2AWCA

Deoxy-dcrh-hr
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
130
structure length
130
Chain Sequence
b'VKWSEDLANLPSIDTQHKRLVDYINDLYRAARRRDMDKAREVFDALKNYAVEHFGYEERLFADYAYPEATRHKEIHRRFVETVLKWEKQLAAGDPEVVMTTLRGLVDWLVNHIMKEDKKYEAYLRERGVS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hemerythrin-like domain protein DcrH
molecule tags Oxygen storage/transport
source organism Desulfovibrio vulgaris
publication title Structural Basis for O(2) Sensing by the Hemerythrin-like Domain of a Bacterial Chemotaxis Protein: Substrate Tunnel and Fluxional N Terminus
pubmed doi rcsb
total genus 61
structure length 130
sequence length 130
ec nomenclature
pdb deposition date 2005-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01814 Hemerythrin Hemerythrin HHE cation binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.50 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Hemerythrin-like 2awcA00
1HMDA 4XPYA 4XPWA 1I4YA 4XQ1A 2AWCA 1I4ZA 2MHRA 3WHNA 1HMOA 3AGUA 3WAQA 1A7EA 1A7DA 2AWYA 2HMQA 2AVKA 4XPXA 3AGTA 2HMZA
chains in the Genus database with same CATH superfamily
1R4TA 1IZMA 4EUKB 3SZRA 3S27A 2WVOA 5B3SC 2LCHA 4ULWA 3B0VC 5HV9A 4KI2A 1T6QA 3RKOF 4WJ0A 2A6EF 5CI8A 3EH1A 4IAOA 3RQGA 1V55C 1BZ4A 1NG1A 2G3VA 3DD7A 4GQHA 4PK4A 3NMJA 1D0XA 4E7SA 2F22A 3ZQYA 2ETSA 1Z63A 3NDBB 4JTCB 1A7DA 3NYLA 4YL0A 5JS5A 1T6IA 4N6CA 3MYIA 4IARA 4J7TA 4WABA 4ANJA 3DE8A 1R5ID 1FAPB 2XXAB 5T3TA 3N24A 4Q5SF 1H7IA 2C04A 2EINC 2R7QA 3G4XA 5L3QA 4OIPF 2OJQA 2XLWA 3M79A 4Q4ZF 3SXMA 2XS1A 1APCA 3OWTA 4XQ1A 4CJGA 3FAJA 4HFFB 1ZU5A 1M2VB 1D1AA 1LI5A 2Q4FA 3G4ZA 3U3FA 3EGXA 3LS1A 2CYDA 2Q3TA 3EGXB 3KYIA 1WASA 2DB4A 3T4RA 3V5ZA 2NUTA 2EPKX 3QVZA 2C03A 4XWJA 4YJWA 3HKKA 1SMYF 1D1BA 2ZXPA 4D4XA 5IY5C 4H4KC 3QTHA 5F5HA 2R03A 2BL2A 4KNVA 4U9DA 3E9VA 4NQFA 5JRAA 3NMIA 2VASA 4XPWA 4BJ5A 1FNTc 2GAQA 2AP3A 1U0BB 2XLMA 1Z6AA 3JSZA 5F28E 3EGDA 3RQEA 3V7OA 3EGDB 1FMVA 1Q0FA 2HSQA 2WL8A 3DJNB 4RDAA 2YL1A 1NFNA 1NU9C 1RKEB 2R05A 3GORA 3TD7A 3BRJA 1H9GA 2EIKC 1RJ9B 1SZIA 1TQGA 1ZW2A 2A0BA 3H2UA 3JTLO 4JEBA 5T3WA 3RVZA 1H9TA 2L7AA 2PX0A 5FZTA 4EBKA 4EKWA 4YT5A 1GS9A 2JPUA 4IB4A 4KC9A 1D0ZA 2FFHA 1HE1A 1MMNA 3CSKA 4K0DA 4XEKA 1VB5A 2R7UA 2HJ3A 1JPJA 1JPNA 1V74B 3IHUA 4FX5A 1E85A 2ZXRA 3AQCA 4MW3A 1U89A 3DMDA 2P61A 4PFPA 2Y69C 1WN0A 3S0XA 4LLEA 5L0CA 1QSPA 2XL8A 1I4YA 2FAPB 4JTAB 4XTKA 3QW1A 3U2LA 3F47A 1MNEA 1E2XA 2XL4A 2HZ8A 4G7ZF 3S9OA 4JE9A 3SEOA 2R7SA 1A7VA 1MNDA 3C8GA 3UNGC 1DOWA 3K1HA 2YRFA 3K66A 5BUOA 2WZGA 1VTMP 1AUEA 1I5NA 4DRIB 2AU5A 4N4WA 1YAUO 5DS5A 2KC3A 2G62A 4N6HA 3GM1A 3ECSA 4AK9A 2A69F 3T6BA 2L81A 3DM5A 1QLEC 1HY5A 4JW1A 3RQFA 2KNHA 4MNDA 3ZVRA 2D5RB 2CNWA 4CSAA 2R7TA 2LQGA 2QUPA 4PFOA 1U6HA 3WODF 4PJJA 3E70C 4K1OA 1DOVA 4MVMA 2HV7A 1UG7A 3IQ5A 4JCHA 4PR9A 1JR8A 4WGZA 5DLJA 4W8PA 2QNLA 3SNHA 1ZZPA 1JAFA 4NTBA 5L0GA 4O6YA 2J7PA 4C3EA 1E84A 2B0JA 3JYYA 2YEVA 2P7VA 2YL0A 1EI7A 3AQBA 4WGYA 4O7GA 4LDQA 3KYJA 3LESA 2I15A 4P9FA 2J0XA 3GWNA 1T01A 5L0IA 3I5PA 5GPGB 4MS2A 1EKYA 2H7VC 2EPMX 1D0YA 2Y3GA 2OKUA 4NY3A 1M2OA 3DAGA 5AC5A 3OEOA 3JZ0A 2OJED 3UR3C 1OR2A 3Q6MA 4G78A 1OQCA 2EPLX 3H65A 4IJJA 1NLXA 3U3BA 4JTDB 4Z9HA 4CS8C 1M57C 4YK5A 5D92A 4A2NB 1A41A 2GWWA 1CGME 1O5HA 2HMQA 3U8VA 1V54C 2IXNA 2XM0A 4W8KA 3B0UX 4Q7CA 3LEVA 1OXKA 5KYWA 1L7CA 3QMKA 4PACA 1GGQA 3NKDA 4FWVA 3EZHA 3QW0A 4AE4B 5FCLA 3C63A 1ZHXA 4OINF 3AG4C 4CDYA 2NUPB 5EHHA 2WZFA 1YYXA 4BG0A 1RJ9A 1SYQA 1UFBA 3S90A 1OKKD 4NTAA 4MTOA 3VAYA 2KQ9A 3LLKA 3U0CA 4QI2A 1FTSA 3U9JA 3SYNA 3ZWIA 2L6FA 2DI3A 3GODA 2VB6A 1WOLA 2VCCA 3PHF2 4DRHB 3RYLA 3UMIA 2OCCC 4OD4A 2DYSC 3M15A 4O79A 3EFOA 1FFTC 3JCUQ 1JRAA 3R2PA 4G0HA 3IQCA 3A11A 2J45A 5D91A 4FAPB 4CBEA 4MTFA 2J46A 4H54A 4JKVA 2PF4E 3B71A 2XS8A 3NYMA 1PD0A 3V5XA 1XZPA 4MW8A 3RFYA 3FDQA 3DI5A 2H7OA 3EHMA 1BR1A 2AVKA 1ZU4A 4DVZA 1RMVA 2YL7A 2QTVA 3A9CA 1CGNA 3Q7LA 4BJ6C 1T5OA 3EPVA 1QKRA 3LAYA 4AL0A 2KGOA 1H6GA 1S7ZA 2L9JA 2UUIA 3TJ6A 3EG9A 1GM5A 2YHSA 2R7XA 1QZXA 4M63A 4BEMJ 3I5QA 1JOGA 4IWBA 4JIOA 3VM6A 3C7JA 2P6VA 1YA9A 5KYYB 1ZYRF 3MFNA 4JRZA 1Z7Qc 4IGGA 2XM4A 2HUJA 4JURI 3W2WA 3AOUA 4YT2A 3G50A 4IAQA 3B0PA 1ORYA 2XXAA 3I4UA 3RVYA 4XLPF 1YA7O 1WWPA 1NBBA 5E3AA 3L0IA 2LK4A 1LIHA 5KYUB 1K04A 1O3UA 2MWQA 4YT8A 4AL1A 2GA0A 2AWCA 2M64A 1TKNA 3UMKA 4EHPA 2EPOA 5KYXB 1LI7A 1E83A 4E0IA 3SXKA 4U5EE 5A6AA 1NFOA 2G3KA 2VH3A 2NSGA 2GFHA 1ZW3A 4JJGA 3OA1A 2OOCA 3GEIA 1BBHA 5JVEA 4LACB 3W8IA 4YL3A 1IW7F 2NUTB 2KW3C 3MBGA 2DYRC 2VCAA 2QLAA 4U9EA 5EK0A 2OEXA 4QI0A 3W4YA 4A4AA 2EIJC 4G7OF 1EA8A 2EPNA 1VK5A 1VMAA 3ZTMA 3AGTA 1WATA 4J7YA 2IM8A 4L6RA 3T9OA 3LJBA 3GEEA 5DS4A 1ZHWA 1SF8A 3L34A 2R7VA 2EIMC 1HE9A 2TMVP 4XPYA 4GYTA 5CI9A 1I4ZA 3TOLA 2IOQA 2XL6A 3LLIA 5BQIA 4P9TA 1LPEA 3S84A 2DGJA 4MVZA 3EJNA 1OXBA 4X0RA 4U5GA 4RBNA 1HMOA 3T6JA 5B3IA 1GQAA 2GDCA 4JZAA 2J9VA 2YLGA 3HNJA 1B68A 3EZIA 3H2VA 1PCXA 4OIQF 4DXWA 3R7CA 3PMRA 4ULVA 2IXOA 3NYJA 3S29A 2AWYA 4R32A 1RXQA 2HJMA 3QVYA 4O6NA 1ZHZA 2HKVA 5DQTA 2V3CC 1HMDA 3MX3A 2IXPA 3EFOB 3M4CA 2LIGA 4CS8A 4C3BA 1LE2A 1YLMA 1TFKB 2HMZA 2Q7RA 1AVOB 4OD5A 3TQOA 3CQZA 2YVKA 3EH2A 3AG1C 2Q9AA 1TWAA 2KK1A 3AG2C 4BJ5C 4DJ9A 1M2VA 2LFFA 3UGPA 4CX9A 3PCVA 4B6IA 5E3CA 4DBQA 1OCZC 4ER9A 3FVYA 2YKZA 5L0FA 2QY9A 3K6BA 4OIRF 2Y3HA 3DZAA 3LUTB 4U5HA 5DVWA 2A0UA 5AC4A 1C02A 2MHRA 4EBBA 4DBRA 1XZQA 3TJ5A 2YLDA 2ZPAA 4U5CE 2A68F 1ZHTA 4CS9C 1VLSA 1NSGB 2RD9A 4GEHA 4RD9A 2I8BA 1YARO 3MLGA 1CPQA 1Y6DA 3HNLA 3NRHA 2MYSA 3TK0A 3ASOC 256BA 3TOMA 4E7ZA 2H7BA 3FXHA 2P0NA 5B1AC 2Y39A 3NKEA 1BR2A 2R25A 3KH2A 1Y4CA 4U5FE 1Q0GA 3DE9A 1OKKA 1HW2A 3SXZA 1YYJA 3B29A 3IPMO 3LS0A 3C62A 1Q0MA 1L3PA 3M4BA 5L3VA 2Y3BA 3ZDLA 4E18A 1YZAA 3C18A 3NMKA 4FESA 4U5BE 5COFA 2PX3A 3DJUB 1YVIA 4LLCA 5JSLA 3WHNA 4QDLA 2IBFA 4MVQA 1OW6A 2HV6A 1S05A 2IYLD 2NSFA 2PNOA 2W4BA 4BJ6A 4E17A 1HW1A 4XEVA 4YT4A 2V26A 2Q9BA 1FMWA 1OCOC 2YLIA 4UDVA 5JT4A 4BJ1A 1MQVA 5KYWB 1K05A 2WVNA 3GM2A 5A6BD 1LVKA 3KKBA 4ONSA 1E86A 4P6IC 4MQ9F 4CJOA 1PV3A 1WTYA 5CIVA 3ABLC 5B1BC 4KBLA 1NZEA 1C17M 1VYKA 4I44A 4CIHA 4JCZA 1FFHA 3K33A 2FGYA 1QVXA 4PJNA 2ICWG 5L0DA 4I3MA 3X2QC 4N06A 1TWCA 4NCQA 3X1OA 3HTKC 4F4BA 5KYNA 2P1AA 5A69A 1VOMA 4BJTA 5HSWA 5KYYA 3L8IA 1OCCC 2UUHA 3BEHA 1A7EA 2W4MA 2YZSA 3DAFA 4NC3A 4Z9JA 2A1DD 4YL1A 3IQTA 5A6JA 5JLIA 2ZD9A 4G7HF 2WB7A 2XLOA 3UMHA 3K1IC 3M1CB 2J9WA 3JT1A 2IXMA 5A6BA 4JJFA 2LD6A 5DQZA 1TWHA 3LNRA 1OR3A 2CNWD 4O6MA 1ORSC 1JMWA 2OG2A 2XSEA 2QE9A 3EQLF 3O55A 4PJMA 3ZIBA 4ZLCA 3ZQVA 4I1OB 3POVA 3C8ZA 1T6UA 3GWLA 4CDAA 4MTGA 3JRTA 4CIPA 1Q0KA 3ABMC 4HEAJ 5COGA 5K0IA 2XRHA 3TULA 4MVUA 2YL3A 1ZVZA 1OW7A 1K40A 3NG1A 2ZXOA 2XLHA 2LFDA 3RIPA 1Z3IX 3DM9B 1LM3B 1MMDA 2J7PD 2LP4A 4D4NA 1RCPA 1C03A 2XLVA 3AJMA 3L1MA 3IEEA 4MVOA 1WGWA 3O10A 4XLNF 4LERA 4CS9A 3DWWA 2CCYA 4MVRA 4OIOF 3RF3A 4KNWA 3VF0A 2KSFA 1ZHYA 5JP7A 5L0JA 2CW0F 3HNKA 3HLZA 2E87A 3W2VA 2X51A 3C8GB 3ITFA 4AX2A 2W45A 2J8WA 3AG3C 2LSEA 3SXYA 1J8YF 2NUPA 1FR0A 3CEXA 1CPRA 3CZ6A 5COMA 3VRCA 1LS4A 2L6HA 4NTFA 1QQ3A 2JX0A 4BPMA 3S28A 2CGEA 4MVSA 3ZSUA 1VYIA 2RSEB 2ASRA 2VCBA 2HS5A 1QPUA 2J9UA 3FOPA 5E2QA 4JEAA 5BQGA 3SP1A 4E0HA 4DRJB 4EBJA 5EGYA 3UGOA 1OCRC 2NG1A 2PBEA 4YN0B 1MMAA 2OQMA 1AEPA 1RKCA 3HNIA 3O39A 4J30B 3K7DA 4LDRA 5AGFA 4HE8D 5TJ5E 3U9MA 4DVYP 1G8XA 1LKXA 3ABKC 3LNMB 4JVSA 4XEFA 3V5YA 1YDIA 3KMIA 3GM3A 1KU2A 2R9RB 3WG7C 3PDMP 1G5ZA 3W8HA 4K7BA 4I1MA 5E33A 1D1CA 3C8GD 2XLEA 3ZG1A 4Z9IA 2PFDA 2O9XA 4XPXA 1EQ1A 3ASNC 4LDKA 3GANA 2R7RA 3Q6NA 2Q00A 2OU6A 2Y3DA 4ZLDA 3RH3A 3RW0A 2W9YA 1MMGA 4EWCA 3EG9B 3IQ6A 2BE5F 2HSBA 4J32B 3GEHA 2WZLA 3Q7GA 4YWQA 2HFIA 5JUAA 1VLTA 1OW8A 1M56C 1ORJA 1PD1A 2WVQA 3ZC4A 3US6A 5A6KA 1KTMA 1A0BA 3QZCA 1LS1A 3JYHA 4EIYA 1LE4A 1TFOB 2JD3A 2X0CA 2R7WA 3LEOA 1Q0DA 2J0WA 5F5FA 3JSEO 2J9BA 1M6TA 1CGOA 1T9KA 1SR2A 3FMSA 2M4EA 3ATPA 1TWGA 5KYUA 4CS7A 5DS6A 1ST6A 2YWAA 3N2ZB 2Q9CA 2B0HA 1V4AA 5KYXA 4JC7A 3KPHA 3K1IA 2VC9A 3O6XA 4CDVA 1YZCA 2YQYA 1BR4A 3FAPB 4U5DE 5L0HA 1G4WR 1N1CA 2CDQA 3MYFA 2R02A 3JRMO 1F1MA 1KNYA 3EHNA 3N0TA 3J06A 2KJGA 3AGUA 4HFKB 3U5SA 4CSAC 4C7OA 1Z23A 4DOZA 1TR2A 4IRUA 2PP4A 3FOOA 3ZTZA 4C7OB 1Z5ZA 2Z15A 3KL4A 2KYHA 2OEVA 3WAQA 2NPUA 3HJCA 5BQHA 1NU7D 1XWJA 3DXJF 4PJLA 1G4US 2ZXWC 3U8PA 4BEJA 3L8JA 4C3DA 3DKAA 3U2MA 3B9QA 3VYWA 2EILC 1O87A 2L6GA 2XLDA 4AE4A 2R7OA 1BDJB 1RKEA 1YJGA 2H8AA 3T6GB 1J8MF 5T1DB 1W2WA 3CAXA 2A6HF 3F46A 3FHDA 2BC5A 2D4UA
chains in the Genus database with same CATH topology
1HMDA 4XPYA 4XPWA 1I4YA 4XQ1A 2AWCA 1I4ZA 2MHRA 3WHNA 1HMOA 3AGUA 3WAQA 1A7EA 1A7DA 2AWYA 2HMQA 2AVKA 4XPXA 3AGTA 2HMZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HMD A;  4XPY A;  4XPW A;  1I4Y A;  4XQ1 A;  2AWC A;  1I4Z A;  2MHR A;  3WHN A;  1HMO A;  3AGU A;  3WAQ A;  1A7E A;  1A7D A;  2AWY A;  2HMQ A;  2AVK A;  4XPX A;  3AGT A;  2HMZ A; 
#chains in the Genus database with same CATH topology
 1R4T A;  1IZM A;  4EUK B;  3SZR A;  3S27 A;  2WVO A;  5B3S C;  2LCH A;  4ULW A;  3B0V C;  5HV9 A;  4KI2 A;  1T6Q A;  3RKO F;  4WJ0 A;  2A6E F;  5CI8 A;  3EH1 A;  4IAO A;  3RQG A;  1V55 C;  1BZ4 A;  1NG1 A;  2G3V A;  3DD7 A;  4GQH A;  4PK4 A;  3NMJ A;  1D0X A;  4E7S A;  2F22 A;  3ZQY A;  2ETS A;  1Z63 A;  3NDB B;  4JTC B;  1A7D A;  3NYL A;  4YL0 A;  5JS5 A;  1T6I A;  4N6C A;  3MYI A;  4IAR A;  4J7T A;  4WAB A;  4ANJ A;  3DE8 A;  1R5I D;  1FAP B;  2XXA B;  5T3T A;  3N24 A;  4Q5S F;  1H7I A;  2C04 A;  2EIN C;  2R7Q A;  3G4X A;  5L3Q A;  4OIP F;  2OJQ A;  2XLW A;  3M79 A;  4Q4Z F;  3SXM A;  2XS1 A;  1APC A;  3OWT A;  4XQ1 A;  4CJG A;  3FAJ A;  4HFF B;  1ZU5 A;  1M2V B;  1D1A A;  1LI5 A;  2Q4F A;  3G4Z A;  3U3F A;  3EGX A;  3LS1 A;  2CYD A;  2Q3T A;  3EGX B;  3KYI A;  1WAS A;  2DB4 A;  3T4R A;  3V5Z A;  2NUT A;  2EPK X;  3QVZ A;  2C03 A;  4XWJ A;  4YJW A;  3HKK A;  1SMY F;  1D1B A;  2ZXP A;  4D4X A;  5IY5 C;  4H4K C;  3QTH A;  5F5H A;  2R03 A;  2BL2 A;  4KNV A;  4U9D A;  3E9V A;  4NQF A;  5JRA A;  3NMI A;  2VAS A;  4XPW A;  4BJ5 A;  1FNT c;  2GAQ A;  2AP3 A;  1U0B B;  2XLM A;  1Z6A A;  3JSZ A;  5F28 E;  3EGD A;  3RQE A;  3V7O A;  3EGD B;  1FMV A;  1Q0F A;  2HSQ A;  2WL8 A;  3DJN B;  4RDA A;  2YL1 A;  1NFN A;  1NU9 C;  1RKE B;  2R05 A;  3GOR A;  3TD7 A;  3BRJ A;  1H9G A;  2EIK C;  1RJ9 B;  1SZI A;  1TQG A;  1ZW2 A;  2A0B A;  3H2U A;  3JTL O;  4JEB A;  5T3W A;  3RVZ A;  1H9T A;  2L7A A;  2PX0 A;  5FZT A;  4EBK A;  4EKW A;  4YT5 A;  1GS9 A;  2JPU A;  4IB4 A;  4KC9 A;  1D0Z A;  2FFH A;  1HE1 A;  1MMN A;  3CSK A;  4K0D A;  4XEK A;  1VB5 A;  2R7U A;  2HJ3 A;  1JPJ A;  1JPN A;  1V74 B;  3IHU A;  4FX5 A;  1E85 A;  2ZXR A;  3AQC A;  4MW3 A;  1U89 A;  3DMD A;  2P61 A;  4PFP A;  2Y69 C;  1WN0 A;  3S0X A;  4LLE A;  5L0C A;  1QSP A;  2XL8 A;  1I4Y A;  2FAP B;  4JTA B;  4XTK A;  3QW1 A;  3U2L A;  3F47 A;  1MNE A;  1E2X A;  2XL4 A;  2HZ8 A;  4G7Z F;  3S9O A;  4JE9 A;  3SEO A;  2R7S A;  1A7V A;  1MND A;  3C8G A;  3UNG C;  1DOW A;  3K1H A;  2YRF A;  3K66 A;  5BUO A;  2WZG A;  1VTM P;  1AUE A;  1I5N A;  4DRI B;  2AU5 A;  4N4W A;  1YAU O;  5DS5 A;  2KC3 A;  2G62 A;  4N6H A;  3GM1 A;  3ECS A;  4AK9 A;  2A69 F;  3T6B A;  2L81 A;  3DM5 A;  1QLE C;  1HY5 A;  4JW1 A;  3RQF A;  2KNH A;  4MND A;  3ZVR A;  2D5R B;  2CNW A;  4CSA A;  2R7T A;  2LQG A;  2QUP A;  4PFO A;  1U6H A;  3WOD F;  4PJJ A;  3E70 C;  4K1O A;  1DOV A;  4MVM A;  2HV7 A;  1UG7 A;  3IQ5 A;  4JCH A;  4PR9 A;  1JR8 A;  4WGZ A;  5DLJ A;  4W8P A;  2QNL A;  3SNH A;  1ZZP A;  1JAF A;  4NTB A;  5L0G A;  4O6Y A;  2J7P A;  4C3E A;  1E84 A;  2B0J A;  3JYY A;  2YEV A;  2P7V A;  2YL0 A;  1EI7 A;  3AQB A;  4WGY A;  4O7G A;  4LDQ A;  3KYJ A;  3LES A;  2I15 A;  4P9F A;  2J0X A;  3GWN A;  1T01 A;  5L0I A;  3I5P A;  5GPG B;  4MS2 A;  1EKY A;  2H7V C;  2EPM X;  1D0Y A;  2Y3G A;  2OKU A;  4NY3 A;  1M2O A;  3DAG A;  5AC5 A;  3OEO A;  3JZ0 A;  2OJE D;  3UR3 C;  1OR2 A;  3Q6M A;  4G78 A;  1OQC A;  2EPL X;  3H65 A;  4IJJ A;  1NLX A;  3U3B A;  4JTD B;  4Z9H A;  4CS8 C;  1M57 C;  4YK5 A;  5D92 A;  4A2N B;  1A41 A;  2GWW A;  1CGM E;  1O5H A;  2HMQ A;  3U8V A;  1V54 C;  2IXN A;  2XM0 A;  4W8K A;  3B0U X;  4Q7C A;  3LEV A;  1OXK A;  5KYW A;  1L7C A;  3QMK A;  4PAC A;  1GGQ A;  3NKD A;  4FWV A;  3EZH A;  3QW0 A;  4AE4 B;  5FCL A;  3C63 A;  1ZHX A;  4OIN F;  3AG4 C;  4CDY A;  2NUP B;  5EHH A;  2WZF A;  1YYX A;  4BG0 A;  1RJ9 A;  1SYQ A;  1UFB A;  3S90 A;  1OKK D;  4NTA A;  4MTO A;  3VAY A;  2KQ9 A;  3LLK A;  3U0C A;  4QI2 A;  1FTS A;  3U9J A;  3SYN A;  3ZWI A;  2L6F A;  2DI3 A;  3GOD A;  2VB6 A;  1WOL A;  2VCC A;  3PHF 2;  4DRH B;  3RYL A;  3UMI A;  2OCC C;  4OD4 A;  2DYS C;  3M15 A;  4O79 A;  3EFO A;  1FFT C;  3JCU Q;  1JRA A;  3R2P A;  4G0H A;  3IQC A;  3A11 A;  2J45 A;  5D91 A;  4FAP B;  4CBE A;  4MTF A;  2J46 A;  4H54 A;  4JKV A;  2PF4 E;  3B71 A;  2XS8 A;  3NYM A;  1PD0 A;  3V5X A;  1XZP A;  4MW8 A;  3RFY A;  3FDQ A;  3DI5 A;  2H7O A;  3EHM A;  1BR1 A;  2AVK A;  1ZU4 A;  4DVZ A;  1RMV A;  2YL7 A;  2QTV A;  3A9C A;  1CGN A;  3Q7L A;  4BJ6 C;  1T5O A;  3EPV A;  1QKR A;  3LAY A;  4AL0 A;  2KGO A;  1H6G A;  1S7Z A;  2L9J A;  2UUI A;  3TJ6 A;  3EG9 A;  1GM5 A;  2YHS A;  2R7X A;  1QZX A;  4M63 A;  4BEM J;  3I5Q A;  1JOG A;  4IWB A;  4JIO A;  3VM6 A;  3C7J A;  2P6V A;  1YA9 A;  5KYY B;  1ZYR F;  3MFN A;  4JRZ A;  1Z7Q c;  4IGG A;  2XM4 A;  2HUJ A;  4JUR I;  3W2W A;  3AOU A;  4YT2 A;  3G50 A;  4IAQ A;  3B0P A;  1ORY A;  2XXA A;  3I4U A;  3RVY A;  4XLP F;  1YA7 O;  1WWP A;  1NBB A;  5E3A A;  3L0I A;  2LK4 A;  1LIH A;  5KYU B;  1K04 A;  1O3U A;  2MWQ A;  4YT8 A;  4AL1 A;  2GA0 A;  2AWC A;  2M64 A;  1TKN A;  3UMK A;  4EHP A;  2EPO A;  5KYX B;  1LI7 A;  1E83 A;  4E0I A;  3SXK A;  4U5E E;  5A6A A;  1NFO A;  2G3K A;  2VH3 A;  2NSG A;  2GFH A;  1ZW3 A;  4JJG A;  3OA1 A;  2OOC A;  3GEI A;  1BBH A;  5JVE A;  4LAC B;  3W8I A;  4YL3 A;  1IW7 F;  2NUT B;  2KW3 C;  3MBG A;  2DYR C;  2VCA A;  2QLA A;  4U9E A;  5EK0 A;  2OEX A;  4QI0 A;  3W4Y A;  4A4A A;  2EIJ C;  4G7O F;  1EA8 A;  2EPN A;  1VK5 A;  1VMA A;  3ZTM A;  3AGT A;  1WAT A;  4J7Y A;  2IM8 A;  4L6R A;  3T9O A;  3LJB A;  3GEE A;  5DS4 A;  1ZHW A;  1SF8 A;  3L34 A;  2R7V A;  2EIM C;  1HE9 A;  2TMV P;  4XPY A;  4GYT A;  5CI9 A;  1I4Z A;  3TOL A;  2IOQ A;  2XL6 A;  3LLI A;  5BQI A;  4P9T A;  1LPE A;  3S84 A;  2DGJ A;  4MVZ A;  3EJN A;  1OXB A;  4X0R A;  4U5G A;  4RBN A;  1HMO A;  3T6J A;  5B3I A;  1GQA A;  2GDC A;  4JZA A;  2J9V A;  2YLG A;  3HNJ A;  1B68 A;  3EZI A;  3H2V A;  1PCX A;  4OIQ F;  4DXW A;  3R7C A;  3PMR A;  4ULV A;  2IXO A;  3NYJ A;  3S29 A;  2AWY A;  4R32 A;  1RXQ A;  2HJM A;  3QVY A;  4O6N A;  1ZHZ A;  2HKV A;  5DQT A;  2V3C C;  1HMD A;  3MX3 A;  2IXP A;  3EFO B;  3M4C A;  2LIG A;  4CS8 A;  4C3B A;  1LE2 A;  1YLM A;  1TFK B;  2HMZ A;  2Q7R A;  1AVO B;  4OD5 A;  3TQO A;  3CQZ A;  2YVK A;  3EH2 A;  3AG1 C;  2Q9A A;  1TWA A;  2KK1 A;  3AG2 C;  4BJ5 C;  4DJ9 A;  1M2V A;  2LFF A;  3UGP A;  4CX9 A;  3PCV A;  4B6I A;  5E3C A;  4DBQ A;  1OCZ C;  4ER9 A;  3FVY A;  2YKZ A;  5L0F A;  2QY9 A;  3K6B A;  4OIR F;  2Y3H A;  3DZA A;  3LUT B;  4U5H A;  5DVW A;  2A0U A;  5AC4 A;  1C02 A;  2MHR A;  4EBB A;  4DBR A;  1XZQ A;  3TJ5 A;  2YLD A;  2ZPA A;  4U5C E;  2A68 F;  1ZHT A;  4CS9 C;  1VLS A;  1NSG B;  2RD9 A;  4GEH A;  4RD9 A;  2I8B A;  1YAR O;  3MLG A;  1CPQ A;  1Y6D A;  3HNL A;  3NRH A;  2MYS A;  3TK0 A;  3ASO C;  256B A;  3TOM A;  4E7Z A;  2H7B A;  3FXH A;  2P0N A;  5B1A C;  2Y39 A;  3NKE A;  1BR2 A;  2R25 A;  3KH2 A;  1Y4C A;  4U5F E;  1Q0G A;  3DE9 A;  1OKK A;  1HW2 A;  3SXZ A;  1YYJ A;  3B29 A;  3IPM O;  3LS0 A;  3C62 A;  1Q0M A;  1L3P A;  3M4B A;  5L3V A;  2Y3B A;  3ZDL A;  4E18 A;  1YZA A;  3C18 A;  3NMK A;  4FES A;  4U5B E;  5COF A;  2PX3 A;  3DJU B;  1YVI A;  4LLC A;  5JSL A;  3WHN A;  4QDL A;  2IBF A;  4MVQ A;  1OW6 A;  2HV6 A;  1S05 A;  2IYL D;  2NSF A;  2PNO A;  2W4B A;  4BJ6 A;  4E17 A;  1HW1 A;  4XEV A;  4YT4 A;  2V26 A;  2Q9B A;  1FMW A;  1OCO C;  2YLI A;  4UDV A;  5JT4 A;  4BJ1 A;  1MQV A;  5KYW B;  1K05 A;  2WVN A;  3GM2 A;  5A6B D;  1LVK A;  3KKB A;  4ONS A;  1E86 A;  4P6I C;  4MQ9 F;  4CJO A;  1PV3 A;  1WTY A;  5CIV A;  3ABL C;  5B1B C;  4KBL A;  1NZE A;  1C17 M;  1VYK A;  4I44 A;  4CIH A;  4JCZ A;  1FFH A;  3K33 A;  2FGY A;  1QVX A;  4PJN A;  2ICW G;  5L0D A;  4I3M A;  3X2Q C;  4N06 A;  1TWC A;  4NCQ A;  3X1O A;  3HTK C;  4F4B A;  5KYN A;  2P1A A;  5A69 A;  1VOM A;  4BJT A;  5HSW A;  5KYY A;  3L8I A;  1OCC C;  2UUH A;  3BEH A;  1A7E A;  2W4M A;  2YZS A;  3DAF A;  4NC3 A;  4Z9J A;  2A1D D;  4YL1 A;  3IQT A;  5A6J A;  5JLI A;  2ZD9 A;  4G7H F;  2WB7 A;  2XLO A;  3UMH A;  3K1I C;  3M1C B;  2J9W A;  3JT1 A;  2IXM A;  5A6B A;  4JJF A;  2LD6 A;  5DQZ A;  1TWH A;  3LNR A;  1OR3 A;  2CNW D;  4O6M A;  1ORS C;  1JMW A;  2OG2 A;  2XSE A;  2QE9 A;  3EQL F;  3O55 A;  4PJM A;  3ZIB A;  4ZLC A;  3ZQV A;  4I1O B;  3POV A;  3C8Z A;  1T6U A;  3GWL A;  4CDA A;  4MTG A;  3JRT A;  4CIP A;  1Q0K A;  3ABM C;  4HEA J;  5COG A;  5K0I A;  2XRH A;  3TUL A;  4MVU A;  2YL3 A;  1ZVZ A;  1OW7 A;  1K40 A;  3NG1 A;  2ZXO A;  2XLH A;  2LFD A;  3RIP A;  1Z3I X;  3DM9 B;  1LM3 B;  1MMD A;  2J7P D;  2LP4 A;  4D4N A;  1RCP A;  1C03 A;  2XLV A;  3AJM A;  3L1M A;  3IEE A;  4MVO A;  1WGW A;  3O10 A;  4XLN F;  4LER A;  4CS9 A;  3DWW A;  2CCY A;  4MVR A;  4OIO F;  3RF3 A;  4KNW A;  3VF0 A;  2KSF A;  1ZHY A;  5JP7 A;  5L0J A;  2CW0 F;  3HNK A;  3HLZ A;  2E87 A;  3W2V A;  2X51 A;  3C8G B;  3ITF A;  4AX2 A;  2W45 A;  2J8W A;  3AG3 C;  2LSE A;  3SXY A;  1J8Y F;  2NUP A;  1FR0 A;  3CEX A;  1CPR A;  3CZ6 A;  5COM A;  3VRC A;  1LS4 A;  2L6H A;  4NTF A;  1QQ3 A;  2JX0 A;  4BPM A;  3S28 A;  2CGE A;  4MVS A;  3ZSU A;  1VYI A;  2RSE B;  2ASR A;  2VCB A;  2HS5 A;  1QPU A;  2J9U A;  3FOP A;  5E2Q A;  4JEA A;  5BQG A;  3SP1 A;  4E0H A;  4DRJ B;  4EBJ A;  5EGY A;  3UGO A;  1OCR C;  2NG1 A;  2PBE A;  4YN0 B;  1MMA A;  2OQM A;  1AEP A;  1RKC A;  3HNI A;  3O39 A;  4J30 B;  3K7D A;  4LDR A;  5AGF A;  4HE8 D;  5TJ5 E;  3U9M A;  4DVY P;  1G8X A;  1LKX A;  3ABK C;  3LNM B;  4JVS A;  4XEF A;  3V5Y A;  1YDI A;  3KMI A;  3GM3 A;  1KU2 A;  2R9R B;  3WG7 C;  3PDM P;  1G5Z A;  3W8H A;  4K7B A;  4I1M A;  5E33 A;  1D1C A;  3C8G D;  2XLE A;  3ZG1 A;  4Z9I A;  2PFD A;  2O9X A;  4XPX A;  1EQ1 A;  3ASN C;  4LDK A;  3GAN A;  2R7R A;  3Q6N A;  2Q00 A;  2OU6 A;  2Y3D A;  4ZLD A;  3RH3 A;  3RW0 A;  2W9Y A;  1MMG A;  4EWC A;  3EG9 B;  3IQ6 A;  2BE5 F;  2HSB A;  4J32 B;  3GEH A;  2WZL A;  3Q7G A;  4YWQ A;  2HFI A;  5JUA A;  1VLT A;  1OW8 A;  1M56 C;  1ORJ A;  1PD1 A;  2WVQ A;  3ZC4 A;  3US6 A;  5A6K A;  1KTM A;  1A0B A;  3QZC A;  1LS1 A;  3JYH A;  4EIY A;  1LE4 A;  1TFO B;  2JD3 A;  2X0C A;  2R7W A;  3LEO A;  1Q0D A;  2J0W A;  5F5F A;  3JSE O;  2J9B A;  1M6T A;  1CGO A;  1T9K A;  1SR2 A;  3FMS A;  2M4E A;  3ATP A;  1TWG A;  5KYU A;  4CS7 A;  5DS6 A;  1ST6 A;  2YWA A;  3N2Z B;  2Q9C A;  2B0H A;  1V4A A;  5KYX A;  4JC7 A;  3KPH A;  3K1I A;  2VC9 A;  3O6X A;  4CDV A;  1YZC A;  2YQY A;  1BR4 A;  3FAP B;  4U5D E;  5L0H A;  1G4W R;  1N1C A;  2CDQ A;  3MYF A;  2R02 A;  3JRM O;  1F1M A;  1KNY A;  3EHN A;  3N0T A;  3J06 A;  2KJG A;  3AGU A;  4HFK B;  3U5S A;  4CSA C;  4C7O A;  1Z23 A;  4DOZ A;  1TR2 A;  4IRU A;  2PP4 A;  3FOO A;  3ZTZ A;  4C7O B;  1Z5Z A;  2Z15 A;  3KL4 A;  2KYH A;  2OEV A;  3WAQ A;  2NPU A;  3HJC A;  5BQH A;  1NU7 D;  1XWJ A;  3DXJ F;  4PJL A;  1G4U S;  2ZXW C;  3U8P A;  4BEJ A;  3L8J A;  4C3D A;  3DKA A;  3U2M A;  3B9Q A;  3VYW A;  2EIL C;  1O87 A;  2L6G A;  2XLD A;  4AE4 A;  2R7O A;  1BDJ B;  1RKE A;  1YJG A;  2H8A A;  3T6G B;  1J8M F;  5T1D B;  1W2W A;  3CAX A;  2A6H F;  3F46 A;  3FHD A;  2BC5 A;  2D4U A; 
#chains in the Genus database with same CATH homology
 1HMD A;  4XPY A;  4XPW A;  1I4Y A;  4XQ1 A;  2AWC A;  1I4Z A;  2MHR A;  3WHN A;  1HMO A;  3AGU A;  3WAQ A;  1A7E A;  1A7D A;  2AWY A;  2HMQ A;  2AVK A;  4XPX A;  3AGT A;  2HMZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...