2AWCA

Deoxy-dcrh-hr
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
130
structure length
130
Chain Sequence
VKWSEDLANLPSIDTQHKRLVDYINDLYRAARRRDMDKAREVFDALKNYAVEHFGYEERLFADYAYPEATRHKEIHRRFVETVLKWEKQLAAGDPEVVMTTLRGLVDWLVNHIMKEDKKYEAYLRERGVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hemerythrin-like domain protein DcrH
publication title Structural Basis for O(2) Sensing by the Hemerythrin-like Domain of a Bacterial Chemotaxis Protein: Substrate Tunnel and Fluxional N Terminus
pubmed doi rcsb
source organism Desulfovibrio vulgaris
molecule tags Oxygen storage/transport
total genus 61
structure length 130
sequence length 130
ec nomenclature
pdb deposition date 2005-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01814 Hemerythrin Hemerythrin HHE cation binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.50 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Hemerythrin-like 2awcA00
1I4YA 2AWYA 3WAQA 2AWCA 1A7DA 1HMDA 1A7EA 4XPXA 4XPYA 4XQ1A 4XPWA 1I4ZA 3WHNA 2HMQA 3AGTA 2MHRA 2AVKA 1HMOA 2HMZA 3AGUA
chains in the Genus database with same CATH superfamily
4JTCB 2XLEA 3EGXA 1S7ZA 3MLGA 5A6JA 4J7YA 4LACB 1OW8A 2L6GA 3CSKA 3DWWA 3TULA 4ER9A 1OR3A 1TWGA 3QW1A 4P9FA 4CS9A 4Q7CA 4DRHB 2IBFA 2Q9AA 4K1OA 4OIQF 4P9TA 1LE4A 2DI3A 4A4AA 1C03A 5A6AA 3X2QC 4XPXA 3U8PA 3RF3A 5A6BA 4D4NA 3W4YA 5L0CA 1VYKA 4U5DE 4YL0A 3TOLA 3LJBA 5AC5A 4MVUA 3ECSA 3AG4C 5L0JA 4LLEA 4XEVA 4K7BA 3S9OA 1QVXA 5B3SC 3W2WA 4PFOA 4DVYP 4C7OA 3DM5A 4H54A 3ABLC 2YLGA 5T3WA 2AVKA 4P6IC 4FESA 3PCVA 5JP7A 5DS4A 1IZMA 3IHUA 4PR9A 5EGYA 3RFYA 3ZG1A 4KC9A 1RCPA 2OU6A 4NTFA 5FCLA 2NUTB 2AP3A 5D91A 3T6BA 4YWQA 1F1MA 1TWCA 2VCCA 2R7TA 2BC5A 4JW1A 1HE1A 1Z5ZA 2ICWG 1L3PA 3K1HA 4EHPA 1LI7A 2W9YA 4JC7A 4C3EA 1Z63A 2WZLA 1EA8A 2EINC 2G3KA 3NYMA 5JSLA 1LM3B 2RD9A 1D1CA 3N2ZB 1MMGA 2NUPA 3M4BA 1E86A 1M6TA 1ORSC 1ZHYA 2R05A 2A6HF 2HMQA 4EBKA 3TD7A 4CJGA 4F4BA 1ZHTA 3LS0A 1NFOA 4DRIB 1QPUA 1IW7F 3US6A 4YT8A 4EIYA 5E3CA 1LI5A 1LVKA 3EH2A 4MS2A 4U5CE 4IGGA 5L0IA 4I1MA 2KJGA 5FZTA 1JPNA 2WVNA 3S29A 4FX5A 1KNYA 1ZU4A 3ZSUA 1YZAA 3FOPA 2YL0A 2EIKC 4CS8A 2Y3HA 3QZCA 2F22A 2VCBA 4IJJA 4DBRA 3T6GB 3C8GD 3B0PA 3FAJA 5L0FA 1TFKB 3VF0A 2Q3TA 1GS9A 3X1OA 3ZVRA 2ZXOA 1YYXA 1ZZPA 1HE9A 3DJUB 4MTGA 4XQ1A 3UMIA 1M57C 2R7SA 3V5YA 4JTAB 1MNDA 1YLMA 4NCQA 4MVQA 4PK4A 2MHRA 1OW6A 4E0HA 1M2OA 1QSPA 1A0BA 2A68F 1PD0A 3NYJA 2Y69C 1GM5A 2B0JA 1D0ZA 2A6EF 3IEEA 1U89A 5E2QA 4AK9A 1EKYA 4DJ9A 2H7BA 4XLPF 1I4YA 2HV7A 1G4WR 1MMDA 4U9EA 1YA9A 4Q5SF 1XZPA 1K05A 1UFBA 4XTKA 5AGFA 4CSAC 2LFFA 3GEHA 1OXKA 2I8BA 3BEHA 5CI9A 1MMAA 2OJQA 3GODA 3O39A 5KYXA 2PBEA 3HNLA 1RKCA 1BR4A 3GWLA 3BRJA 4PJMA 4RDAA 3R7CA 5F5HA 3U5SA 4EBBA 1VK5A 3JZ0A 1AEPA 3L34A 1H7IA 3ZQVA 3K6BA 4R32A 3TK0A 1NLXA 1K40A 2FGYA 5TJ5E 4QI0A 3SEOA 256BA 2CDQA 3RQGA 1WASA 4GQHA 3RQFA 4HE8D 3TJ5A 3GWNA 4XLNF 3RW0A 4JEAA 3ZQYA 4MNDA 4O7GA 5A69A 3FAPB 4JCHA 2HSQA 2A0UA 4ANJA 3HKKA 1ZHXA 2EPLX 3RVYA 1WN0A 2VC9A 3GM3A 3N24A 4PJLA 2KW3C 1MQVA 5T1DB 2DGJA 3HJCA 1O87A 1U6HA 4U9DA 2PNOA 2PP4A 4KNWA 1Y4CA 3DXJF 3JCUQ 4JEBA 3SZRA 1AUEA 1V74B 4N6HA 2LK4A 1NBBA 1VYIA 2XSEA 3EPVA 5KYUB 2QTVA 2VASA 3AG3C 4C3DA 4BJ5A 1GGQA 1K04A 4U5BE 5BQGA 2YLIA 3U9JA 4AL1A 3DAFA 1O5HA 3FOOA 2ZXPA 3A9CA 3ASNC 3ABKC 3C8ZA 2XLVA 4FWVA 3EGDB 5KYWA 5L3VA 1H9GA 2Q9BA 1J8YF 2UUIA 1T9KA 4W8PA 4BG0A 3AGUA 2H7VC 5KYYA 4JE9A 1NG1A 1VTMP 3JYYA 2NPUA 4CX9A 3C63A 1OW7A 1RKEA 5A6KA 4JCZA 4AE4A 4WJ0A 4ULWA 3GEIA 3CEXA 4HEAJ 5DVWA 4OIPF 4E7SA 5DS6A 4BEMJ 2KK1A 2B0HA 2IOQA 3NKEA 1Q0GA 4LDKA 1YZCA 3Q6MA 4XPWA 2IYLD 2KSFA 1FTSA 3O6XA 3EHNA 4Z9JA 1YVIA 3NMJA 4Q4ZF 1ZHZA 2CCYA 3U8VA 1ZW3A 2YKZA 3KPHA 2PF4E 3MYFA 3U2MA 2TMVP 1OQCA 4PACA 3U3FA 4OINF 5L0DA 4JURI 1ST6A 2LCHA 4E17A 1V4AA 3CQZA 4CDYA 2R7OA 2R9RB 3AQCA 2KC3A 3NYLA 4NY3A 1YA7O 3H2UA 5BQHA 1APCA 3GM1A 5E3AA 2L7AA 3UGOA 1MMNA 3AJMA 3DM9B 2XM4A 2VCAA 3C8GB 3UR3C 3HNJA 3NMIA 3R2PA 4G0HA 5BQIA 3C7JA 3S90A 4OIRF 4U5HA 2Q9CA 2XS8A 1Z6AA 4G7OF 4HFKB 3W8IA 3W2VA 3HLZA 5BUOA 5KYNA 4MTOA 2P1AA 4OD5A 2LIGA 2PX0A 2RSEB 2R7UA 2R7QA 3KKBA 4WGYA 3U3BA 2EIMC 1FAPB 2EPOA 3LS1A 3UMKA 2Y3DA 4U5GA 2LQGA 4MQ9F 4OIOF 4N4WA 3MYIA 5JVEA 1XZQA 2XS1A 1LKXA 1Q0DA 3OWTA 3NRHA 3FMSA 2WVQA 1SYQA 1LIHA 3ZWIA 2DYRC 1UG7A 1CPRA 2HJ3A 3DAGA 4BJ1A 2HJMA 1CGOA 2HKVA 1PD1A 1R4TA 1T6UA 4YL1A 3K7DA 5L0HA 4H4KC 4I3MA 3B71A 2J8WA 5AC4A 2YL3A 3SXKA 5COMA 3IPMO 3EFOB 5JT4A 1ZW2A 2Y3BA 4OD4A 2MWQA 1OR2A 3B0UX 2A1DD 1RJ9B 1LE2A 4YT5A 1V55C 3SXYA 1BR1A 3W8HA 3K1IC 1WWPA 1JMWA 2HFIA 3RYLA 3KL4A 5KYWB 2L6HA 3EG9A 3CAXA 4U5EE 4XEFA 2CYDA 5JS5A 1EQ1A 1TQGA 1MNEA 3I4UA 1RMVA 2QNLA 1QZXA 3B9QA 3EGXB 2P0NA 4JRZA 5DQTA 1SMYF 2XRHA 3O10A 3EH1A 2WB7A 3N0TA 2YVKA 2HV6A 2EPKX 2IXNA 2M4EA 4JJGA 3MBGA 4Z9IA 2XXAA 3UNGC 3KYIA 2EIJC 2Y39A 3SNHA 1SZIA 5IY5C 2FAPB 2YZSA 2J9WA 1HW2A 4LDRA 5COGA 4MVOA 2J9VA 1D0XA 4DRJB 1HMDA 4I44A 1A7EA 2R02A 3A11A 4CBEA 4DBQA 4C7OB 4YL3A 1Y6DA 2ZXWC 3DKAA 1O3UA 2IXOA 3L8IA 4O6YA 5CIVA 3NKDA 3LNRA 2OJED 1V54C 4JZAA 1A41A 3DI5A 5CI8A 1DOVA 4YJWA 3T6JA 3V7OA 3JT1A 2LP4A 1WOLA 4WGZA 3PDMP 5B1BC 2XLOA 3AOUA 2IXMA 3E70C 1NFNA 2A0BA 2JX0A 1FFHA 3ASOC 3HTKC 2C03A 4X0RA 2XM0A 1BR2A 3PMRA 2AU5A 1GQAA 3MFNA 3S28A 4QI2A 1T6QA 4XWJA 3LEOA 3QMKA 4MVRA 3FVYA 3SP1A 4K0DA 4BJ5C 2L6FA 3ZDLA 1BBHA 2KGOA 5T3TA 4NTAA 5HV9A 2V3CC 2NUTA 1E84A 2NUPB 1ZHWA 1PV3A 2WVOA 3GORA 3F46A 2Q4FA 3NDBB 4HFFB 2ZPAA 3IQ5A 1OCOC 3QW0A 4NQFA 3TJ6A 1D0YA 1W2WA 1N1CA 1G8XA 4IAOA 3POVA 3U0CA 2YWAA 3ITFA 2QY9A 2UUHA 4CIHA 2LD6A 3WHNA 1LPEA 3FXHA 3DJNB 4NC3A 1D1BA 4D4XA 4IWBA 4GEHA 4W8KA 1Z23A 3ZC4A 4CJOA 2W4BA 1Q0KA 1TWAA 3KYJA 2G3VA 2R7WA 2R7VA 2NG1A 4DOZA 2YHSA 4RBNA 2HUJA 4WABA 1ORJA 1HW1A 2R25A 1QKRA 3VAYA 4DXWA 1ZYRF 4AX2A 3EJNA 1ZU5A 1YJGA 2QE9A 2QUPA 3H65A 2XLDA 3EHMA 4KBLA 4JIOA 3V5ZA 4O6MA 3VRCA 2NSFA 1VB5A 2R03A 1QLEC 2NSGA 3LNMB 4G7HF 3B29A 3KMIA 2XLHA 3EZIA 3RIPA 4MTFA 4JJFA 2QLAA 1TFOB 2HZ8A 1YARO 2D5RB 1NZEA 3DZAA 4JKVA 4YK5A 2OCCC 2IM8A 2LFDA 4BJ6A 1A7VA 3K33A 2J45A 2J9UA 1KTMA 3Q7GA 3IQCA 4E7ZA 4B6IA 1M2VA 1R5ID 1OCCC 2W4MA 3ZTZA 4CS7A 2YLDA 3TQOA 2AWYA 2JD3A 4JTDB 2XLWA 4FAPB 3J06A 3M1CB 5KYXB 3ATPA 4GYTA 3VM6A 1VLTA 2VH3A 3GANA 3L0IA 3F47A 3H2VA 2GFHA 3DE9A 4MVMA 3IQ6A 3RH3A 1JPJA 3T4RA 2CNWA 3JRMO 2J0XA 1H6GA 5DLJA 2GA0A 3S0XA 2BL2A 1OKKD 2WL8A 2YL7A 3NG1A 1YDIA 2MYSA 2H7OA 2R7XA 2OOCA 3EZHA 1CPQA 3PHF2 3CZ6A 2Z15A 3C18A 2YRFA 3K66A 1G5ZA 2H8AA 4YN0B 3C62A 3GEEA 3MX3A 2ASRA 2L9JA 5COFA 4CS8C 1G4US 2ETSA 4LERA 5K0IA 2J7PA 3WG7C 4EUKB 4MW3A 2Y3GA 1VOMA 4DVZA 5F5FA 2XLMA 3RKOF 2HS5A 2YQYA 1HY5A 2AWCA 2WZFA 2FFHA 3AG1C 3AQBA 4MVSA 2A69F 3ABMC 3AG2C 3L8JA 5L3QA 3B0VC 1TKNA 1PCXA 1CGNA 2LSEA 3DMDA 2I15A 2HSBA 5F28E 4KI2A 3S27A 4EWCA 1Z7Qc 1JOGA 3U2LA 1C02A 1B68A 1YYJA 5HSWA 1OCZC 1NSGB 2PFDA 4AL0A 4MVZA 4J32B 1NU7D 3G50A 2D4UA 3HNIA 5KYUA 3JRTA 4RD9A 1OKKA 2EPNA 3DD7A 2M64A 5L0GA 2X0CA 2P6VA 3LLKA 3AGTA 2GWWA 3I5QA 1FFTC 1NU9C 4EBJA 4O6NA 4YT4A 2Q00A 3M15A 5KYYB 1BZ4A 2J0WA 1E85A 2J9BA 2X51A 1YAUO 3NMKA 1JRAA 5DS5A 2O9XA 3Q7LA 1RKEB 4LLCA 4NTBA 5JUAA 4IARA 4AE4B 3EGDA 2YL1A 3QVZA 3WAQA 4ONSA 2WZGA 1XWJA 5EHHA 4G78A 3UGPA 4YT2A 1WTYA 3GM2A 2ZXRA 4M63A 4PJJA 3VYWA 1TR2A 2OG2A 4BPMA 3QTHA 5E33A 4KNVA 4MW8A 1WATA 1Q0FA 4XPYA 2Q7RA 3JTLO 4ZLCA 1D1AA 1I4ZA 1FNTc 3ZIBA 3LEVA 5GPGB 1ZVZA 3UMHA 1M2VB 4A2NB 3M4CA 1L7CA 1I5NA 1VLSA 2P7VA 3K1IA 1J8MF 3L1MA 3LAYA 4J30B 3JYHA 5JLIA 1HMOA 3G4XA 2HMZA 4CS9C 3T9OA 4Z9HA 1Z3IX 4L6RA 1T6IA 4I1OB 1DOWA 1KU2A 2EILC 2W45A 2BE5F 4E0IA 2V26A 1LS4A 2CGEA 4IRUA 3HNKA 2G62A 2OQMA 4U5FE 1AVOB 1M56C 3EQLF 2OEVA 2OEXA 4IAQA 1OXBA 2ZD9A 1A7DA 3I5PA 3JSEO 3SYNA 3TOMA 1LS1A 3C8GA 2YEVA 4CSAA 5D92A 2XL6A 3QVYA 1OCRC 2OKUA 4BEJA 4CIPA 1QQ3A 1RXQA 2GAQA 4N06A 4JVSA 3DE8A 4UDVA 4PFPA 1VMAA 2C04A 1TWHA 4EKWA 3Q6NA 1ORYA 1H9TA 3FHDA 2GDCA 2CW0F 2DYSC 1WGWA 2DB4A 3OA1A 2P61A 3S84A 4XEKA 4J7TA 4CDVA 1FMVA 1T5OA 4PJNA 4G7ZF 3ZTMA 4ZLDA 4CDAA 3JSZA 2PX3A 2JPUA 3WODF 5DQZA 5JRAA 1BDJB 2IXPA 2L81A 4N6CA 3LESA 4LDQA 1SR2A 3E9VA 5A6BD 1Q0MA 4QDLA 2KYHA 1C17M 2CNWD 3EG9B 3RQEA 3LUTB 1EI7A 4BJ6C 1S05A 1JR8A 3KH2A 1T01A 3OEOA 5EK0A 3U9MA 3EFOA 3G4ZA 1CGME 1U0BB 3M79A 4BJTA 2E87A 2KNHA 1RJ9A 2EPMX 3SXMA 4O79A 2J46A 3RVZA 4ULVA 3SXZA 3IQTA 3LLIA 2XL4A 1JAFA 3O55A 4IB4A 4E18A 3V5XA 2KQ9A 1FMWA 1SF8A 1E83A 2XXAB 1E2XA 2J7PD 2XL8A 4C3BA 2VB6A 3FDQA 2R7RA 1FR0A 5B3IA 5B1AC
chains in the Genus database with same CATH topology
1I4YA 2AWYA 3WAQA 2AWCA 1A7DA 1HMDA 1A7EA 4XPXA 4XPYA 4XQ1A 4XPWA 1I4ZA 3WHNA 2HMQA 3AGTA 2MHRA 2AVKA 1HMOA 2HMZA 3AGUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I4Y A;  2AWY A;  3WAQ A;  2AWC A;  1A7D A;  1HMD A;  1A7E A;  4XPX A;  4XPY A;  4XQ1 A;  4XPW A;  1I4Z A;  3WHN A;  2HMQ A;  3AGT A;  2MHR A;  2AVK A;  1HMO A;  2HMZ A;  3AGU A; 
#chains in the Genus database with same CATH topology
 4JTC B;  2XLE A;  3EGX A;  1S7Z A;  3MLG A;  5A6J A;  4J7Y A;  4LAC B;  1OW8 A;  2L6G A;  3CSK A;  3DWW A;  3TUL A;  4ER9 A;  1OR3 A;  1TWG A;  3QW1 A;  4P9F A;  4CS9 A;  4Q7C A;  4DRH B;  2IBF A;  2Q9A A;  4K1O A;  4OIQ F;  4P9T A;  1LE4 A;  2DI3 A;  4A4A A;  1C03 A;  5A6A A;  3X2Q C;  4XPX A;  3U8P A;  3RF3 A;  5A6B A;  4D4N A;  3W4Y A;  5L0C A;  1VYK A;  4U5D E;  4YL0 A;  3TOL A;  3LJB A;  5AC5 A;  4MVU A;  3ECS A;  3AG4 C;  5L0J A;  4LLE A;  4XEV A;  4K7B A;  3S9O A;  1QVX A;  5B3S C;  3W2W A;  4PFO A;  4DVY P;  4C7O A;  3DM5 A;  4H54 A;  3ABL C;  2YLG A;  5T3W A;  2AVK A;  4P6I C;  4FES A;  3PCV A;  5JP7 A;  5DS4 A;  1IZM A;  3IHU A;  4PR9 A;  5EGY A;  3RFY A;  3ZG1 A;  4KC9 A;  1RCP A;  2OU6 A;  4NTF A;  5FCL A;  2NUT B;  2AP3 A;  5D91 A;  3T6B A;  4YWQ A;  1F1M A;  1TWC A;  2VCC A;  2R7T A;  2BC5 A;  4JW1 A;  1HE1 A;  1Z5Z A;  2ICW G;  1L3P A;  3K1H A;  4EHP A;  1LI7 A;  2W9Y A;  4JC7 A;  4C3E A;  1Z63 A;  2WZL A;  1EA8 A;  2EIN C;  2G3K A;  3NYM A;  5JSL A;  1LM3 B;  2RD9 A;  1D1C A;  3N2Z B;  1MMG A;  2NUP A;  3M4B A;  1E86 A;  1M6T A;  1ORS C;  1ZHY A;  2R05 A;  2A6H F;  2HMQ A;  4EBK A;  3TD7 A;  4CJG A;  4F4B A;  1ZHT A;  3LS0 A;  1NFO A;  4DRI B;  1QPU A;  1IW7 F;  3US6 A;  4YT8 A;  4EIY A;  5E3C A;  1LI5 A;  1LVK A;  3EH2 A;  4MS2 A;  4U5C E;  4IGG A;  5L0I A;  4I1M A;  2KJG A;  5FZT A;  1JPN A;  2WVN A;  3S29 A;  4FX5 A;  1KNY A;  1ZU4 A;  3ZSU A;  1YZA A;  3FOP A;  2YL0 A;  2EIK C;  4CS8 A;  2Y3H A;  3QZC A;  2F22 A;  2VCB A;  4IJJ A;  4DBR A;  3T6G B;  3C8G D;  3B0P A;  3FAJ A;  5L0F A;  1TFK B;  3VF0 A;  2Q3T A;  1GS9 A;  3X1O A;  3ZVR A;  2ZXO A;  1YYX A;  1ZZP A;  1HE9 A;  3DJU B;  4MTG A;  4XQ1 A;  3UMI A;  1M57 C;  2R7S A;  3V5Y A;  4JTA B;  1MND A;  1YLM A;  4NCQ A;  4MVQ A;  4PK4 A;  2MHR A;  1OW6 A;  4E0H A;  1M2O A;  1QSP A;  1A0B A;  2A68 F;  1PD0 A;  3NYJ A;  2Y69 C;  1GM5 A;  2B0J A;  1D0Z A;  2A6E F;  3IEE A;  1U89 A;  5E2Q A;  4AK9 A;  1EKY A;  4DJ9 A;  2H7B A;  4XLP F;  1I4Y A;  2HV7 A;  1G4W R;  1MMD A;  4U9E A;  1YA9 A;  4Q5S F;  1XZP A;  1K05 A;  1UFB A;  4XTK A;  5AGF A;  4CSA C;  2LFF A;  3GEH A;  1OXK A;  2I8B A;  3BEH A;  5CI9 A;  1MMA A;  2OJQ A;  3GOD A;  3O39 A;  5KYX A;  2PBE A;  3HNL A;  1RKC A;  1BR4 A;  3GWL A;  3BRJ A;  4PJM A;  4RDA A;  3R7C A;  5F5H A;  3U5S A;  4EBB A;  1VK5 A;  3JZ0 A;  1AEP A;  3L34 A;  1H7I A;  3ZQV A;  3K6B A;  4R32 A;  3TK0 A;  1NLX A;  1K40 A;  2FGY A;  5TJ5 E;  4QI0 A;  3SEO A;  256B A;  2CDQ A;  3RQG A;  1WAS A;  4GQH A;  3RQF A;  4HE8 D;  3TJ5 A;  3GWN A;  4XLN F;  3RW0 A;  4JEA A;  3ZQY A;  4MND A;  4O7G A;  5A69 A;  3FAP B;  4JCH A;  2HSQ A;  2A0U A;  4ANJ A;  3HKK A;  1ZHX A;  2EPL X;  3RVY A;  1WN0 A;  2VC9 A;  3GM3 A;  3N24 A;  4PJL A;  2KW3 C;  1MQV A;  5T1D B;  2DGJ A;  3HJC A;  1O87 A;  1U6H A;  4U9D A;  2PNO A;  2PP4 A;  4KNW A;  1Y4C A;  3DXJ F;  3JCU Q;  4JEB A;  3SZR A;  1AUE A;  1V74 B;  4N6H A;  2LK4 A;  1NBB A;  1VYI A;  2XSE A;  3EPV A;  5KYU B;  2QTV A;  2VAS A;  3AG3 C;  4C3D A;  4BJ5 A;  1GGQ A;  1K04 A;  4U5B E;  5BQG A;  2YLI A;  3U9J A;  4AL1 A;  3DAF A;  1O5H A;  3FOO A;  2ZXP A;  3A9C A;  3ASN C;  3ABK C;  3C8Z A;  2XLV A;  4FWV A;  3EGD B;  5KYW A;  5L3V A;  1H9G A;  2Q9B A;  1J8Y F;  2UUI A;  1T9K A;  4W8P A;  4BG0 A;  3AGU A;  2H7V C;  5KYY A;  4JE9 A;  1NG1 A;  1VTM P;  3JYY A;  2NPU A;  4CX9 A;  3C63 A;  1OW7 A;  1RKE A;  5A6K A;  4JCZ A;  4AE4 A;  4WJ0 A;  4ULW A;  3GEI A;  3CEX A;  4HEA J;  5DVW A;  4OIP F;  4E7S A;  5DS6 A;  4BEM J;  2KK1 A;  2B0H A;  2IOQ A;  3NKE A;  1Q0G A;  4LDK A;  1YZC A;  3Q6M A;  4XPW A;  2IYL D;  2KSF A;  1FTS A;  3O6X A;  3EHN A;  4Z9J A;  1YVI A;  3NMJ A;  4Q4Z F;  1ZHZ A;  2CCY A;  3U8V A;  1ZW3 A;  2YKZ A;  3KPH A;  2PF4 E;  3MYF A;  3U2M A;  2TMV P;  1OQC A;  4PAC A;  3U3F A;  4OIN F;  5L0D A;  4JUR I;  1ST6 A;  2LCH A;  4E17 A;  1V4A A;  3CQZ A;  4CDY A;  2R7O A;  2R9R B;  3AQC A;  2KC3 A;  3NYL A;  4NY3 A;  1YA7 O;  3H2U A;  5BQH A;  1APC A;  3GM1 A;  5E3A A;  2L7A A;  3UGO A;  1MMN A;  3AJM A;  3DM9 B;  2XM4 A;  2VCA A;  3C8G B;  3UR3 C;  3HNJ A;  3NMI A;  3R2P A;  4G0H A;  5BQI A;  3C7J A;  3S90 A;  4OIR F;  4U5H A;  2Q9C A;  2XS8 A;  1Z6A A;  4G7O F;  4HFK B;  3W8I A;  3W2V A;  3HLZ A;  5BUO A;  5KYN A;  4MTO A;  2P1A A;  4OD5 A;  2LIG A;  2PX0 A;  2RSE B;  2R7U A;  2R7Q A;  3KKB A;  4WGY A;  3U3B A;  2EIM C;  1FAP B;  2EPO A;  3LS1 A;  3UMK A;  2Y3D A;  4U5G A;  2LQG A;  4MQ9 F;  4OIO F;  4N4W A;  3MYI A;  5JVE A;  1XZQ A;  2XS1 A;  1LKX A;  1Q0D A;  3OWT A;  3NRH A;  3FMS A;  2WVQ A;  1SYQ A;  1LIH A;  3ZWI A;  2DYR C;  1UG7 A;  1CPR A;  2HJ3 A;  3DAG A;  4BJ1 A;  2HJM A;  1CGO A;  2HKV A;  1PD1 A;  1R4T A;  1T6U A;  4YL1 A;  3K7D A;  5L0H A;  4H4K C;  4I3M A;  3B71 A;  2J8W A;  5AC4 A;  2YL3 A;  3SXK A;  5COM A;  3IPM O;  3EFO B;  5JT4 A;  1ZW2 A;  2Y3B A;  4OD4 A;  2MWQ A;  1OR2 A;  3B0U X;  2A1D D;  1RJ9 B;  1LE2 A;  4YT5 A;  1V55 C;  3SXY A;  1BR1 A;  3W8H A;  3K1I C;  1WWP A;  1JMW A;  2HFI A;  3RYL A;  3KL4 A;  5KYW B;  2L6H A;  3EG9 A;  3CAX A;  4U5E E;  4XEF A;  2CYD A;  5JS5 A;  1EQ1 A;  1TQG A;  1MNE A;  3I4U A;  1RMV A;  2QNL A;  1QZX A;  3B9Q A;  3EGX B;  2P0N A;  4JRZ A;  5DQT A;  1SMY F;  2XRH A;  3O10 A;  3EH1 A;  2WB7 A;  3N0T A;  2YVK A;  2HV6 A;  2EPK X;  2IXN A;  2M4E A;  4JJG A;  3MBG A;  4Z9I A;  2XXA A;  3UNG C;  3KYI A;  2EIJ C;  2Y39 A;  3SNH A;  1SZI A;  5IY5 C;  2FAP B;  2YZS A;  2J9W A;  1HW2 A;  4LDR A;  5COG A;  4MVO A;  2J9V A;  1D0X A;  4DRJ B;  1HMD A;  4I44 A;  1A7E A;  2R02 A;  3A11 A;  4CBE A;  4DBQ A;  4C7O B;  4YL3 A;  1Y6D A;  2ZXW C;  3DKA A;  1O3U A;  2IXO A;  3L8I A;  4O6Y A;  5CIV A;  3NKD A;  3LNR A;  2OJE D;  1V54 C;  4JZA A;  1A41 A;  3DI5 A;  5CI8 A;  1DOV A;  4YJW A;  3T6J A;  3V7O A;  3JT1 A;  2LP4 A;  1WOL A;  4WGZ A;  3PDM P;  5B1B C;  2XLO A;  3AOU A;  2IXM A;  3E70 C;  1NFN A;  2A0B A;  2JX0 A;  1FFH A;  3ASO C;  3HTK C;  2C03 A;  4X0R A;  2XM0 A;  1BR2 A;  3PMR A;  2AU5 A;  1GQA A;  3MFN A;  3S28 A;  4QI2 A;  1T6Q A;  4XWJ A;  3LEO A;  3QMK A;  4MVR A;  3FVY A;  3SP1 A;  4K0D A;  4BJ5 C;  2L6F A;  3ZDL A;  1BBH A;  2KGO A;  5T3T A;  4NTA A;  5HV9 A;  2V3C C;  2NUT A;  1E84 A;  2NUP B;  1ZHW A;  1PV3 A;  2WVO A;  3GOR A;  3F46 A;  2Q4F A;  3NDB B;  4HFF B;  2ZPA A;  3IQ5 A;  1OCO C;  3QW0 A;  4NQF A;  3TJ6 A;  1D0Y A;  1W2W A;  1N1C A;  1G8X A;  4IAO A;  3POV A;  3U0C A;  2YWA A;  3ITF A;  2QY9 A;  2UUH A;  4CIH A;  2LD6 A;  3WHN A;  1LPE A;  3FXH A;  3DJN B;  4NC3 A;  1D1B A;  4D4X A;  4IWB A;  4GEH A;  4W8K A;  1Z23 A;  3ZC4 A;  4CJO A;  2W4B A;  1Q0K A;  1TWA A;  3KYJ A;  2G3V A;  2R7W A;  2R7V A;  2NG1 A;  4DOZ A;  2YHS A;  4RBN A;  2HUJ A;  4WAB A;  1ORJ A;  1HW1 A;  2R25 A;  1QKR A;  3VAY A;  4DXW A;  1ZYR F;  4AX2 A;  3EJN A;  1ZU5 A;  1YJG A;  2QE9 A;  2QUP A;  3H65 A;  2XLD A;  3EHM A;  4KBL A;  4JIO A;  3V5Z A;  4O6M A;  3VRC A;  2NSF A;  1VB5 A;  2R03 A;  1QLE C;  2NSG A;  3LNM B;  4G7H F;  3B29 A;  3KMI A;  2XLH A;  3EZI A;  3RIP A;  4MTF A;  4JJF A;  2QLA A;  1TFO B;  2HZ8 A;  1YAR O;  2D5R B;  1NZE A;  3DZA A;  4JKV A;  4YK5 A;  2OCC C;  2IM8 A;  2LFD A;  4BJ6 A;  1A7V A;  3K33 A;  2J45 A;  2J9U A;  1KTM A;  3Q7G A;  3IQC A;  4E7Z A;  4B6I A;  1M2V A;  1R5I D;  1OCC C;  2W4M A;  3ZTZ A;  4CS7 A;  2YLD A;  3TQO A;  2AWY A;  2JD3 A;  4JTD B;  2XLW A;  4FAP B;  3J06 A;  3M1C B;  5KYX B;  3ATP A;  4GYT A;  3VM6 A;  1VLT A;  2VH3 A;  3GAN A;  3L0I A;  3F47 A;  3H2V A;  2GFH A;  3DE9 A;  4MVM A;  3IQ6 A;  3RH3 A;  1JPJ A;  3T4R A;  2CNW A;  3JRM O;  2J0X A;  1H6G A;  5DLJ A;  2GA0 A;  3S0X A;  2BL2 A;  1OKK D;  2WL8 A;  2YL7 A;  3NG1 A;  1YDI A;  2MYS A;  2H7O A;  2R7X A;  2OOC A;  3EZH A;  1CPQ A;  3PHF 2;  3CZ6 A;  2Z15 A;  3C18 A;  2YRF A;  3K66 A;  1G5Z A;  2H8A A;  4YN0 B;  3C62 A;  3GEE A;  3MX3 A;  2ASR A;  2L9J A;  5COF A;  4CS8 C;  1G4U S;  2ETS A;  4LER A;  5K0I A;  2J7P A;  3WG7 C;  4EUK B;  4MW3 A;  2Y3G A;  1VOM A;  4DVZ A;  5F5F A;  2XLM A;  3RKO F;  2HS5 A;  2YQY A;  1HY5 A;  2AWC A;  2WZF A;  2FFH A;  3AG1 C;  3AQB A;  4MVS A;  2A69 F;  3ABM C;  3AG2 C;  3L8J A;  5L3Q A;  3B0V C;  1TKN A;  1PCX A;  1CGN A;  2LSE A;  3DMD A;  2I15 A;  2HSB A;  5F28 E;  4KI2 A;  3S27 A;  4EWC A;  1Z7Q c;  1JOG A;  3U2L A;  1C02 A;  1B68 A;  1YYJ A;  5HSW A;  1OCZ C;  1NSG B;  2PFD A;  4AL0 A;  4MVZ A;  4J32 B;  1NU7 D;  3G50 A;  2D4U A;  3HNI A;  5KYU A;  3JRT A;  4RD9 A;  1OKK A;  2EPN A;  3DD7 A;  2M64 A;  5L0G A;  2X0C A;  2P6V A;  3LLK A;  3AGT A;  2GWW A;  3I5Q A;  1FFT C;  1NU9 C;  4EBJ A;  4O6N A;  4YT4 A;  2Q00 A;  3M15 A;  5KYY B;  1BZ4 A;  2J0W A;  1E85 A;  2J9B A;  2X51 A;  1YAU O;  3NMK A;  1JRA A;  5DS5 A;  2O9X A;  3Q7L A;  1RKE B;  4LLC A;  4NTB A;  5JUA A;  4IAR A;  4AE4 B;  3EGD A;  2YL1 A;  3QVZ A;  3WAQ A;  4ONS A;  2WZG A;  1XWJ A;  5EHH A;  4G78 A;  3UGP A;  4YT2 A;  1WTY A;  3GM2 A;  2ZXR A;  4M63 A;  4PJJ A;  3VYW A;  1TR2 A;  2OG2 A;  4BPM A;  3QTH A;  5E33 A;  4KNV A;  4MW8 A;  1WAT A;  1Q0F A;  4XPY A;  2Q7R A;  3JTL O;  4ZLC A;  1D1A A;  1I4Z A;  1FNT c;  3ZIB A;  3LEV A;  5GPG B;  1ZVZ A;  3UMH A;  1M2V B;  4A2N B;  3M4C A;  1L7C A;  1I5N A;  1VLS A;  2P7V A;  3K1I A;  1J8M F;  3L1M A;  3LAY A;  4J30 B;  3JYH A;  5JLI A;  1HMO A;  3G4X A;  2HMZ A;  4CS9 C;  3T9O A;  4Z9H A;  1Z3I X;  4L6R A;  1T6I A;  4I1O B;  1DOW A;  1KU2 A;  2EIL C;  2W45 A;  2BE5 F;  4E0I A;  2V26 A;  1LS4 A;  2CGE A;  4IRU A;  3HNK A;  2G62 A;  2OQM A;  4U5F E;  1AVO B;  1M56 C;  3EQL F;  2OEV A;  2OEX A;  4IAQ A;  1OXB A;  2ZD9 A;  1A7D A;  3I5P A;  3JSE O;  3SYN A;  3TOM A;  1LS1 A;  3C8G A;  2YEV A;  4CSA A;  5D92 A;  2XL6 A;  3QVY A;  1OCR C;  2OKU A;  4BEJ A;  4CIP A;  1QQ3 A;  1RXQ A;  2GAQ A;  4N06 A;  4JVS A;  3DE8 A;  4UDV A;  4PFP A;  1VMA A;  2C04 A;  1TWH A;  4EKW A;  3Q6N A;  1ORY A;  1H9T A;  3FHD A;  2GDC A;  2CW0 F;  2DYS C;  1WGW A;  2DB4 A;  3OA1 A;  2P61 A;  3S84 A;  4XEK A;  4J7T A;  4CDV A;  1FMV A;  1T5O A;  4PJN A;  4G7Z F;  3ZTM A;  4ZLD A;  4CDA A;  3JSZ A;  2PX3 A;  2JPU A;  3WOD F;  5DQZ A;  5JRA A;  1BDJ B;  2IXP A;  2L81 A;  4N6C A;  3LES A;  4LDQ A;  1SR2 A;  3E9V A;  5A6B D;  1Q0M A;  4QDL A;  2KYH A;  1C17 M;  2CNW D;  3EG9 B;  3RQE A;  3LUT B;  1EI7 A;  4BJ6 C;  1S05 A;  1JR8 A;  3KH2 A;  1T01 A;  3OEO A;  5EK0 A;  3U9M A;  3EFO A;  3G4Z A;  1CGM E;  1U0B B;  3M79 A;  4BJT A;  2E87 A;  2KNH A;  1RJ9 A;  2EPM X;  3SXM A;  4O79 A;  2J46 A;  3RVZ A;  4ULV A;  3SXZ A;  3IQT A;  3LLI A;  2XL4 A;  1JAF A;  3O55 A;  4IB4 A;  4E18 A;  3V5X A;  2KQ9 A;  1FMW A;  1SF8 A;  1E83 A;  2XXA B;  1E2X A;  2J7P D;  2XL8 A;  4C3B A;  2VB6 A;  3FDQ A;  2R7R A;  1FR0 A;  5B3I A;  5B1A C; 
#chains in the Genus database with same CATH homology
 1I4Y A;  2AWY A;  3WAQ A;  2AWC A;  1A7D A;  1HMD A;  1A7E A;  4XPX A;  4XPY A;  4XQ1 A;  4XPW A;  1I4Z A;  3WHN A;  2HMQ A;  3AGT A;  2MHR A;  2AVK A;  1HMO A;  2HMZ A;  3AGU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...