2AWCA

Deoxy-dcrh-hr
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
130
structure length
130
Chain Sequence
VKWSEDLANLPSIDTQHKRLVDYINDLYRAARRRDMDKAREVFDALKNYAVEHFGYEERLFADYAYPEATRHKEIHRRFVETVLKWEKQLAAGDPEVVMTTLRGLVDWLVNHIMKEDKKYEAYLRERGVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for O(2) Sensing by the Hemerythrin-like Domain of a Bacterial Chemotaxis Protein: Substrate Tunnel and Fluxional N Terminus
pubmed doi rcsb
source organism Desulfovibrio vulgaris
molecule tags Oxygen storage/transport
molecule keywords hemerythrin-like domain protein DcrH
total genus 61
structure length 130
sequence length 130
ec nomenclature
pdb deposition date 2005-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01814 Hemerythrin Hemerythrin HHE cation binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.50 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Hemerythrin-like 2awcA00
4XPWA 1A7DA 2HMQA 3WHNA 1A7EA 3AGUA 1HMDA 1I4YA 2AWYA 4XPYA 3AGTA 4XQ1A 1HMOA 2HMZA 2AVKA 2AWCA 2MHRA 1I4ZA 4XPXA 3WAQA
chains in the Genus database with same CATH superfamily
3AG3C 3QMKA 2YLGA 3QZCA 2NUTA 3RVYA 3EGDA 3OA1A 1SZIA 5JRAA 4E7SA 5JT4A 1U89A 2IOQA 3E9VA 4OIPF 3QVYA 2CDQA 2NUPB 4WGZA 4XPWA 3F47A 2IXMA 5L3QA 3K7DA 4CS8A 1YVIA 3K66A 1CGME 5IY5C 5F28E 4YWQA 4J32B 5JP7A 3I4UA 1Q0KA 3GEEA 4MVQA 4XEFA 3EG9B 3MBGA 4JCZA 4C3BA 3EFOB 4CS9A 3H2UA 5K0IA 2CYDA 3LEVA 2AU5A 2PX0A 3EGXA 5E33A 2EIMC 2YLDA 4U5DE 1A7VA 1LE4A 2J7PA 5T3TA 3TK0A 1T01A 3IPMO 4GYTA 3KKBA 3NG1A 1FMVA 1QPUA 3RF3A 3O10A 4MVOA 4Z9JA 2NUTB 1UFBA 3QVZA 3SZRA 4PACA 3TOLA 5L0CA 4Q4ZF 5JVEA 2XLDA 4N6HA 3UMIA 3RKOF 2P0NA 2R7UA 2F22A 3EH1A 4BJ6A 3NRHA 4I1OB 1QLEC 4JTDB 1WASA 2J9VA 4YT8A 4FAPB 2FAPB 4HFKB 3ITFA 1V54C 4MTFA 1Z23A 1LIHA 2B0HA 4EBKA 2Q4FA 2EILC 1RCPA 3A9CA 4PK4A 1HY5A 4GQHA 5COMA 5B1AC 4OIOF 3DI5A 5AGFA 3WHNA 1R5ID 2HUJA 4BEMJ 4CJGA 5FZTA 1LI5A 1J8YF 2BC5A 3S27A 1TWCA 2XLOA 4EUKB 1BR4A 2LIGA 1D1BA 1WN0A 3FHDA 3Q7LA 4D4NA 1NFOA 3G4XA 1L7CA 3JT1A 3ASNC 5A6KA 3I5QA 3LS1A 5A6AA 3JCUQ 2XXAA 3CAXA 2R9RB 3NYLA 4JC7A 2E87A 2M4EA 2YKZA 4MVRA 1O5HA 2Y3HA 2HJMA 3US6A 1T5OA 3TQOA 5B1BC 1WTYA 3K1HA 3C63A 4H4KC 2ETSA 2W45A 1OXBA 3G4ZA 2HMQA 1M2VA 1M56C 1NBBA 1OCOC 1VOMA 3I5PA 4DVYP 4IGGA 5B3SC 5L0IA 1B68A 1YLMA 4EHPA 3MX3A 1BBHA 2IM8A 2X51A 4U9DA 3NMKA 3ZDLA 5KYUA 3GEIA 3UGOA 2XL8A 3CEXA 4QDLA 1H9GA 1WWPA 4PFPA 3HNLA 1GS9A 1KTMA 3HNKA 4NCQA 2XLHA 3RH3A 4XLPF 1NSGB 1QVXA 3JRTA 1A0BA 3KYIA 3ZTZA 2H7VC 2D5RB 4C3DA 3TJ5A 4YT4A 1YA9A 2CW0F 3U8VA 3LLKA 4BEJA 4XWJA 5DS6A 2WVNA 4BJ6C 5BQIA 2PX3A 4MVMA 2YLIA 3RW0A 4WJ0A 1APCA 4MVZA 1BR1A 2J7PD 2LFFA 4U5BE 3Q6NA 5GPGB 5EHHA 3LNRA 1TWHA 4ZLDA 3WODF 2WB7A 4MW8A 4NTAA 4KNWA 3NYJA 2NUPA 1JR8A 1M2OA 2Y3DA 3OWTA 5D92A 1E85A 3EPVA 3DAFA 3T6JA 4UDVA 1Q0MA 3L8IA 3JTLO 3U0CA 2IXPA 1A7EA 1HE1A 3AG4C 1OXKA 3C8ZA 3JSEO 3L8JA 2A69F 4MTOA 2JD3A 4U5CE 3FDQA 3N24A 1MNDA 5CI8A 2PP4A 4E0IA 4N06A 2H8AA 2OJQA 3B0VC 1CGNA 2YL7A 2HV6A 2MHRA 2AVKA 2L6GA 2LP4A 2RSEB 3MYIA 5TJ5E 3TJ6A 3B0UX 3PMRA 4YT2A 2CGEA 2UUHA 2Z15A 3LUTB 2DYRC 4DBRA 1E2XA 3UMKA 4HFFB 2AWCA 2DI3A 2NSFA 3V5YA 2FGYA 1D0XA 3WG7C 2OEXA 1D1AA 3DXJF 1ZHZA 2DYSC 2PFDA 2W4BA 2XSEA 3FVYA 4IRUA 1N1CA 1ZVZA 4XLNF 4BJ1A 1RKEA 1LS4A 4KNVA 1O3UA 2Q9CA 3ABLC 3S28A 1FFHA 4MNDA 2NG1A 4O6NA 4LERA 1FMWA 2XLWA 4EIYA 2ZXOA 4YL3A 2XLMA 5L0FA 1K40A 3KYJA 1XZQA 3K6BA 1EQ1A 2IBFA 2G3VA 2R7XA 4O6YA 1WOLA 2ASRA 1K05A 2OQMA 2CNWD 2LCHA 2Y3GA 4CS8C 1YYXA 2YL3A 4JIOA 3S90A 1TKNA 1ZU4A 5DLJA 3OEOA 1O87A 4FESA 5A6BD 5D91A 4KI2A 4OIRF 2G3KA 2J45A 2DGJA 1TWGA 2XM0A 4WABA 5COFA 1RKEB 4MVSA 3LESA 1BZ4A 4XQ1A 1KNYA 4K0DA 3A11A 3PHF2 1A7DA 3U8PA 4K1OA 5CIVA 2DB4A 1QSPA 1TFKB 1TWAA 2I15A 4O79A 2ZXWC 2L6HA 2G62A 4PJJA 1D1CA 3DAGA 1ZHXA 2Y3BA 2ZXPA 1EKYA 1A41A 4CJOA 2EPMX 3M15A 3RFYA 1CGOA 2YWAA 1OCZC 3EQLF 2YVKA 5JSLA 3DD7A 4H54A 1H9TA 3GM3A 3C8GD 4JURI 2A0UA 1YARO 1VB5A 1C03A 1U0BB 3LEOA 3J06A 3FAPB 3H2VA 2J9UA 4MS2A 4CIHA 4F4BA 1I4ZA 4P6IC 2LSEA 3AQCA 1OR2A 3L1MA 3LLIA 3CSKA 2WL8A 3U2MA 2EPKX 2QNLA 1T9KA 2M64A 4XPYA 2J9WA 3DWWA 2IXNA 4XTKA 1NLXA 3UMHA 1HMDA 4O6MA 4OD4A 3KL4A 2VCAA 4G78A 4JVSA 2X0CA 3DM9B 5DQTA 1IZMA 2HJ3A 2Y39A 2QUPA 4N6CA 2EIKC 3WAQA 4CDAA 4LDRA 4U9EA 4YK5A 3K33A 3MFNA 2KW3C 5L3VA 3VM6A 4CSAA 1DOVA 2J0XA 1SR2A 4PJMA 4G0HA 3M4CA 4AE4A 2P7VA 4QI0A 3ZQYA 3VAYA 4C7OB 2NPUA 3U3FA 1E83A 3NKDA 2KYHA 3RQFA 3IQ6A 1E86A 1HE9A 4IARA 4U5HA 1T6QA 1TQGA 5DVWA 5T1DB 1ZHWA 3BRJA 3M4BA 2OKUA 1RJ9A 4G7HF 4C7OA 1ZZPA 4MW3A 3VF0A 4JKVA 1M2VB 4CDVA 4CX9A 2MWQA 3FAJA 2KSFA 3F46A 3GWLA 3QW0A 3RVZA 4EWCA 3U3BA 3KH2A 2EINC 1D0ZA 2WZFA 2LD6A 3GANA 4FX5A 1Z7Qc 3VYWA 3GORA 3K1IA 1OKKA 1U6HA 1T6UA 3DKAA 3AG2C 2GDCA 1Q0FA 2Q00A 2VCBA 3B0PA 4AK9A 4OD5A 3UNGC 4C3EA 3EG9A 4CBEA 5DS4A 1FR0A 4LLEA 4NTFA 1J8MF 2Y69C 3T6BA 1WGWA 4J30B 4NY3A 4IJJA 4DBQA 5AC4A 1YDIA 4JJFA 2A6HF 2I8BA 2BE5F 4K7BA 4U5FE 5HSWA 1OW8A 2OJED 4DRJB 2GAQA 2KC3A 3PCVA 3JRMO 4PJNA 4E7ZA 4ANJA 1MQVA 1AUEA 1SF8A 1RJ9B 3SXKA 4JTCB 2ICWG 5F5FA 3B9QA 1NU9C 256BA 3LNMB 4JCHA 3DJUB 1G5ZA 4YL0A 3SP1A 3UGPA 1VK5A 2C04A 1OW6A 3AQBA 4OINF 1EA8A 4MQ9F 5E3CA 2J9BA 4D4XA 4J7TA 2IYLD 3GEHA 4YT5A 1L3PA 1Z5ZA 2YEVA 3S9OA 2J8WA 2YQYA 2Q3TA 2VB6A 2LFDA 3G50A 3IQCA 5L0DA 3HLZA 3EZIA 3TOMA 3BEHA 1YA7O 4R32A 4JZAA 2P6VA 4Z9IA 3HNIA 2HZ8A 2QY9A 3S0XA 3N2ZB 2ZPAA 3N0TA 4CIPA 1JAFA 3CQZA 2R7VA 3LAYA 3V5ZA 1Q0DA 1NU7D 1ZHTA 3FOPA 1LS1A 1M57C 2H7OA 2JX0A 2L6FA 4RD9A 5CI9A 3NKEA 2Q7RA 3U9JA 1ZYRF 1EI7A 2HKVA 3KMIA 5BQHA 3ZVRA 4IAOA 2R7TA 4NC3A 1JPNA 2XRHA 4YJWA 3IHUA 3E70C 2BL2A 2GFHA 4ONSA 5DQZA 2PF4E 1LKXA 5HV9A 3ABKC 1WATA 2XM4A 3SEOA 4RBNA 1MNEA 2YL0A 1I4YA 2VC9A 3W2VA 1GGQA 3C62A 5BUOA 3H65A 4X0RA 3W4YA 3FOOA 1CPRA 1K04A 3O39A 3EGDB 4PFOA 1T6IA 3TULA 2D4UA 2PNOA 1LE2A 2V3CC 4PJLA 1Z63A 3RQGA 3HNJA 2XS8A 1ORJA 1PCXA 4LDKA 2KK1A 3W8HA 4N4WA 5KYNA 3NDBB 1MMGA 2L7AA 1VYKA 1D0YA 3ZWIA 4AX2A 4A4AA 2R7SA 4CDYA 5FCLA 2AP3A 4O7GA 2XL4A 3TD7A 3QW1A 4M63A 3M1CB 4AE4B 5E3AA 2J46A 2LK4A 3LJBA 4IAQA 4NTBA 1BDJB 3T9OA 2YL1A 3UR3C 5DS5A 4BJTA 2QTVA 3GWNA 5E2QA 2ZXRA 1IW7F 1HMOA 3C8GA 4I3MA 3CZ6A 2OU6A 1LPEA 2OCCC 2Q9AA 2R03A 4JE9A 1ZW2A 2EIJC 3IQTA 4MVUA 5F5HA 5KYUB 1C02A 1NFNA 4KC9A 1AEPA 2R05A 3DE8A 3IEEA 3K1IC 2A1DD 4JEBA 2UUIA 3ZTMA 2OOCA 1S7ZA 2QE9A 4E0HA 3EHNA 2EPNA 2HSQA 3M79A 4LACB 3GM2A 2OEVA 1LI7A 2KJGA 3EHMA 2P1AA 1OR3A 5T3WA 3JZ0A 5AC5A 2R7WA 2KNHA 2L81A 4BJ5C 2HSBA 4XEKA 2A68F 1F1MA 5KYYB 2L9JA 2R7RA 1OCRC 3C7JA 3S29A 4E17A 1E84A 3MLGA 4ULWA 1PD0A 3AJMA 3SXZA 2XS1A 3DM5A 3C8GB 5B3IA 2R7OA 2CNWA 2GWWA 1JMWA 2KQ9A 2EPOA 2FFHA 3V7OA 4DJ9A 4DXWA 5KYYA 1G4WR 4CS7A 5L0GA 3EH2A 4CSAC 3L0IA 5A6JA 1YZCA 1OKKD 1YJGA 1YYJA 3AGTA 1ZW3A 3T4RA 2W4MA 3ABMC 3EZHA 1Z6AA 2YHSA 3RIPA 1VLTA 2R7QA 4JW1A 4HEAJ 4BG0A 2CCYA 3C18A 1XWJA 4BPMA 3JYHA 2NSGA 5KYXB 1ZU5A 4LLCA 2O9XA 3Q6MA 3NYMA 4QI2A 3ZG1A 3W2WA 1Y4CA 1NZEA 1XZPA 3T6GB 4EBBA 2TMVP 1W2WA 2HV7A 3RQEA 5JUAA 2B0JA 5KYWA 5KYXA 2HS5A 1ORYA 2MYSA 3QTHA 3DJNB 2WVQA 2KGOA 4MTGA 4NQFA 1V55C 4J7YA 2XXAB 4YL1A 4U5GA 3U5SA 4G7OF 1ZHYA 2P61A 2XLVA 2C03A 4KBLA 2W9YA 1DOWA 1I5NA 3X2QC 2AWYA 4IWBA 2R25A 3GM1A 3ZSUA 3U9MA 3HTKC 3EGXB 5L0JA 2HFIA 2PBEA 3SNHA 5A69A 1HW2A 1FFTC 4Z9HA 2JPUA 4JEAA 3SXYA 3SYNA 1FTSA 1JOGA 3GODA 4DRIB 1GM5A 2VASA 1V4AA 1LM3B 1LVKA 1UG7A 4P9TA 4I1MA 1G8XA 3ZIBA 4B6IA 3POVA 1QQ3A 4G7ZF 1RXQA 1SMYF 1M6TA 3FXHA 4FWVA 3JSZA 4HE8D 1SYQA 5L0HA 3EJNA 3LS0A 4RDAA 4EKWA 3PDMP 4E18A 1JPJA 1VLSA 1S05A 3ATPA 2A6EF 4AL1A 1Q0GA 2H7BA 2GA0A 2RD9A 3U2LA 1MMDA 2WZLA 3L34A 3W8IA 4BJ5A 1GQAA 4DVZA 5EGYA 1YAUO 2V26A 3VRCA 1OCCC 3RYLA 1C17M 4DOZA 1PV3A 2XLEA 4WGYA 3HKKA 3R7CA 2EPLX 3JYYA 5COGA 3X1OA 4AL0A 2XL6A 3SXMA 4ULVA 3NMJA 1BR2A 4OIQF 1ORSC 3NMIA 1TR2A 3EFOA 1VTMP 3KPHA 3B71A 3DZAA 4W8PA 4U5EE 4DRHB 1R4TA 3ASOC 3ECSA 1YZAA 3MYFA 5BQGA 3S84A 1JRAA 1CPQA 3R2PA 4W8KA 1Z3IX 4JTAB 4L6RA 3AG1C 4JJGA 3V5XA 5A6BA 3ZC4A 3HJCA 3AGUA 1OW7A 2YRFA 2QLAA 4ER9A 1TFOB 2ZD9A 1H7IA 2WZGA 4CS9C 4ZLCA 1OQCA 1MMAA 4I44A 1QZXA 1AVOB 5EK0A 1MMNA 1V74B 2IXOA 3O6XA 4P9FA 2J0WA 3IQ5A 4PR9A 1FNTc 1QKRA 2VH3A 3Q7GA 5JLIA 1HW1A 2YZSA 4JRZA 2Q9BA 4XPXA 1KU2A 1RMVA 3DE9A 4YN0B 2R02A 1VMAA 2WVOA 2A0BA 3AOUA 3O55A 4IB4A 1FAPB 4XEVA 2HMZA 4Q5SF 1VYIA 1RKCA 1Y6DA 5KYWB 3B29A 2LQGA 4LDQA 1H6GA 5JS5A 3DMDA 1PD1A 4A2NB 1G4US 1ST6A 4Q7CA 4EBJA 3ZQVA 2VCCA 1NG1A 3FMSA 4GEHA 2OG2A
chains in the Genus database with same CATH topology
4XPWA 1A7DA 2HMQA 3WHNA 1A7EA 3AGUA 1HMDA 1I4YA 2AWYA 4XPYA 3AGTA 4XQ1A 1HMOA 2HMZA 2AVKA 2AWCA 2MHRA 1I4ZA 4XPXA 3WAQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XPW A;  1A7D A;  2HMQ A;  3WHN A;  1A7E A;  3AGU A;  1HMD A;  1I4Y A;  2AWY A;  4XPY A;  3AGT A;  4XQ1 A;  1HMO A;  2HMZ A;  2AVK A;  2AWC A;  2MHR A;  1I4Z A;  4XPX A;  3WAQ A; 
#chains in the Genus database with same CATH topology
 3AG3 C;  3QMK A;  2YLG A;  3QZC A;  2NUT A;  3RVY A;  3EGD A;  3OA1 A;  1SZI A;  5JRA A;  4E7S A;  5JT4 A;  1U89 A;  2IOQ A;  3E9V A;  4OIP F;  3QVY A;  2CDQ A;  2NUP B;  4WGZ A;  4XPW A;  3F47 A;  2IXM A;  5L3Q A;  3K7D A;  4CS8 A;  1YVI A;  3K66 A;  1CGM E;  5IY5 C;  5F28 E;  4YWQ A;  4J32 B;  5JP7 A;  3I4U A;  1Q0K A;  3GEE A;  4MVQ A;  4XEF A;  3EG9 B;  3MBG A;  4JCZ A;  4C3B A;  3EFO B;  4CS9 A;  3H2U A;  5K0I A;  2CYD A;  3LEV A;  2AU5 A;  2PX0 A;  3EGX A;  5E33 A;  2EIM C;  2YLD A;  4U5D E;  1A7V A;  1LE4 A;  2J7P A;  5T3T A;  3TK0 A;  1T01 A;  3IPM O;  4GYT A;  3KKB A;  3NG1 A;  1FMV A;  1QPU A;  3RF3 A;  3O10 A;  4MVO A;  4Z9J A;  2NUT B;  1UFB A;  3QVZ A;  3SZR A;  4PAC A;  3TOL A;  5L0C A;  4Q4Z F;  5JVE A;  2XLD A;  4N6H A;  3UMI A;  3RKO F;  2P0N A;  2R7U A;  2F22 A;  3EH1 A;  4BJ6 A;  3NRH A;  4I1O B;  1QLE C;  4JTD B;  1WAS A;  2J9V A;  4YT8 A;  4FAP B;  2FAP B;  4HFK B;  3ITF A;  1V54 C;  4MTF A;  1Z23 A;  1LIH A;  2B0H A;  4EBK A;  2Q4F A;  2EIL C;  1RCP A;  3A9C A;  4PK4 A;  1HY5 A;  4GQH A;  5COM A;  5B1A C;  4OIO F;  3DI5 A;  5AGF A;  3WHN A;  1R5I D;  2HUJ A;  4BEM J;  4CJG A;  5FZT A;  1LI5 A;  1J8Y F;  2BC5 A;  3S27 A;  1TWC A;  2XLO A;  4EUK B;  1BR4 A;  2LIG A;  1D1B A;  1WN0 A;  3FHD A;  3Q7L A;  4D4N A;  1NFO A;  3G4X A;  1L7C A;  3JT1 A;  3ASN C;  5A6K A;  3I5Q A;  3LS1 A;  5A6A A;  3JCU Q;  2XXA A;  3CAX A;  2R9R B;  3NYL A;  4JC7 A;  2E87 A;  2M4E A;  2YKZ A;  4MVR A;  1O5H A;  2Y3H A;  2HJM A;  3US6 A;  1T5O A;  3TQO A;  5B1B C;  1WTY A;  3K1H A;  3C63 A;  4H4K C;  2ETS A;  2W45 A;  1OXB A;  3G4Z A;  2HMQ A;  1M2V A;  1M56 C;  1NBB A;  1OCO C;  1VOM A;  3I5P A;  4DVY P;  4IGG A;  5B3S C;  5L0I A;  1B68 A;  1YLM A;  4EHP A;  3MX3 A;  1BBH A;  2IM8 A;  2X51 A;  4U9D A;  3NMK A;  3ZDL A;  5KYU A;  3GEI A;  3UGO A;  2XL8 A;  3CEX A;  4QDL A;  1H9G A;  1WWP A;  4PFP A;  3HNL A;  1GS9 A;  1KTM A;  3HNK A;  4NCQ A;  2XLH A;  3RH3 A;  4XLP F;  1NSG B;  1QVX A;  3JRT A;  1A0B A;  3KYI A;  3ZTZ A;  2H7V C;  2D5R B;  4C3D A;  3TJ5 A;  4YT4 A;  1YA9 A;  2CW0 F;  3U8V A;  3LLK A;  4BEJ A;  4XWJ A;  5DS6 A;  2WVN A;  4BJ6 C;  5BQI A;  2PX3 A;  4MVM A;  2YLI A;  3RW0 A;  4WJ0 A;  1APC A;  4MVZ A;  1BR1 A;  2J7P D;  2LFF A;  4U5B E;  3Q6N A;  5GPG B;  5EHH A;  3LNR A;  1TWH A;  4ZLD A;  3WOD F;  2WB7 A;  4MW8 A;  4NTA A;  4KNW A;  3NYJ A;  2NUP A;  1JR8 A;  1M2O A;  2Y3D A;  3OWT A;  5D92 A;  1E85 A;  3EPV A;  3DAF A;  3T6J A;  4UDV A;  1Q0M A;  3L8I A;  3JTL O;  3U0C A;  2IXP A;  1A7E A;  1HE1 A;  3AG4 C;  1OXK A;  3C8Z A;  3JSE O;  3L8J A;  2A69 F;  4MTO A;  2JD3 A;  4U5C E;  3FDQ A;  3N24 A;  1MND A;  5CI8 A;  2PP4 A;  4E0I A;  4N06 A;  2H8A A;  2OJQ A;  3B0V C;  1CGN A;  2YL7 A;  2HV6 A;  2MHR A;  2AVK A;  2L6G A;  2LP4 A;  2RSE B;  3MYI A;  5TJ5 E;  3TJ6 A;  3B0U X;  3PMR A;  4YT2 A;  2CGE A;  2UUH A;  2Z15 A;  3LUT B;  2DYR C;  4DBR A;  1E2X A;  3UMK A;  4HFF B;  2AWC A;  2DI3 A;  2NSF A;  3V5Y A;  2FGY A;  1D0X A;  3WG7 C;  2OEX A;  1D1A A;  3DXJ F;  1ZHZ A;  2DYS C;  2PFD A;  2W4B A;  2XSE A;  3FVY A;  4IRU A;  1N1C A;  1ZVZ A;  4XLN F;  4BJ1 A;  1RKE A;  1LS4 A;  4KNV A;  1O3U A;  2Q9C A;  3ABL C;  3S28 A;  1FFH A;  4MND A;  2NG1 A;  4O6N A;  4LER A;  1FMW A;  2XLW A;  4EIY A;  2ZXO A;  4YL3 A;  2XLM A;  5L0F A;  1K40 A;  3KYJ A;  1XZQ A;  3K6B A;  1EQ1 A;  2IBF A;  2G3V A;  2R7X A;  4O6Y A;  1WOL A;  2ASR A;  1K05 A;  2OQM A;  2CNW D;  2LCH A;  2Y3G A;  4CS8 C;  1YYX A;  2YL3 A;  4JIO A;  3S90 A;  1TKN A;  1ZU4 A;  5DLJ A;  3OEO A;  1O87 A;  4FES A;  5A6B D;  5D91 A;  4KI2 A;  4OIR F;  2G3K A;  2J45 A;  2DGJ A;  1TWG A;  2XM0 A;  4WAB A;  5COF A;  1RKE B;  4MVS A;  3LES A;  1BZ4 A;  4XQ1 A;  1KNY A;  4K0D A;  3A11 A;  3PHF 2;  1A7D A;  3U8P A;  4K1O A;  5CIV A;  2DB4 A;  1QSP A;  1TFK B;  1TWA A;  2I15 A;  4O79 A;  2ZXW C;  2L6H A;  2G62 A;  4PJJ A;  1D1C A;  3DAG A;  1ZHX A;  2Y3B A;  2ZXP A;  1EKY A;  1A41 A;  4CJO A;  2EPM X;  3M15 A;  3RFY A;  1CGO A;  2YWA A;  1OCZ C;  3EQL F;  2YVK A;  5JSL A;  3DD7 A;  4H54 A;  1H9T A;  3GM3 A;  3C8G D;  4JUR I;  2A0U A;  1YAR O;  1VB5 A;  1C03 A;  1U0B B;  3LEO A;  3J06 A;  3FAP B;  3H2V A;  2J9U A;  4MS2 A;  4CIH A;  4F4B A;  1I4Z A;  4P6I C;  2LSE A;  3AQC A;  1OR2 A;  3L1M A;  3LLI A;  3CSK A;  2WL8 A;  3U2M A;  2EPK X;  2QNL A;  1T9K A;  2M64 A;  4XPY A;  2J9W A;  3DWW A;  2IXN A;  4XTK A;  1NLX A;  3UMH A;  1HMD A;  4O6M A;  4OD4 A;  3KL4 A;  2VCA A;  4G78 A;  4JVS A;  2X0C A;  3DM9 B;  5DQT A;  1IZM A;  2HJ3 A;  2Y39 A;  2QUP A;  4N6C A;  2EIK C;  3WAQ A;  4CDA A;  4LDR A;  4U9E A;  4YK5 A;  3K33 A;  3MFN A;  2KW3 C;  5L3V A;  3VM6 A;  4CSA A;  1DOV A;  2J0X A;  1SR2 A;  4PJM A;  4G0H A;  3M4C A;  4AE4 A;  2P7V A;  4QI0 A;  3ZQY A;  3VAY A;  4C7O B;  2NPU A;  3U3F A;  1E83 A;  3NKD A;  2KYH A;  3RQF A;  3IQ6 A;  1E86 A;  1HE9 A;  4IAR A;  4U5H A;  1T6Q A;  1TQG A;  5DVW A;  5T1D B;  1ZHW A;  3BRJ A;  3M4B A;  2OKU A;  1RJ9 A;  4G7H F;  4C7O A;  1ZZP A;  4MW3 A;  3VF0 A;  4JKV A;  1M2V B;  4CDV A;  4CX9 A;  2MWQ A;  3FAJ A;  2KSF A;  3F46 A;  3GWL A;  3QW0 A;  3RVZ A;  4EWC A;  3U3B A;  3KH2 A;  2EIN C;  1D0Z A;  2WZF A;  2LD6 A;  3GAN A;  4FX5 A;  1Z7Q c;  3VYW A;  3GOR A;  3K1I A;  1OKK A;  1U6H A;  1T6U A;  3DKA A;  3AG2 C;  2GDC A;  1Q0F A;  2Q00 A;  2VCB A;  3B0P A;  4AK9 A;  4OD5 A;  3UNG C;  4C3E A;  3EG9 A;  4CBE A;  5DS4 A;  1FR0 A;  4LLE A;  4NTF A;  1J8M F;  2Y69 C;  3T6B A;  1WGW A;  4J30 B;  4NY3 A;  4IJJ A;  4DBQ A;  5AC4 A;  1YDI A;  4JJF A;  2A6H F;  2I8B A;  2BE5 F;  4K7B A;  4U5F E;  5HSW A;  1OW8 A;  2OJE D;  4DRJ B;  2GAQ A;  2KC3 A;  3PCV A;  3JRM O;  4PJN A;  4E7Z A;  4ANJ A;  1MQV A;  1AUE A;  1SF8 A;  1RJ9 B;  3SXK A;  4JTC B;  2ICW G;  5F5F A;  3B9Q A;  1NU9 C;  256B A;  3LNM B;  4JCH A;  3DJU B;  1G5Z A;  4YL0 A;  3SP1 A;  3UGP A;  1VK5 A;  2C04 A;  1OW6 A;  3AQB A;  4OIN F;  1EA8 A;  4MQ9 F;  5E3C A;  2J9B A;  4D4X A;  4J7T A;  2IYL D;  3GEH A;  4YT5 A;  1L3P A;  1Z5Z A;  2YEV A;  3S9O A;  2J8W A;  2YQY A;  2Q3T A;  2VB6 A;  2LFD A;  3G50 A;  3IQC A;  5L0D A;  3HLZ A;  3EZI A;  3TOM A;  3BEH A;  1YA7 O;  4R32 A;  4JZA A;  2P6V A;  4Z9I A;  3HNI A;  2HZ8 A;  2QY9 A;  3S0X A;  3N2Z B;  2ZPA A;  3N0T A;  4CIP A;  1JAF A;  3CQZ A;  2R7V A;  3LAY A;  3V5Z A;  1Q0D A;  1NU7 D;  1ZHT A;  3FOP A;  1LS1 A;  1M57 C;  2H7O A;  2JX0 A;  2L6F A;  4RD9 A;  5CI9 A;  3NKE A;  2Q7R A;  3U9J A;  1ZYR F;  1EI7 A;  2HKV A;  3KMI A;  5BQH A;  3ZVR A;  4IAO A;  2R7T A;  4NC3 A;  1JPN A;  2XRH A;  4YJW A;  3IHU A;  3E70 C;  2BL2 A;  2GFH A;  4ONS A;  5DQZ A;  2PF4 E;  1LKX A;  5HV9 A;  3ABK C;  1WAT A;  2XM4 A;  3SEO A;  4RBN A;  1MNE A;  2YL0 A;  1I4Y A;  2VC9 A;  3W2V A;  1GGQ A;  3C62 A;  5BUO A;  3H65 A;  4X0R A;  3W4Y A;  3FOO A;  1CPR A;  1K04 A;  3O39 A;  3EGD B;  4PFO A;  1T6I A;  3TUL A;  2D4U A;  2PNO A;  1LE2 A;  2V3C C;  4PJL A;  1Z63 A;  3RQG A;  3HNJ A;  2XS8 A;  1ORJ A;  1PCX A;  4LDK A;  2KK1 A;  3W8H A;  4N4W A;  5KYN A;  3NDB B;  1MMG A;  2L7A A;  1VYK A;  1D0Y A;  3ZWI A;  4AX2 A;  4A4A A;  2R7S A;  4CDY A;  5FCL A;  2AP3 A;  4O7G A;  2XL4 A;  3TD7 A;  3QW1 A;  4M63 A;  3M1C B;  4AE4 B;  5E3A A;  2J46 A;  2LK4 A;  3LJB A;  4IAQ A;  4NTB A;  1BDJ B;  3T9O A;  2YL1 A;  3UR3 C;  5DS5 A;  4BJT A;  2QTV A;  3GWN A;  5E2Q A;  2ZXR A;  1IW7 F;  1HMO A;  3C8G A;  4I3M A;  3CZ6 A;  2OU6 A;  1LPE A;  2OCC C;  2Q9A A;  2R03 A;  4JE9 A;  1ZW2 A;  2EIJ C;  3IQT A;  4MVU A;  5F5H A;  5KYU B;  1C02 A;  1NFN A;  4KC9 A;  1AEP A;  2R05 A;  3DE8 A;  3IEE A;  3K1I C;  2A1D D;  4JEB A;  2UUI A;  3ZTM A;  2OOC A;  1S7Z A;  2QE9 A;  4E0H A;  3EHN A;  2EPN A;  2HSQ A;  3M79 A;  4LAC B;  3GM2 A;  2OEV A;  1LI7 A;  2KJG A;  3EHM A;  2P1A A;  1OR3 A;  5T3W A;  3JZ0 A;  5AC5 A;  2R7W A;  2KNH A;  2L81 A;  4BJ5 C;  2HSB A;  4XEK A;  2A68 F;  1F1M A;  5KYY B;  2L9J A;  2R7R A;  1OCR C;  3C7J A;  3S29 A;  4E17 A;  1E84 A;  3MLG A;  4ULW A;  1PD0 A;  3AJM A;  3SXZ A;  2XS1 A;  3DM5 A;  3C8G B;  5B3I A;  2R7O A;  2CNW A;  2GWW A;  1JMW A;  2KQ9 A;  2EPO A;  2FFH A;  3V7O A;  4DJ9 A;  4DXW A;  5KYY A;  1G4W R;  4CS7 A;  5L0G A;  3EH2 A;  4CSA C;  3L0I A;  5A6J A;  1YZC A;  1OKK D;  1YJG A;  1YYJ A;  3AGT A;  1ZW3 A;  3T4R A;  2W4M A;  3ABM C;  3EZH A;  1Z6A A;  2YHS A;  3RIP A;  1VLT A;  2R7Q A;  4JW1 A;  4HEA J;  4BG0 A;  2CCY A;  3C18 A;  1XWJ A;  4BPM A;  3JYH A;  2NSG A;  5KYX B;  1ZU5 A;  4LLC A;  2O9X A;  3Q6M A;  3NYM A;  4QI2 A;  3ZG1 A;  3W2W A;  1Y4C A;  1NZE A;  1XZP A;  3T6G B;  4EBB A;  2TMV P;  1W2W A;  2HV7 A;  3RQE A;  5JUA A;  2B0J A;  5KYW A;  5KYX A;  2HS5 A;  1ORY A;  2MYS A;  3QTH A;  3DJN B;  2WVQ A;  2KGO A;  4MTG A;  4NQF A;  1V55 C;  4J7Y A;  2XXA B;  4YL1 A;  4U5G A;  3U5S A;  4G7O F;  1ZHY A;  2P61 A;  2XLV A;  2C03 A;  4KBL A;  2W9Y A;  1DOW A;  1I5N A;  3X2Q C;  2AWY A;  4IWB A;  2R25 A;  3GM1 A;  3ZSU A;  3U9M A;  3HTK C;  3EGX B;  5L0J A;  2HFI A;  2PBE A;  3SNH A;  5A69 A;  1HW2 A;  1FFT C;  4Z9H A;  2JPU A;  4JEA A;  3SXY A;  3SYN A;  1FTS A;  1JOG A;  3GOD A;  4DRI B;  1GM5 A;  2VAS A;  1V4A A;  1LM3 B;  1LVK A;  1UG7 A;  4P9T A;  4I1M A;  1G8X A;  3ZIB A;  4B6I A;  3POV A;  1QQ3 A;  4G7Z F;  1RXQ A;  1SMY F;  1M6T A;  3FXH A;  4FWV A;  3JSZ A;  4HE8 D;  1SYQ A;  5L0H A;  3EJN A;  3LS0 A;  4RDA A;  4EKW A;  3PDM P;  4E18 A;  1JPJ A;  1VLS A;  1S05 A;  3ATP A;  2A6E F;  4AL1 A;  1Q0G A;  2H7B A;  2GA0 A;  2RD9 A;  3U2L A;  1MMD A;  2WZL A;  3L34 A;  3W8I A;  4BJ5 A;  1GQA A;  4DVZ A;  5EGY A;  1YAU O;  2V26 A;  3VRC A;  1OCC C;  3RYL A;  1C17 M;  4DOZ A;  1PV3 A;  2XLE A;  4WGY A;  3HKK A;  3R7C A;  2EPL X;  3JYY A;  5COG A;  3X1O A;  4AL0 A;  2XL6 A;  3SXM A;  4ULV A;  3NMJ A;  1BR2 A;  4OIQ F;  1ORS C;  3NMI A;  1TR2 A;  3EFO A;  1VTM P;  3KPH A;  3B71 A;  3DZA A;  4W8P A;  4U5E E;  4DRH B;  1R4T A;  3ASO C;  3ECS A;  1YZA A;  3MYF A;  5BQG A;  3S84 A;  1JRA A;  1CPQ A;  3R2P A;  4W8K A;  1Z3I X;  4JTA B;  4L6R A;  3AG1 C;  4JJG A;  3V5X A;  5A6B A;  3ZC4 A;  3HJC A;  3AGU A;  1OW7 A;  2YRF A;  2QLA A;  4ER9 A;  1TFO B;  2ZD9 A;  1H7I A;  2WZG A;  4CS9 C;  4ZLC A;  1OQC A;  1MMA A;  4I44 A;  1QZX A;  1AVO B;  5EK0 A;  1MMN A;  1V74 B;  2IXO A;  3O6X A;  4P9F A;  2J0W A;  3IQ5 A;  4PR9 A;  1FNT c;  1QKR A;  2VH3 A;  3Q7G A;  5JLI A;  1HW1 A;  2YZS A;  4JRZ A;  2Q9B A;  4XPX A;  1KU2 A;  1RMV A;  3DE9 A;  4YN0 B;  2R02 A;  1VMA A;  2WVO A;  2A0B A;  3AOU A;  3O55 A;  4IB4 A;  1FAP B;  4XEV A;  2HMZ A;  4Q5S F;  1VYI A;  1RKC A;  1Y6D A;  5KYW B;  3B29 A;  2LQG A;  4LDQ A;  1H6G A;  5JS5 A;  3DMD A;  1PD1 A;  4A2N B;  1G4U S;  1ST6 A;  4Q7C A;  4EBJ A;  3ZQV A;  2VCC A;  1NG1 A;  3FMS A;  4GEH A;  2OG2 A; 
#chains in the Genus database with same CATH homology
 4XPW A;  1A7D A;  2HMQ A;  3WHN A;  1A7E A;  3AGU A;  1HMD A;  1I4Y A;  2AWY A;  4XPY A;  3AGT A;  4XQ1 A;  1HMO A;  2HMZ A;  2AVK A;  2AWC A;  2MHR A;  1I4Z A;  4XPX A;  3WAQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...