  2XUR A;  4N94 A;  3V62 B;  1JQJ A;  5E0U A;  5H0T A;  5FRQ A;  5AGV A;  1RXZ A;  4TR8 A;  2IX2 B;  3L0X A;  3GGR B;  1RWZ A;  3P16 A;  2HII C;  5DA7 A;  4N99 A;  4MJQ A;  4MJP A;  1U76 A;  2NTI A;  2OD8 A;  3FDS D;  4K3L A;  5IXA A;  1B77 A;  3Q4L A;  3F1W A;  3AIX B;  4K3S A;  2AWA A;  5B7O A;  3WGW A;  2HII A;  1OK7 A;  4RKI A;  3D1E A;  5AH2 A;  1T6L A;  3G65 C;  4TSZ A;  3HI8 A;  3A1J B;  2IX2 C;  1IZ4 A;  4K3K A;  5JNE D;  4PNW A;  3V61 B;  1B8H A;  4S3I A;  1PLR A;  3U60 F;  1VYM A;  5IWD A;  1GE8 A;  4PNU A;  3G65 A;  5AGU A;  2HIK B;  3PGE B;  3BEP A;  5A6D A;  3Q4J A;  1UD9 A;  2ZVW A;  5E0V A;  3GPM A;  4D2G A;  1W60 A;  1SXJ F;  4HK1 A;  3I2M X;  3QSB B;  1VYJ A;  3IFV A;  3A2F B;  3L10 A;  4K3P A;  4CS5 A;  2IZO B;  1U7B A;  3P83 A;  3U61 F;  2IO4 B;  4N98 A;  2IJX A;  5AH4 A;  2ZVV A;  4K3R A;  4RJF A;  3GGR C;  5DAI A;  2NTI B;  3GPN A;  1JQL A;  4OVG A;  2ZVK A;  3HSL X;  4N97 A;  4OVF A;  4K3Q A;  3T0P A;  2IX2 A;  1VPK A;  3VKX A;  4N96 A;  3GGR A;  5CFK A;  2HII B;  2AVT A; 
#chains in the Genus database with same CATH topology
 2Z0L A;  3P91 A;  4N95 A;  4L6P A;  3L0W A;  4TR6 A;  5FVE A;  2ZVM A;  3A1J C;  3LX2 A;  3AIX A;  1AXC A;  5E0T A;  4ZTD A;  3Q4K A;  3RB9 A;  4K3M A;  3PWE A;  4K74 A;  1DML A;  4OVH A;  1IZ5 A;  3G65 B;  3P87 A;  2HIK C;  3FDS C;  3A1J A;  4K3O A;  3LX1 A;  3AIZ C;  4TRT A;  3D1G A;  4TR7 A;  2ZVL A;  4PNV A;  3F1V A;  3D1F A;  3K4X A;  1CZD A;  3U5Z F;  1UL1 A;  2HIK A;  3PGE A;  3L10 B;  2IZO C;  1ISQ A;  4MJR A;  3AIZ A;  5HAC A;  2POL A;  3V60 B;  4YHR A;  1RXM A;  1YYP A;  5IY4 A;  1UNN A;  3QSB A;  4L60 A;  3TBL A;  2NTI C;  1MMI A;  5AUJ A;  1PLQ A;  4N9A A;  2IO4 A;  2XUR A;  4N94 A;  3V62 B;  1JQJ A;  5E0U A;  5H0T A;  5FRQ A;  5AGV A;  1RXZ A;  4TR8 A;  2IX2 B;  3L0X A;  3GGR B;  1RWZ A;  3P16 A;  2HII C;  5DA7 A;  4N99 A;  4MJQ A;  4MJP A;  1U76 A;  2NTI A;  2OD8 A;  3FDS D;  4K3L A;  3L0W B;  5IXA A;  1B77 A;  3Q4L A;  3F1W A;  3AIX B;  4K3S A;  2AWA A;  5B7O A;  3WGW A;  2HII A;  1OK7 A;  4RKI A;  3D1E A;  5AH2 A;  1T6L A;  3G65 C;  4TSZ A;  3HI8 A;  3A1J B;  2IX2 C;  1IZ4 A;  4K3K A;  5JNE D;  4PNW A;  3V61 B;  1B8H A;  4S3I A;  1PLR A;  3U60 F;  1VYM A;  5IWD A;  1GE8 A;  4PNU A;  3G65 A;  5AGU A;  2HIK B;  3PGE B;  3BEP A;  5A6D A;  3Q4J A;  1UD9 A;  2ZVW A;  5E0V A;  3GPM A;  4D2G A;  1W60 A;  1SXJ F;  4HK1 A;  3I2M X;  3QSB B;  1VYJ A;  3IFV A;  3A2F B;  3L10 A;  4K3P A;  4CS5 A;  2IZO B;  1U7B A;  3P83 A;  3U61 F;  2IO4 B;  4N98 A;  2IJX A;  5AH4 A;  2ZVV A;  4K3R A;  4RJF A;  3L0X B;  3GGR C;  5DAI A;  2NTI B;  3GPN A;  1JQL A;  4OVG A;  2ZVK A;  3HSL X;  4N97 A;  4OVF A;  4K3Q A;  3T0P A;  2IX2 A;  1VPK A;  3VKX A;  4N96 A;  3GGR A;  5CFK A;  2HII B;  2AVT A; 
#chains in the Genus database with same CATH homology
 2Z0L A;  3P91 A;  4N95 A;  4L6P A;  3L0W A;  4TR6 A;  5FVE A;  2ZVM A;  3A1J C;  3LX2 A;  3AIX A;  1AXC A;  5E0T A;  4ZTD A;  3Q4K A;  3RB9 A;  4K3M A;  3PWE A;  4K74 A;  1DML A;  4OVH A;  1IZ5 A;  3G65 B;  3P87 A;  2HIK C;  3FDS C;  3A1J A;  4K3O A;  3LX1 A;  3AIZ C;  4TRT A;  3D1G A;  4TR7 A;  2ZVL A;  4PNV A;  3F1V A;  3D1F A;  3K4X A;  1CZD A;  3U5Z F;  1UL1 A;  2HIK A;  2IZO C;  1ISQ A;  4MJR A;  3AIZ A;  5HAC A;  2POL A;  3V60 B;  4YHR A;  1RXM A;  1YYP A;  5IY4 A;  1UNN A;  3QSB A;  4L60 A;  3TBL A;  2NTI C;  1MMI A;  5AUJ A;  1PLQ A;  4N9A A;  2IO4 A;  2XUR A;  4N94 A;  3V62 B;  1JQJ A;  5E0U A;  5H0T A;  5FRQ A;  5AGV A;  1RXZ A;  4TR8 A;  2IX2 B;  3L0X A;  3GGR B;  1RWZ A;  3P16 A;  2HII C;  5DA7 A;  4N99 A;  4MJQ A;  4MJP A;  1U76 A;  2NTI A;  2OD8 A;  3FDS D;  4K3L A;  5IXA A;  1B77 A;  3Q4L A;  3F1W A;  3AIX B;  4K3S A;  2AWA A;  5B7O A;  3WGW A;  2HII A;  1OK7 A;  4RKI A;  3D1E A;  5AH2 A;  1T6L A;  3G65 C;  4TSZ A;  3HI8 A;  3A1J B;  2IX2 C;  1IZ4 A;  4K3K A;  5JNE D;  4PNW A;  3V61 B;  1B8H A;  4S3I A;  1PLR A;  3U60 F;  1VYM A;  5IWD A;  1GE8 A;  4PNU A;  3G65 A;  5AGU A;  2HIK B;  3PGE B;  3BEP A;  5A6D A;  3Q4J A;  1UD9 A;  2ZVW A;  5E0V A;  3GPM A;  4D2G A;  1W60 A;  1SXJ F;  4HK1 A;  3I2M X;  3QSB B;  1VYJ A;  3IFV A;  3A2F B;  3L10 A;  4K3P A;  4CS5 A;  2IZO B;  1U7B A;  3P83 A;  3U61 F;  2IO4 B;  4N98 A;  2IJX A;  5AH4 A;  2ZVV A;  4K3R A;  4RJF A;  3GGR C;  5DAI A;  2NTI B;  3GPN A;  1JQL A;  4OVG A;  2ZVK A;  3HSL X;  4N97 A;  4OVF A;  4K3Q A;  3T0P A;  2IX2 A;  1VPK A;  3VKX A;  4N96 A;  3GGR A;  5CFK A;  2HII B;  2AVT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...