2AWCA

Deoxy-dcrh-hr
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
130
structure length
130
Chain Sequence
VKWSEDLANLPSIDTQHKRLVDYINDLYRAARRRDMDKAREVFDALKNYAVEHFGYEERLFADYAYPEATRHKEIHRRFVETVLKWEKQLAAGDPEVVMTTLRGLVDWLVNHIMKEDKKYEAYLRERGVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for O(2) Sensing by the Hemerythrin-like Domain of a Bacterial Chemotaxis Protein: Substrate Tunnel and Fluxional N Terminus
pubmed doi rcsb
source organism Desulfovibrio vulgaris
molecule tags Oxygen storage/transport
molecule keywords hemerythrin-like domain protein DcrH
total genus 61
structure length 130
sequence length 130
ec nomenclature
pdb deposition date 2005-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01814 Hemerythrin Hemerythrin HHE cation binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.50 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Hemerythrin-like 2awcA00
3WHNA 4XPXA 1A7DA 3AGUA 2HMQA 2AWCA 4XPWA 4XPYA 1A7EA 1I4YA 1I4ZA 2AWYA 2AVKA 2MHRA 3AGTA 1HMDA 1HMOA 2HMZA 4XQ1A 3WAQA
chains in the Genus database with same CATH superfamily
4XEKA 4JCHA 4JZAA 4UDVA 1V55C 4DRJB 4JJGA 3ZVRA 3B0UX 2QNLA 3EQLF 3FOOA 1W2WA 5L0CA 4IARA 3Q7GA 2ZPAA 3FXHA 3NMJA 4JRZA 4PFOA 4W8KA 1M57C 4CS9C 3DJNB 4U5CE 2IM8A 1JPJA 3GEHA 1OKKD 2ZXOA 4MVOA 3RQEA 3PHF2 2EIKC 2DYRC 4GQHA 3T4RA 3K33A 2R03A 2Y69C 2Z15A 3WODF 2WVOA 1N1CA 4XEFA 3TULA 1VTMP 3DD7A 5BQGA 4BJ5A 3EJNA 3KPHA 1LE4A 4ONSA 3S29A 5A6JA 1WASA 3SXYA 3U3BA 3M1CB 3X2QC 3S0XA 5DS5A 4CS8A 5BUOA 3TK0A 3RYLA 2XLEA 3DE9A 3SP1A 4WABA 3JSEO 4JE9A 1M2OA 3ZTMA 2DI3A 4EKWA 1RKEB 4OD4A 2LD6A 2XLDA 3TQOA 2R7QA 1OKKA 1HY5A 5JS5A 2KJGA 3IQ6A 3RH3A 1L7CA 4FESA 3U2LA 1JPNA 1EQ1A 2B0JA 3NG1A 3EG9B 2OJED 4JKVA 4CIPA 3SZRA 3JZ0A 2AVKA 2YRFA 3CZ6A 1I5NA 2NUPA 4MVRA 4NQFA 1Y4CA 1ZHZA 2YLGA 2UUHA 1LPEA 2P61A 3SNHA 1RJ9B 1A0BA 2HSBA 2HJMA 2YVKA 2QLAA 3K6BA 4M63A 4O6MA 1JMWA 4MVSA 3POVA 3RQGA 1TWAA 4BJTA 4AL0A 3NMKA 2A6EF 3FAJA 3C7JA 5F28E 2XXAA 2R7XA 4OIRF 4I44A 3U0CA 3G50A 4JIOA 1R4TA 2LK4A 2QY9A 3OEOA 3L1MA 2A69F 2IXMA 1K05A 2Q9CA 4YN0B 3AG1C 3ITFA 3RVZA 3R2PA 2IOQA 3CSKA 1Z5ZA 1QKRA 2OEVA 3EHNA 4ER9A 5DQZA 3W8IA 1RMVA 1PD1A 2OG2A 3LESA 3ABLC 4PR9A 1YYXA 2ZXRA 4PK4A 1V74B 1H7IA 1D1CA 3C8GD 4W8PA 3T9OA 5T3WA 1YZAA 2Q9AA 2PNOA 4A4AA 3DXJF 1RJ9A 2EPOA 4RDAA 2LP4A 4ZLCA 1JOGA 1VYIA 3BEHA 2BC5A 4CBEA 5L3QA 2R7SA 3LJBA 3SEOA 3DM9B 4CSAA 4YK5A 3LS0A 1M56C 2HJ3A 1SR2A 1Q0KA 5COGA 1MMAA 1YA7O 4H4KC 5COFA 1M6TA 2IXNA 2NUTB 3L34A 3QVZA 4NTBA 4JVSA 4X0RA 4IAOA 2OQMA 2HZ8A 1YLMA 2C04A 2WB7A 1IZMA 1Q0GA 1T6UA 1G8XA 2YLIA 3C8GA 5E3AA 1MMGA 5F5HA 1B68A 1KNYA 2ICWG 2CGEA 4AX2A 4E7ZA 1FFHA 3IQTA 2OOCA 3EH2A 1U89A 2R7WA 3FVYA 1BDJB 4E17A 4JTAB 4U5DE 2CCYA 1TKNA 1FNTc 5JRAA 5AGFA 1NSGB 4XPYA 2FAPB 4AL1A 4CS7A 3IHUA 3U5SA 1G5ZA 3DMDA 5KYWB 3WAQA 4CX9A 5B3IA 2O9XA 3RF3A 4LDKA 2QTVA 3UGPA 2NUPB 2I15A 3US6A 4PJMA 2P1AA 4BEMJ 4ANJA 3MYIA 4I3MA 5D91A 5K0IA 4KNWA 2JPUA 1L3PA 3DI5A 3IEEA 1KU2A 1SZIA 2PF4E 1HW1A 3X1OA 2P0NA 2H7OA 5A69A 1TWHA 3M4CA 3S9OA 4A2NB 4U5BE 1QQ3A 1WN0A 5KYYA 1CPRA 4XLNF 1ZHYA 2PX0A 4WJ0A 3HLZA 4HE8D 2YKZA 3AQBA 1ZZPA 2Q4FA 2HUJA 1QVXA 3ATPA 3N2ZB 2XLVA 3V5XA 3VF0A 4B6IA 4MW3A 1OQCA 3RIPA 4G7ZF 3JYHA 2CDQA 256BA 3A9CA 5DVWA 2DB4A 3ZC4A 2NUTA 4BJ6C 2ZD9A 4OINF 1LS1A 3QMKA 4MQ9F 1Z63A 3NYMA 1T5OA 1LM3B 1VLTA 1VMAA 3S28A 2NG1A 5L0GA 1OW8A 3K1IA 3LEVA 3VRCA 4J30B 4JEAA 3KMIA 4KNVA 4EHPA 3W4YA 3LUTB 2G3KA 2L6GA 3SXMA 3H2UA 2XL6A 3LLKA 3S84A 2VH3A 3ABMC 4E0HA 1MQVA 4Z9IA 3UNGC 1QZXA 1T6QA 4O6NA 1ZHXA 4N6CA 1Y6DA 3V7OA 1OCCC 3DM5A 4MTGA 1YVIA 1RKEA 3NYJA 5B1BC 1O5HA 4YL1A 1OCOC 5DLJA 1Z6AA 3GM1A 4MVQA 5COMA 1F1MA 1YA9A 1YAUO 4IB4A 4DRHB 2J7PD 4OIOF 1E84A 2WZLA 2FGYA 1EA8A 3JYYA 2YHSA 1HW2A 5KYUA 4WGZA 4XLPF 2WVQA 2OKUA 2VASA 1C03A 1UG7A 3BRJA 2H7BA 2YWAA 3W2WA 3DZAA 4G0HA 4J7YA 4MVMA 1Z3IX 1C02A 3DKAA 4FWVA 5D92A 4ULVA 3RQFA 2CW0F 5JT4A 4AE4A 5L0HA 4EBKA 1RXQA 3O10A 4N4WA 3AGUA 1D0ZA 1U0BB 1ORSC 4CS9A 1RCPA 1ZU4A 2EPMX 2W4MA 1NU9C 3GM3A 3NRHA 4EIYA 4U9DA 1V54C 2YZSA 5F5FA 3EGDB 3DE8A 1LVKA 4C3DA 1HE1A 5EHHA 1WOLA 2OU6A 1ZYRF 1NLXA 2KC3A 2LFDA 5IY5C 3F47A 2OCCC 3ASNC 4J32B 5T1DB 1PD0A 2EPNA 4KC9A 2XS8A 1A7VA 3WHNA 2LQGA 3AJMA 4G7HF 4DBQA 1NFOA 4CS8C 4PFPA 2GFHA 1NBBA 5B3SC 3H65A 1ZW3A 4JCZA 2HV7A 2HKVA 2X51A 4XPWA 3FHDA 1YDIA 2NSFA 2VCCA 1G4WR 2R9RB 2VB6A 3A11A 4EBBA 2OEXA 4G78A 2VCBA 1CGOA 2XLOA 3FDQA 2IXPA 3M15A 5FCLA 1H9TA 2A6HF 4E0IA 4D4XA 4LLCA 2J9WA 1Z23A 3B0PA 2L7AA 3GANA 2J0XA 4MTOA 4QDLA 2KQ9A 1E2XA 2HS5A 4U5FE 3U8PA 1J8YF 3U9MA 1WWPA 3WG7C 1TQGA 3DWWA 4PJLA 4DVYP 5CIVA 3LNMB 1YARO 2W45A 3AGTA 2L6FA 1ZHWA 3K7DA 4U5EE 5E33A 4MW8A 3H2VA 5KYXA 1LKXA 1AVOB 1ST6A 2MYSA 5TJ5E 4DOZA 3RKOF 1QSPA 2AU5A 3U2MA 5E2QA 4YWQA 3T6JA 3IQ5A 3AG3C 3G4XA 4IJJA 2YL1A 3E70C 3QZCA 3JTLO 2J9UA 3NKDA 3I5QA 3RVYA 4YT4A 1MNEA 2A1DD 3UMKA 1UFBA 3UMIA 3EHMA 1TR2A 3C63A 1WATA 2EILC 3L8JA 3IPMO 3ECSA 4XWJA 1MMDA 2R02A 4AE4B 5L0DA 1GS9A 5L0IA 1TFOB 2Q3TA 2C03A 4JW1A 3RFYA 2EIJC 3U9JA 4E7SA 4EWCA 2LCHA 3VAYA 4F4BA 5A6KA 3NYLA 4N6HA 4DVZA 2GAQA 2ZXWC 4C3EA 1S7ZA 4DRIB 5DS6A 1NFNA 4JEBA 3VM6A 2M4EA 2L6HA 2FFHA 1JAFA 1O3UA 2H8AA 4LLEA 3DAGA 4CDYA 3M4BA 1DOVA 3NMIA 3JRMO 5T3TA 3GODA 4U5HA 1BR2A 1OW7A 3EH1A 3HNJA 3O6XA 2IYLD 1EI7A 2YL7A 3DAFA 5BQIA 2HMZA 2KNHA 4YL3A 4ZLDA 3L8IA 5AC4A 2BE5F 1IW7F 1TFKB 2E87A 3C62A 3C8ZA 3GM2A 3JCUQ 3U8VA 1XZQA 2P7VA 4CDVA 2KK1A 4K1OA 4Q5SF 1A7DA 3QVYA 3QW1A 2AWYA 2MHRA 2J0WA 1AUEA 1ZU5A 1NG1A 3AG4C 3W2VA 1TWCA 2M64A 2PBEA 3JRTA 4JJFA 2XLWA 4JURI 4MTFA 3TOMA 4CJOA 2KW3C 3JSZA 4C7OA 1FFTC 2GA0A 4YT5A 2AP3A 3B71A 1H6GA 3GWLA 3LLIA 3HKKA 3E9VA 2L81A 5CI8A 4O6YA 4YJWA 5KYNA 3B0VC 2J9VA 5GPGB 2J9BA 1OCZC 1HMDA 1VOMA 3SYNA 2R7TA 3K1HA 1RKCA 1YJGA 3KL4A 2ETSA 3EZHA 3M79A 3LNRA 5EK0A 5A6BD 3HNKA 3CEXA 4NC3A 2LSEA 3CQZA 2W9YA 4MNDA 4P9TA 2NSGA 3O55A 3SXKA 2XM4A 1CPQA 5L3VA 4HFKB 1U6HA 2YL3A 4MVZA 3GEIA 4BJ5C 2LIGA 4YL0A 1S05A 5JUAA 1WTYA 3OA1A 1FTSA 4R32A 5KYWA 2JD3A 4I1OB 1FMVA 4BJ6A 3V5ZA 2JX0A 1DOWA 2YL0A 4RD9A 3MFNA 3KH2A 1OW6A 2D5RB 4H54A 1E86A 3Q6MA 1SYQA 3LS1A 2VC9A 1MNDA 3GORA 3UR3C 3ZQVA 2ZXPA 3UGOA 2QUPA 4PJJA 4Q4ZF 3NKEA 3IQCA 2XS1A 4I1MA 2WL8A 4PACA 2R25A 2G3VA 2X0CA 2Y3HA 4K0DA 2R7RA 1K04A 4CDAA 4E18A 3MX3A 4MS2A 3FAPB 1C17M 5E3CA 3R7CA 2J46A 4J7TA 3AG2C 1D1BA 4BJ1A 4WGYA 2XL8A 3JT1A 2G62A 4CIHA 5B1AC 2R7VA 1BZ4A 5AC5A 2TMVP 1VLSA 3EGXA 1BR1A 3QW0A 2A0UA 3HNIA 4OD5A 3V5YA 1GGQA 2WVNA 1CGNA 1OR2A 5HSWA 3EPVA 4BEJA 1H9GA 2Y39A 1LE2A 3F46A 4NY3A 3J06A 2V3CC 2XLHA 3U3FA 1NU7D 4CJGA 4G7OF 4HEAJ 4EBJA 4Z9JA 4ULWA 1LI7A 1G4US 1E85A 1FR0A 3HNLA 1OXBA 4C7OB 1I4YA 5JVEA 2I8BA 2H7VC 1Q0MA 2BL2A 3PCVA 2IXOA 2Y3GA 4XTKA 1CGME 4AK9A 2AWCA 3PDMP 4GYTA 2Y3BA 2F22A 1HMOA 3GEEA 5DQTA 5FZTA 1OR3A 1VK5A 3VYWA 2DYSC 3C8GB 2RD9A 1M2VA 4MVUA 4Q7CA 5JLIA 1YZCA 2Q00A 1AEPA 1ORYA 3TD7A 4DBRA 4QI2A 1SMYF 3FOPA 4U9EA 5EGYA 1OXKA 3S27A 3EGXB 4KI2A 2XSEA 3G4ZA 2EPLX 1T6IA 4QI0A 1Z7Qc 4RBNA 4LERA 4YT8A 4CSAC 4FAPB 3NDBB 4IWBA 3MYFA 4K7BA 3T6GB 2MWQA 2P6VA 2PP4A 2CNWA 2J45A 5BQHA 1FAPB 3SXZA 4IAQA 2A0BA 3QTHA 4IRUA 3TOLA 2XLMA 4LDRA 1D0XA 2J8WA 2DGJA 2HMQA 2PFDA 2V26A 2GWWA 3EFOB 1K40A 4NTFA 3O39A 1T9KA 1XZPA 4LDQA 4BG0A 1Q0DA 3S90A 3KYJA 1WGWA 1VB5A 4O79A 4Z9HA 4LACB 3ZG1A 1GQAA 2B0HA 2KSFA 3HTKC 3CAXA 3ZWIA 1I4ZA 1LS4A 2L9JA 2RSEB 5JSLA 2EIMC 1NZEA 4KBLA 4P9FA 2YQYA 1D1AA 1SF8A 3KKBA 2KGOA 1R5ID 2WZFA 4IGGA 3ASOC 5KYYB 2CNWD 3B29A 4O7GA 3EGDA 4HFFB 4N06A 2HFIA 4OIPF 2VCAA 2Y3DA 2WZGA 5JP7A 4XEVA 2R7OA 3B9QA 4OIQF 3TJ6A 1D0YA 4U5GA 1PCXA 3AOUA 1ORJA 1BR4A 3C18A 1ZHTA 2NPUA 3RW0A 3ZQYA 3GWNA 1HE9A 1BBHA 3I5PA 3KYIA 1MMNA 2LFFA 1VYKA 4DXWA 1Q0FA 2Q9BA 2XL4A 2XRHA 1O87A 2KYHA 1M2VB 3AQCA 2PX3A 1QPUA 2EINC 3L0IA 5L0JA 4D4NA 2R7UA 5HV9A 2OJQA 2R05A 2IBFA 3LAYA 2XM0A 3MLGA 2ASRA 1LIHA 2XXAB 2HSQA 3OWTA 4JTCB 2CYDA 2D4UA 3DJUB 4FX5A 5KYUB 1PV3A 1XWJA 2QE9A 3UMHA 4DJ9A 3Q6NA 3FMSA 1OCRC 1GM5A 2UUIA 1T01A 2W4BA 3K1IC 4XQ1A 2A68F 2YLDA 3LEOA 4NTAA 5KYXB 1E83A 3I4UA 3EG9A 3ZIBA 2GDCA 4PJNA 1LI5A 1A41A 3ABKC 4L6RA 4P6IC 2YEVA 4BPMA 5DS4A 3TJ5A 1QLEC 4EUKB 1TWGA 2J7PA 5L0FA 1JRAA 1ZVZA 3HJCA 4GEHA 1APCA 1YYJA 3MBGA 3ZTZA 4JTDB 1J8MF 3EFOA 2HV6A 3N0TA 2EPKX 4XPXA 1JR8A 5A6AA 1A7EA 1FMWA 1KTMA 3EZIA 3N24A 4NCQA 3K66A 4C3BA 3W8HA 1EKYA 1V4AA 2Q7RA 3PMRA 3ZDLA 3Q7LA 5A6BA 3T6BA 5CI9A 4JC7A 1ZW2A 4YT2A 3ZSUA
chains in the Genus database with same CATH topology
3WHNA 4XPXA 1A7DA 3AGUA 2HMQA 2AWCA 4XPWA 4XPYA 1A7EA 1I4YA 1I4ZA 2AWYA 2AVKA 2MHRA 3AGTA 1HMDA 1HMOA 2HMZA 4XQ1A 3WAQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WHN A;  4XPX A;  1A7D A;  3AGU A;  2HMQ A;  2AWC A;  4XPW A;  4XPY A;  1A7E A;  1I4Y A;  1I4Z A;  2AWY A;  2AVK A;  2MHR A;  3AGT A;  1HMD A;  1HMO A;  2HMZ A;  4XQ1 A;  3WAQ A; 
#chains in the Genus database with same CATH topology
 4XEK A;  4JCH A;  4JZA A;  4UDV A;  1V55 C;  4DRJ B;  4JJG A;  3ZVR A;  3B0U X;  2QNL A;  3EQL F;  3FOO A;  1W2W A;  5L0C A;  4IAR A;  3Q7G A;  2ZPA A;  3FXH A;  3NMJ A;  4JRZ A;  4PFO A;  4W8K A;  1M57 C;  4CS9 C;  3DJN B;  4U5C E;  2IM8 A;  1JPJ A;  3GEH A;  1OKK D;  2ZXO A;  4MVO A;  3RQE A;  3PHF 2;  2EIK C;  2DYR C;  4GQH A;  3T4R A;  3K33 A;  2R03 A;  2Y69 C;  2Z15 A;  3WOD F;  2WVO A;  1N1C A;  4XEF A;  3TUL A;  1VTM P;  3DD7 A;  5BQG A;  4BJ5 A;  3EJN A;  3KPH A;  1LE4 A;  4ONS A;  3S29 A;  5A6J A;  1WAS A;  3SXY A;  3U3B A;  3M1C B;  3X2Q C;  3S0X A;  5DS5 A;  4CS8 A;  5BUO A;  3TK0 A;  3RYL A;  2XLE A;  3DE9 A;  3SP1 A;  4WAB A;  3JSE O;  4JE9 A;  1M2O A;  3ZTM A;  2DI3 A;  4EKW A;  1RKE B;  4OD4 A;  2LD6 A;  2XLD A;  3TQO A;  2R7Q A;  1OKK A;  1HY5 A;  5JS5 A;  2KJG A;  3IQ6 A;  3RH3 A;  1L7C A;  4FES A;  3U2L A;  1JPN A;  1EQ1 A;  2B0J A;  3NG1 A;  3EG9 B;  2OJE D;  4JKV A;  4CIP A;  3SZR A;  3JZ0 A;  2AVK A;  2YRF A;  3CZ6 A;  1I5N A;  2NUP A;  4MVR A;  4NQF A;  1Y4C A;  1ZHZ A;  2YLG A;  2UUH A;  1LPE A;  2P61 A;  3SNH A;  1RJ9 B;  1A0B A;  2HSB A;  2HJM A;  2YVK A;  2QLA A;  3K6B A;  4M63 A;  4O6M A;  1JMW A;  4MVS A;  3POV A;  3RQG A;  1TWA A;  4BJT A;  4AL0 A;  3NMK A;  2A6E F;  3FAJ A;  3C7J A;  5F28 E;  2XXA A;  2R7X A;  4OIR F;  4I44 A;  3U0C A;  3G50 A;  4JIO A;  1R4T A;  2LK4 A;  2QY9 A;  3OEO A;  3L1M A;  2A69 F;  2IXM A;  1K05 A;  2Q9C A;  4YN0 B;  3AG1 C;  3ITF A;  3RVZ A;  3R2P A;  2IOQ A;  3CSK A;  1Z5Z A;  1QKR A;  2OEV A;  3EHN A;  4ER9 A;  5DQZ A;  3W8I A;  1RMV A;  1PD1 A;  2OG2 A;  3LES A;  3ABL C;  4PR9 A;  1YYX A;  2ZXR A;  4PK4 A;  1V74 B;  1H7I A;  1D1C A;  3C8G D;  4W8P A;  3T9O A;  5T3W A;  1YZA A;  2Q9A A;  2PNO A;  4A4A A;  3DXJ F;  1RJ9 A;  2EPO A;  4RDA A;  2LP4 A;  4ZLC A;  1JOG A;  1VYI A;  3BEH A;  2BC5 A;  4CBE A;  5L3Q A;  2R7S A;  3LJB A;  3SEO A;  3DM9 B;  4CSA A;  4YK5 A;  3LS0 A;  1M56 C;  2HJ3 A;  1SR2 A;  1Q0K A;  5COG A;  1MMA A;  1YA7 O;  4H4K C;  5COF A;  1M6T A;  2IXN A;  2NUT B;  3L34 A;  3QVZ A;  4NTB A;  4JVS A;  4X0R A;  4IAO A;  2OQM A;  2HZ8 A;  1YLM A;  2C04 A;  2WB7 A;  1IZM A;  1Q0G A;  1T6U A;  1G8X A;  2YLI A;  3C8G A;  5E3A A;  1MMG A;  5F5H A;  1B68 A;  1KNY A;  2ICW G;  2CGE A;  4AX2 A;  4E7Z A;  1FFH A;  3IQT A;  2OOC A;  3EH2 A;  1U89 A;  2R7W A;  3FVY A;  1BDJ B;  4E17 A;  4JTA B;  4U5D E;  2CCY A;  1TKN A;  1FNT c;  5JRA A;  5AGF A;  1NSG B;  4XPY A;  2FAP B;  4AL1 A;  4CS7 A;  3IHU A;  3U5S A;  1G5Z A;  3DMD A;  5KYW B;  3WAQ A;  4CX9 A;  5B3I A;  2O9X A;  3RF3 A;  4LDK A;  2QTV A;  3UGP A;  2NUP B;  2I15 A;  3US6 A;  4PJM A;  2P1A A;  4BEM J;  4ANJ A;  3MYI A;  4I3M A;  5D91 A;  5K0I A;  4KNW A;  2JPU A;  1L3P A;  3DI5 A;  3IEE A;  1KU2 A;  1SZI A;  2PF4 E;  1HW1 A;  3X1O A;  2P0N A;  2H7O A;  5A69 A;  1TWH A;  3M4C A;  3S9O A;  4A2N B;  4U5B E;  1QQ3 A;  1WN0 A;  5KYY A;  1CPR A;  4XLN F;  1ZHY A;  2PX0 A;  4WJ0 A;  3HLZ A;  4HE8 D;  2YKZ A;  3AQB A;  1ZZP A;  2Q4F A;  2HUJ A;  1QVX A;  3ATP A;  3N2Z B;  2XLV A;  3V5X A;  3VF0 A;  4B6I A;  4MW3 A;  1OQC A;  3RIP A;  4G7Z F;  3JYH A;  2CDQ A;  256B A;  3A9C A;  5DVW A;  2DB4 A;  3ZC4 A;  2NUT A;  4BJ6 C;  2ZD9 A;  4OIN F;  1LS1 A;  3QMK A;  4MQ9 F;  1Z63 A;  3NYM A;  1T5O A;  1LM3 B;  1VLT A;  1VMA A;  3S28 A;  2NG1 A;  5L0G A;  1OW8 A;  3K1I A;  3LEV A;  3VRC A;  4J30 B;  4JEA A;  3KMI A;  4KNV A;  4EHP A;  3W4Y A;  3LUT B;  2G3K A;  2L6G A;  3SXM A;  3H2U A;  2XL6 A;  3LLK A;  3S84 A;  2VH3 A;  3ABM C;  4E0H A;  1MQV A;  4Z9I A;  3UNG C;  1QZX A;  1T6Q A;  4O6N A;  1ZHX A;  4N6C A;  1Y6D A;  3V7O A;  1OCC C;  3DM5 A;  4MTG A;  1YVI A;  1RKE A;  3NYJ A;  5B1B C;  1O5H A;  4YL1 A;  1OCO C;  5DLJ A;  1Z6A A;  3GM1 A;  4MVQ A;  5COM A;  1F1M A;  1YA9 A;  1YAU O;  4IB4 A;  4DRH B;  2J7P D;  4OIO F;  1E84 A;  2WZL A;  2FGY A;  1EA8 A;  3JYY A;  2YHS A;  1HW2 A;  5KYU A;  4WGZ A;  4XLP F;  2WVQ A;  2OKU A;  2VAS A;  1C03 A;  1UG7 A;  3BRJ A;  2H7B A;  2YWA A;  3W2W A;  3DZA A;  4G0H A;  4J7Y A;  4MVM A;  1Z3I X;  1C02 A;  3DKA A;  4FWV A;  5D92 A;  4ULV A;  3RQF A;  2CW0 F;  5JT4 A;  4AE4 A;  5L0H A;  4EBK A;  1RXQ A;  3O10 A;  4N4W A;  3AGU A;  1D0Z A;  1U0B B;  1ORS C;  4CS9 A;  1RCP A;  1ZU4 A;  2EPM X;  2W4M A;  1NU9 C;  3GM3 A;  3NRH A;  4EIY A;  4U9D A;  1V54 C;  2YZS A;  5F5F A;  3EGD B;  3DE8 A;  1LVK A;  4C3D A;  1HE1 A;  5EHH A;  1WOL A;  2OU6 A;  1ZYR F;  1NLX A;  2KC3 A;  2LFD A;  5IY5 C;  3F47 A;  2OCC C;  3ASN C;  4J32 B;  5T1D B;  1PD0 A;  2EPN A;  4KC9 A;  2XS8 A;  1A7V A;  3WHN A;  2LQG A;  3AJM A;  4G7H F;  4DBQ A;  1NFO A;  4CS8 C;  4PFP A;  2GFH A;  1NBB A;  5B3S C;  3H65 A;  1ZW3 A;  4JCZ A;  2HV7 A;  2HKV A;  2X51 A;  4XPW A;  3FHD A;  1YDI A;  2NSF A;  2VCC A;  1G4W R;  2R9R B;  2VB6 A;  3A11 A;  4EBB A;  2OEX A;  4G78 A;  2VCB A;  1CGO A;  2XLO A;  3FDQ A;  2IXP A;  3M15 A;  5FCL A;  1H9T A;  2A6H F;  4E0I A;  4D4X A;  4LLC A;  2J9W A;  1Z23 A;  3B0P A;  2L7A A;  3GAN A;  2J0X A;  4MTO A;  4QDL A;  2KQ9 A;  1E2X A;  2HS5 A;  4U5F E;  3U8P A;  1J8Y F;  3U9M A;  1WWP A;  3WG7 C;  1TQG A;  3DWW A;  4PJL A;  4DVY P;  5CIV A;  3LNM B;  1YAR O;  2W45 A;  3AGT A;  2L6F A;  1ZHW A;  3K7D A;  4U5E E;  5E33 A;  4MW8 A;  3H2V A;  5KYX A;  1LKX A;  1AVO B;  1ST6 A;  2MYS A;  5TJ5 E;  4DOZ A;  3RKO F;  1QSP A;  2AU5 A;  3U2M A;  5E2Q A;  4YWQ A;  3T6J A;  3IQ5 A;  3AG3 C;  3G4X A;  4IJJ A;  2YL1 A;  3E70 C;  3QZC A;  3JTL O;  2J9U A;  3NKD A;  3I5Q A;  3RVY A;  4YT4 A;  1MNE A;  2A1D D;  3UMK A;  1UFB A;  3UMI A;  3EHM A;  1TR2 A;  3C63 A;  1WAT A;  2EIL C;  3L8J A;  3IPM O;  3ECS A;  4XWJ A;  1MMD A;  2R02 A;  4AE4 B;  5L0D A;  1GS9 A;  5L0I A;  1TFO B;  2Q3T A;  2C03 A;  4JW1 A;  3RFY A;  2EIJ C;  3U9J A;  4E7S A;  4EWC A;  2LCH A;  3VAY A;  4F4B A;  5A6K A;  3NYL A;  4N6H A;  4DVZ A;  2GAQ A;  2ZXW C;  4C3E A;  1S7Z A;  4DRI B;  5DS6 A;  1NFN A;  4JEB A;  3VM6 A;  2M4E A;  2L6H A;  2FFH A;  1JAF A;  1O3U A;  2H8A A;  4LLE A;  3DAG A;  4CDY A;  3M4B A;  1DOV A;  3NMI A;  3JRM O;  5T3T A;  3GOD A;  4U5H A;  1BR2 A;  1OW7 A;  3EH1 A;  3HNJ A;  3O6X A;  2IYL D;  1EI7 A;  2YL7 A;  3DAF A;  5BQI A;  2HMZ A;  2KNH A;  4YL3 A;  4ZLD A;  3L8I A;  5AC4 A;  2BE5 F;  1IW7 F;  1TFK B;  2E87 A;  3C62 A;  3C8Z A;  3GM2 A;  3JCU Q;  3U8V A;  1XZQ A;  2P7V A;  4CDV A;  2KK1 A;  4K1O A;  4Q5S F;  1A7D A;  3QVY A;  3QW1 A;  2AWY A;  2MHR A;  2J0W A;  1AUE A;  1ZU5 A;  1NG1 A;  3AG4 C;  3W2V A;  1TWC A;  2M64 A;  2PBE A;  3JRT A;  4JJF A;  2XLW A;  4JUR I;  4MTF A;  3TOM A;  4CJO A;  2KW3 C;  3JSZ A;  4C7O A;  1FFT C;  2GA0 A;  4YT5 A;  2AP3 A;  3B71 A;  1H6G A;  3GWL A;  3LLI A;  3HKK A;  3E9V A;  2L81 A;  5CI8 A;  4O6Y A;  4YJW A;  5KYN A;  3B0V C;  2J9V A;  5GPG B;  2J9B A;  1OCZ C;  1HMD A;  1VOM A;  3SYN A;  2R7T A;  3K1H A;  1RKC A;  1YJG A;  3KL4 A;  2ETS A;  3EZH A;  3M79 A;  3LNR A;  5EK0 A;  5A6B D;  3HNK A;  3CEX A;  4NC3 A;  2LSE A;  3CQZ A;  2W9Y A;  4MND A;  4P9T A;  2NSG A;  3O55 A;  3SXK A;  2XM4 A;  1CPQ A;  5L3V A;  4HFK B;  1U6H A;  2YL3 A;  4MVZ A;  3GEI A;  4BJ5 C;  2LIG A;  4YL0 A;  1S05 A;  5JUA A;  1WTY A;  3OA1 A;  1FTS A;  4R32 A;  5KYW A;  2JD3 A;  4I1O B;  1FMV A;  4BJ6 A;  3V5Z A;  2JX0 A;  1DOW A;  2YL0 A;  4RD9 A;  3MFN A;  3KH2 A;  1OW6 A;  2D5R B;  4H54 A;  1E86 A;  3Q6M A;  1SYQ A;  3LS1 A;  2VC9 A;  1MND A;  3GOR A;  3UR3 C;  3ZQV A;  2ZXP A;  3UGO A;  2QUP A;  4PJJ A;  4Q4Z F;  3NKE A;  3IQC A;  2XS1 A;  4I1M A;  2WL8 A;  4PAC A;  2R25 A;  2G3V A;  2X0C A;  2Y3H A;  4K0D A;  2R7R A;  1K04 A;  4CDA A;  4E18 A;  3MX3 A;  4MS2 A;  3FAP B;  1C17 M;  5E3C A;  3R7C A;  2J46 A;  4J7T A;  3AG2 C;  1D1B A;  4BJ1 A;  4WGY A;  2XL8 A;  3JT1 A;  2G62 A;  4CIH A;  5B1A C;  2R7V A;  1BZ4 A;  5AC5 A;  2TMV P;  1VLS A;  3EGX A;  1BR1 A;  3QW0 A;  2A0U A;  3HNI A;  4OD5 A;  3V5Y A;  1GGQ A;  2WVN A;  1CGN A;  1OR2 A;  5HSW A;  3EPV A;  4BEJ A;  1H9G A;  2Y39 A;  1LE2 A;  3F46 A;  4NY3 A;  3J06 A;  2V3C C;  2XLH A;  3U3F A;  1NU7 D;  4CJG A;  4G7O F;  4HEA J;  4EBJ A;  4Z9J A;  4ULW A;  1LI7 A;  1G4U S;  1E85 A;  1FR0 A;  3HNL A;  1OXB A;  4C7O B;  1I4Y A;  5JVE A;  2I8B A;  2H7V C;  1Q0M A;  2BL2 A;  3PCV A;  2IXO A;  2Y3G A;  4XTK A;  1CGM E;  4AK9 A;  2AWC A;  3PDM P;  4GYT A;  2Y3B A;  2F22 A;  1HMO A;  3GEE A;  5DQT A;  5FZT A;  1OR3 A;  1VK5 A;  3VYW A;  2DYS C;  3C8G B;  2RD9 A;  1M2V A;  4MVU A;  4Q7C A;  5JLI A;  1YZC A;  2Q00 A;  1AEP A;  1ORY A;  3TD7 A;  4DBR A;  4QI2 A;  1SMY F;  3FOP A;  4U9E A;  5EGY A;  1OXK A;  3S27 A;  3EGX B;  4KI2 A;  2XSE A;  3G4Z A;  2EPL X;  1T6I A;  4QI0 A;  1Z7Q c;  4RBN A;  4LER A;  4YT8 A;  4CSA C;  4FAP B;  3NDB B;  4IWB A;  3MYF A;  4K7B A;  3T6G B;  2MWQ A;  2P6V A;  2PP4 A;  2CNW A;  2J45 A;  5BQH A;  1FAP B;  3SXZ A;  4IAQ A;  2A0B A;  3QTH A;  4IRU A;  3TOL A;  2XLM A;  4LDR A;  1D0X A;  2J8W A;  2DGJ A;  2HMQ A;  2PFD A;  2V26 A;  2GWW A;  3EFO B;  1K40 A;  4NTF A;  3O39 A;  1T9K A;  1XZP A;  4LDQ A;  4BG0 A;  1Q0D A;  3S90 A;  3KYJ A;  1WGW A;  1VB5 A;  4O79 A;  4Z9H A;  4LAC B;  3ZG1 A;  1GQA A;  2B0H A;  2KSF A;  3HTK C;  3CAX A;  3ZWI A;  1I4Z A;  1LS4 A;  2L9J A;  2RSE B;  5JSL A;  2EIM C;  1NZE A;  4KBL A;  4P9F A;  2YQY A;  1D1A A;  1SF8 A;  3KKB A;  2KGO A;  1R5I D;  2WZF A;  4IGG A;  3ASO C;  5KYY B;  2CNW D;  3B29 A;  4O7G A;  3EGD A;  4HFF B;  4N06 A;  2HFI A;  4OIP F;  2VCA A;  2Y3D A;  2WZG A;  5JP7 A;  4XEV A;  2R7O A;  3B9Q A;  4OIQ F;  3TJ6 A;  1D0Y A;  4U5G A;  1PCX A;  3AOU A;  1ORJ A;  1BR4 A;  3C18 A;  1ZHT A;  2NPU A;  3RW0 A;  3ZQY A;  3GWN A;  1HE9 A;  1BBH A;  3I5P A;  3KYI A;  1MMN A;  2LFF A;  1VYK A;  4DXW A;  1Q0F A;  2Q9B A;  2XL4 A;  2XRH A;  1O87 A;  2KYH A;  1M2V B;  3AQC A;  2PX3 A;  1QPU A;  2EIN C;  3L0I A;  5L0J A;  4D4N A;  2R7U A;  5HV9 A;  2OJQ A;  2R05 A;  2IBF A;  3LAY A;  2XM0 A;  3MLG A;  2ASR A;  1LIH A;  2XXA B;  2HSQ A;  3OWT A;  4JTC B;  2CYD A;  2D4U A;  3DJU B;  4FX5 A;  5KYU B;  1PV3 A;  1XWJ A;  2QE9 A;  3UMH A;  4DJ9 A;  3Q6N A;  3FMS A;  1OCR C;  1GM5 A;  2UUI A;  1T01 A;  2W4B A;  3K1I C;  4XQ1 A;  2A68 F;  2YLD A;  3LEO A;  4NTA A;  5KYX B;  1E83 A;  3I4U A;  3EG9 A;  3ZIB A;  2GDC A;  4PJN A;  1LI5 A;  1A41 A;  3ABK C;  4L6R A;  4P6I C;  2YEV A;  4BPM A;  5DS4 A;  3TJ5 A;  1QLE C;  4EUK B;  1TWG A;  2J7P A;  5L0F A;  1JRA A;  1ZVZ A;  3HJC A;  4GEH A;  1APC A;  1YYJ A;  3MBG A;  3ZTZ A;  4JTD B;  1J8M F;  3EFO A;  2HV6 A;  3N0T A;  2EPK X;  4XPX A;  1JR8 A;  5A6A A;  1A7E A;  1FMW A;  1KTM A;  3EZI A;  3N24 A;  4NCQ A;  3K66 A;  4C3B A;  3W8H A;  1EKY A;  1V4A A;  2Q7R A;  3PMR A;  3ZDL A;  3Q7L A;  5A6B A;  3T6B A;  5CI9 A;  4JC7 A;  1ZW2 A;  4YT2 A;  3ZSU A; 
#chains in the Genus database with same CATH homology
 3WHN A;  4XPX A;  1A7D A;  3AGU A;  2HMQ A;  2AWC A;  4XPW A;  4XPY A;  1A7E A;  1I4Y A;  1I4Z A;  2AWY A;  2AVK A;  2MHR A;  3AGT A;  1HMD A;  1HMO A;  2HMZ A;  4XQ1 A;  3WAQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...