2AWKA

Gfp r96m mature chromophore
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
225
structure length
224
Chain Sequence
KGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLVQCFSRYPDHMKQHDFFKSAMPEGYVQEMTISFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYITADKQKNGIKANFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords green fluorescent protein
publication title Defining the role of arginine 96 in green fluorescent protein fluorophore biosynthesis.
pubmed doi rcsb
source organism Aequorea victoria
molecule tags Luminescent protein
total genus 59
structure length 224
sequence length 225
ec nomenclature
pdb deposition date 2005-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01353 GFP Green fluorescent protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.155.10 Mainly Beta Beta Barrel Green Fluorescent Protein Green fluorescent protein 2awkA00
1RRXA 1GL4A 5DPIA 3DQOA 3NEZA 3CD9A 2AWLA 2VVIA 1QYOA 1H4UA 4IK1A 5EJUA 4W72A 2IE2A 2EMNA 3DQ2A 4W6RA 5HBDA 3EKHA 4IK5A 4W74A 4W6NA 2A53B 5DRGA 2O24A 3SVUA 2O29A 3AKOA 5HZUA 5T3IA 3DQ7A 4H3MA 5DPJA 2VAEA 1W7SA 3EK7A 2YE1A 1GFLA 4L12A 2A56B 3I19A 3BX9A 2V4EB 4I2YA 1MOUA 5DY6A 2Z1OA 4HQ9A 3ST4A 4JRBA 3DQCA 4OHSA 1Z1QA 2A47A 3PJ5A 3RWAA 2QZ0A 3U8AA 4ZFSA 4DXOA 2YFPA 3DPXA 3SSLA 3SSHA 3DQ6A 2HGDA 3DQKA 1C4FA 4PPKA 3VHTB 4EULA 2QLGA 5BQLA 3U0NA 2HFCA 3DQAA 4ZBLA 2OGRA 3LSAA 5BT0A 3BXAA 4W6TA 3H1RA 1XSSA 1KYRA 4AS8A 2Y0GA 3ST2A 3CGLA 3WLCA 5LTRA 5DTYA 4KGFA 4KW4A 2DDDA 2A48A 1JBYA 2WSOA 2DD9A 4Q7TA 3BXBA 1EMAA 5EXCI 1YJFA 2HJOA 4W7DA 2Z6YA 4GF6B 4HE4A 1Q4DA 5DPGA 2DUFA 2V4EC 4W6CA 1OXDA 5LTQA 4OQWA 4XL5A 2IOVA 2H9WA 5DPHA 4Z4MA 5DQMA 4DXIA 2QLGB 4ORNA 4PPJA 5KTGA 3DPZA 3DQ5A 4Q9XA 1F09A 4W6GA 3SVSA 4PFEA 3IP2A 1YHIA 4W6HA 3ZULA 2GW3A 4W7FA 1OXFA 2G3OA 4LQUA 4W7AA 1W7UA 3OSRA 5HGEA 2WISA 5DQBA 4TZAA 5FHVA 2VZXA 4OY4A 3ED8A 2EMDA 3IR8A 1OXEA 2Q6PA 1KYSA 4ZIOA 3CB9A 1Z1PA 2YE0A 5J2OA 2QT2A 3DQ8A 2WHTA 4IK4A 2DDCA 2ARLA 3DQDA 3NT3A 5LTPA 4W7EA 1F0BA 4KA9A 3DQNA 4OJ0A 4W6PA 4R6BA 2VVHA 4DKNA 3E5WA 1MOVA 5H89A 1Q4AA 3LF4B 3ZUJA 3CBEA 4W7CA 3PJBA 5DTXA 1MYWA 4W77A 3SS0A 4W6AA 3SG3A 3K1KA 2PXSA 3SRYA 3EVRA 3VICA 3P28A 4JF9A 1XAEA 2DUEA 3VHTA 2DUHA 3AI4A 4W7XA 3V3DA 1W7TA 2EMOA 3CFFA 4KF5A 4UTSA 3UG0A 4LQTA 1RMOA 4W7RA 3SVEA 5LK4A 3SSKA 4H3LA 5HZTA 3VK1A 2FL1A 5HW9A 4DXQA 2QU1A 1ZGQA 3KCTA 4RYSA 1RMMA 4J88A 3W1DA 1EMBA 4LJBA 4KAGA 3EVPA 4KF4A 4Q7RA 1RMPA 1EMLA 2A54B 2AWKA 4L13A 4IK9A 3WCKA 4W69A 3CFAA 3EK4A 3P8UA 1KP5A 2QLIA 3ZTFA 2G16B 3DQ4A 3SSTA 2A50B 4LW5A 4EDSA 3GJ2A 4PPLA 3SVBA 3SVDA 1YHGA 2Z6ZA 1YJ2A 4J89A 2GX2A 4XOWA 5FVGA 4HQCA 3SV5A 4W6DA 2ZO6A 3O77A 3DQ3A 3U0LA 3A8SA 4ZF3A 1B9CA 1ZGPA 1QXTA 4JGEA 5DU0A 3DQLA 5AQBB 2C9JA 2ZMUA 3U8CA 1RM9A 1YHHA 1JBZA 3U0MA 3LS3A 2FWQA 2GW4B 1KYPA 1YZWA 2HRSA 5DTLA 2VVJA 3SVRA 2PXWA 3SG7A 2B3QA 1Q4EA 3LVAA 3SVOA 3DQFA 3EVVA 3KCSA 2ZMWA 2G6YA 4BDUA 2P4MA 4W6OA 4GESB 5EB6A 4J8AA 3NF0A 3OGOA 4U2VA 4KF5C 2B3PA 4W6MA 3LA1A 4W6FA 5HZSA 1ZUXA 3ADFA 3E5VA 4H47A 1HUYA 1EMFA 4KW8A 2ICRA 3U0KA 5EHUA 4GOBA 4IK8A 1Q4CA 2AH8A 4W6LA 5DRFA 2WHUA 4B5YA 2HQZA 4HQ8A 4ZB1A 2QLEA 2AHAA 1XA9A 2DUIA 4RTCA 3DQJA 4H3NA 3DPWA 4W6SA 5EXBA 5DTZA 3SG5A 4EDOA 1ZGOA 3SG2A 3LVDA 2DD7A 4W6IA 1EMMA 4B30A 2AWJA 4JEOA 4RYWA 3WLDA 3SSPA 4LJDA 2HGYA 3DQUA 4R6DA 4W6KA 3TMTA 2HPWA 1EMKA 3DQEA 2H6VA 3LVCA 3PJ7A 2A52B 4TZGA 3CFHA 1XMZA 3SG6A 4EN1A 3MGFA 4LJCA 4ZINA 2G5ZB 3ST0A 3AI5A 3NT9A 3GL4A 4NWSA 2G6EA 4ZF5A 2OTBA 1YFPA 1QY3A 1XQMA 1JC1A 3GJ1A 3GB3A 4P1QA 3DQIA 2G6XA 2JADA 3DQ9A 4JFGA 4XGYA 1EMEA 4B30B 5BTTA 3BXCA 2OKWA 4KW9A 2IB5A 2WSNA 4IK3A 4KPIA 4HVFA 3RWTA 2WIQA 4ANJA 1UISA 3GEXA 2WURA 1G7KA 3U8PA 3NEDA 4W73A 2HQKA 4H48A 2WHSA 2O2BA 2BTJA 1HCJA 1EMGA 1S6ZA 4W6BA 2ZO7A 1BFPA 4N3DA 5FVIA 2POXA 2QRFA 2G2SB 2DUGA 1QYFA 4ZF4A 3E5TA 5F9GA 2A46A 1GGXA 4Q7UA 3PIBA 5EXUA 4EMQA 3SVCA 2OTEA 3O78A 1JC0A 2FZUA 5BTTB 3M24A 2RH7A 4IZNA 3SVNA 3DQ1A 1Q4BA 2IB6A 4DXPA 4P76A 4Z4KA 2Z6XA 3SSVA 2Q57A 4W75A 3S05A 4L1IA 3ST3A 4XOVA 4LJDC 5HZOA 4AR7A 4W6UA 5H88A 5FVFA 4W6JA 3CD1A 2H5RA 1CV7A 3W1CA 4DKMA 4Q9WA 3EVUA 4OGSA 4KGEA 5EB7A 2HCGA 3UFZA 2G3DB 4W76A 2AWMA 2OJKA 5EBJA 2QLHA 2VADA 2H8QA 5H87A 3LF3A 2YDZA 2H5OA 4XVPA 1QYQA 3M22A 1Q73A 2C9IA 3TMRA 1EMCA 4KEXA 3H1OA 4DXNA 3EKJA 3DQHA 2OKYA 3DQMA 2H5PA 1H6RA 2V4EA 3EK8A 3SG4A 3G9AA 3SSYA 2GX0A 3ZUFA 4JC2A 3OSQA 4DXMA 2H5QA
chains in the Genus database with same CATH superfamily
1RRXA 1GL4A 5DPIA 3DQOA 3NEZA 3CD9A 2AWLA 2VVIA 1QYOA 1H4UA 4IK1A 5EJUA 4W72A 2IE2A 2EMNA 3DQ2A 4W6RA 5HBDA 3EKHA 4IK5A 4W74A 4W6NA 2A53B 5DRGA 2O24A 3SVUA 2O29A 3AKOA 5HZUA 5T3IA 3DQ7A 4H3MA 5DPJA 2VAEA 1W7SA 3EK7A 2YE1A 1GFLA 4L12A 2A56B 3I19A 3BX9A 2V4EB 4I2YA 1MOUA 5DY6A 2Z1OA 4HQ9A 3ST4A 4JRBA 3DQCA 4OHSA 1Z1QA 2A47A 3PJ5A 3RWAA 2QZ0A 3U8AA 4ZFSA 4DXOA 2YFPA 3DPXA 3SSLA 3SSHA 3DQ6A 2HGDA 3DQKA 1C4FA 4PPKA 3VHTB 4EULA 2QLGA 5BQLA 3U0NA 2HFCA 3DQAA 4ZBLA 2OGRA 3LSAA 5BT0A 3BXAA 4W6TA 3H1RA 1XSSA 1KYRA 4AS8A 2Y0GA 3ST2A 3CGLA 3WLCA 5LTRA 5DTYA 4KGFA 4KW4A 2DDDA 2A48A 1JBYA 2WSOA 2DD9A 4Q7TA 3BXBA 1EMAA 5EXCI 1YJFA 2HJOA 4W7DA 2Z6YA 4GF6B 4HE4A 1Q4DA 5DPGA 2DUFA 2V4EC 4W6CA 1OXDA 5LTQA 4OQWA 4XL5A 2IOVA 2H9WA 5DPHA 4Z4MA 5DQMA 4DXIA 2QLGB 4ORNA 4PPJA 5KTGA 3DPZA 3DQ5A 4Q9XA 1F09A 4W6GA 3SVSA 4PFEA 3IP2A 1YHIA 4W6HA 3ZULA 2GW3A 4W7FA 1OXFA 2G3OA 4LQUA 4W7AA 1W7UA 3OSRA 5HGEA 2WISA 5DQBA 4TZAA 5FHVA 2VZXA 4OY4A 3ED8A 2EMDA 3IR8A 1OXEA 2Q6PA 1KYSA 4ZIOA 3CB9A 1Z1PA 2YE0A 5J2OA 2QT2A 3DQ8A 2WHTA 4IK4A 2DDCA 2ARLA 3DQDA 3NT3A 5LTPA 4W7EA 1F0BA 4KA9A 3DQNA 4OJ0A 4W6PA 4R6BA 2VVHA 4DKNA 3E5WA 1MOVA 5H89A 1Q4AA 3LF4B 3ZUJA 3CBEA 4W7CA 3PJBA 5DTXA 1MYWA 4W77A 3SS0A 4W6AA 3SG3A 3K1KA 2PXSA 3SRYA 3EVRA 3VICA 3P28A 4JF9A 1XAEA 2DUEA 3VHTA 2DUHA 3AI4A 4W7XA 3V3DA 1W7TA 2EMOA 3CFFA 4KF5A 4UTSA 3UG0A 4LQTA 1RMOA 4W7RA 3SVEA 5LK4A 3SSKA 4H3LA 5HZTA 3VK1A 2FL1A 5HW9A 4DXQA 2QU1A 1ZGQA 3KCTA 4RYSA 1RMMA 4J88A 3W1DA 1EMBA 4LJBA 4KAGA 3EVPA 4KF4A 4Q7RA 1RMPA 1EMLA 2A54B 2AWKA 4L13A 4IK9A 3WCKA 4W69A 3CFAA 3EK4A 3P8UA 1KP5A 2QLIA 3ZTFA 2G16B 3DQ4A 3SSTA 2A50B 4LW5A 4EDSA 3GJ2A 4PPLA 3SVBA 3SVDA 1YHGA 2Z6ZA 1YJ2A 4J89A 2GX2A 4XOWA 5FVGA 4HQCA 3SV5A 4W6DA 2ZO6A 3O77A 3DQ3A 3U0LA 3A8SA 4ZF3A 1B9CA 1ZGPA 1QXTA 4JGEA 5DU0A 3DQLA 5AQBB 2C9JA 2ZMUA 3U8CA 1RM9A 1YHHA 1JBZA 3U0MA 3LS3A 2FWQA 2GW4B 1KYPA 1YZWA 2HRSA 5DTLA 2VVJA 3SVRA 2PXWA 3SG7A 2B3QA 1Q4EA 3LVAA 3SVOA 3DQFA 3EVVA 3KCSA 2ZMWA 2G6YA 4BDUA 2P4MA 4W6OA 4GESB 5EB6A 4J8AA 3NF0A 3OGOA 4U2VA 4KF5C 2B3PA 4W6MA 3LA1A 4W6FA 5HZSA 1ZUXA 3ADFA 3E5VA 4H47A 1HUYA 1EMFA 4KW8A 2ICRA 3U0KA 5EHUA 4GOBA 4IK8A 1Q4CA 2AH8A 4W6LA 5DRFA 2WHUA 4B5YA 2HQZA 4HQ8A 4ZB1A 2QLEA 2AHAA 1XA9A 2DUIA 4RTCA 3DQJA 4H3NA 3DPWA 4W6SA 5EXBA 5DTZA 3SG5A 4EDOA 1ZGOA 3SG2A 3LVDA 2DD7A 4W6IA 1EMMA 4B30A 2AWJA 4JEOA 4RYWA 3WLDA 3SSPA 4LJDA 2HGYA 3DQUA 4R6DA 4W6KA 3TMTA 2HPWA 1EMKA 3DQEA 2H6VA 3LVCA 3PJ7A 2A52B 4TZGA 3CFHA 1XMZA 3SG6A 4EN1A 3MGFA 4LJCA 4ZINA 2G5ZB 3ST0A 3AI5A 3NT9A 3GL4A 4NWSA 2G6EA 4ZF5A 2OTBA 1YFPA 1QY3A 1XQMA 1JC1A 3GJ1A 3GB3A 4P1QA 3DQIA 2G6XA 2JADA 3DQ9A 4JFGA 4XGYA 1EMEA 4B30B 5BTTA 3BXCA 2OKWA 4KW9A 2IB5A 2WSNA 4IK3A 4KPIA 4HVFA 3RWTA 2WIQA 4ANJA 1UISA 3GEXA 2WURA 1G7KA 3U8PA 3NEDA 4W73A 2HQKA 4H48A 2WHSA 2O2BA 2BTJA 1HCJA 1EMGA 1S6ZA 4W6BA 2ZO7A 1BFPA 4N3DA 5FVIA 2POXA 2QRFA 2G2SB 2DUGA 1QYFA 4ZF4A 3E5TA 5F9GA 2A46A 1GGXA 4Q7UA 3PIBA 5EXUA 4EMQA 3SVCA 2OTEA 3O78A 1JC0A 2FZUA 5BTTB 3M24A 2RH7A 4IZNA 3SVNA 3DQ1A 1Q4BA 2IB6A 4DXPA 4P76A 4Z4KA 2Z6XA 3SSVA 2Q57A 4W75A 3S05A 4L1IA 3ST3A 4XOVA 4LJDC 5HZOA 4AR7A 4W6UA 5H88A 5FVFA 4W6JA 3CD1A 2H5RA 1CV7A 3W1CA 4DKMA 4Q9WA 3EVUA 4OGSA 4KGEA 5EB7A 2HCGA 3UFZA 2G3DB 4W76A 2AWMA 2OJKA 5EBJA 2QLHA 2VADA 2H8QA 5H87A 3LF3A 2YDZA 2H5OA 4XVPA 1QYQA 3M22A 1Q73A 2C9IA 3TMRA 1EMCA 4KEXA 3H1OA 4DXNA 3EKJA 3DQHA 2OKYA 3DQMA 2H5PA 1H6RA 2V4EA 3EK8A 3SG4A 3G9AA 3SSYA 2GX0A 3ZUFA 4JC2A 3OSQA 4DXMA 2H5QA
chains in the Genus database with same CATH topology
1RRXA 1GL4A 5DPIA 3DQOA 3NEZA 3CD9A 2AWLA 2VVIA 1QYOA 1H4UA 4IK1A 5EJUA 4W72A 2IE2A 2EMNA 3DQ2A 4W6RA 5HBDA 3EKHA 4IK5A 4W74A 4W6NA 2A53B 5DRGA 2O24A 3SVUA 2O29A 3AKOA 5HZUA 5T3IA 3DQ7A 4H3MA 5DPJA 2VAEA 1W7SA 3EK7A 2YE1A 1GFLA 4L12A 2A56B 3I19A 3BX9A 2V4EB 4I2YA 1MOUA 5DY6A 2Z1OA 4HQ9A 3ST4A 4JRBA 3DQCA 4OHSA 1Z1QA 2A47A 3PJ5A 3RWAA 2QZ0A 3U8AA 4ZFSA 4DXOA 2YFPA 3DPXA 3SSLA 3SSHA 3DQ6A 2HGDA 3DQKA 1C4FA 4PPKA 3VHTB 4EULA 2QLGA 5BQLA 3U0NA 2HFCA 3DQAA 4ZBLA 2OGRA 3LSAA 5BT0A 3BXAA 4W6TA 3H1RA 1XSSA 1KYRA 4AS8A 2Y0GA 3ST2A 3CGLA 3WLCA 5LTRA 5DTYA 4KGFA 4KW4A 2DDDA 2A48A 1JBYA 2WSOA 2DD9A 4Q7TA 3BXBA 1EMAA 5EXCI 1YJFA 2HJOA 4W7DA 2Z6YA 4GF6B 4HE4A 1Q4DA 5DPGA 2DUFA 2V4EC 4W6CA 1OXDA 5LTQA 4OQWA 4XL5A 2IOVA 2H9WA 5DPHA 4Z4MA 5DQMA 4DXIA 2QLGB 4ORNA 4PPJA 5KTGA 3DPZA 3DQ5A 4Q9XA 1F09A 4W6GA 3SVSA 4PFEA 3IP2A 1YHIA 4W6HA 3ZULA 2GW3A 4W7FA 1OXFA 2G3OA 4LQUA 4W7AA 1W7UA 3OSRA 5HGEA 2WISA 5DQBA 4TZAA 5FHVA 2VZXA 4OY4A 3ED8A 2EMDA 3IR8A 1OXEA 2Q6PA 1KYSA 4ZIOA 3CB9A 1Z1PA 2YE0A 5J2OA 2QT2A 3DQ8A 2WHTA 4IK4A 2DDCA 2ARLA 3DQDA 3NT3A 5LTPA 4W7EA 1F0BA 4KA9A 3DQNA 4OJ0A 4W6PA 4R6BA 2VVHA 4DKNA 3E5WA 1MOVA 5H89A 1Q4AA 3LF4B 3ZUJA 3CBEA 4W7CA 3PJBA 5DTXA 1MYWA 4W77A 3SS0A 4W6AA 3SG3A 3K1KA 2PXSA 3SRYA 3EVRA 3VICA 3P28A 4JF9A 1XAEA 2DUEA 3VHTA 2DUHA 3AI4A 4W7XA 3V3DA 1W7TA 2EMOA 3CFFA 4KF5A 4UTSA 3UG0A 4LQTA 1RMOA 4W7RA 3SVEA 5LK4A 3SSKA 4H3LA 5HZTA 3VK1A 2FL1A 5HW9A 4DXQA 2QU1A 1ZGQA 3KCTA 4RYSA 1RMMA 4J88A 3W1DA 1EMBA 4LJBA 4KAGA 3EVPA 4KF4A 4Q7RA 1RMPA 1EMLA 2A54B 2AWKA 4L13A 4IK9A 3WCKA 4W69A 3CFAA 3EK4A 3P8UA 1KP5A 2QLIA 3ZTFA 2G16B 3DQ4A 3SSTA 2A50B 4LW5A 4EDSA 3GJ2A 4PPLA 3SVBA 3SVDA 1YHGA 2Z6ZA 1YJ2A 4J89A 2GX2A 4XOWA 5FVGA 4HQCA 3SV5A 4W6DA 2ZO6A 3O77A 3DQ3A 3U0LA 3A8SA 4ZF3A 1B9CA 1ZGPA 1QXTA 4JGEA 5DU0A 3DQLA 5AQBB 2C9JA 2ZMUA 3U8CA 1RM9A 1YHHA 1JBZA 3U0MA 3LS3A 2FWQA 2GW4B 1KYPA 1YZWA 2HRSA 5DTLA 2VVJA 3SVRA 2PXWA 3SG7A 2B3QA 1Q4EA 3LVAA 3SVOA 3DQFA 3EVVA 3KCSA 2ZMWA 2G6YA 4BDUA 2P4MA 4W6OA 4GESB 5EB6A 4J8AA 3NF0A 3OGOA 4U2VA 4KF5C 2B3PA 4W6MA 3LA1A 4W6FA 5HZSA 1ZUXA 3ADFA 3E5VA 4H47A 1HUYA 1EMFA 4KW8A 2ICRA 3U0KA 5EHUA 4GOBA 4IK8A 1Q4CA 2AH8A 4W6LA 5DRFA 2WHUA 4B5YA 2HQZA 4HQ8A 4ZB1A 2QLEA 2AHAA 1XA9A 2DUIA 4RTCA 3DQJA 4H3NA 3DPWA 4W6SA 5EXBA 5DTZA 3SG5A 4EDOA 1ZGOA 3SG2A 3LVDA 2DD7A 4W6IA 1EMMA 4B30A 2AWJA 4JEOA 4RYWA 3WLDA 3SSPA 4LJDA 2HGYA 3DQUA 4R6DA 4W6KA 3TMTA 2HPWA 1EMKA 3DQEA 2H6VA 3LVCA 3PJ7A 2A52B 4TZGA 3CFHA 1XMZA 3SG6A 4EN1A 3MGFA 4LJCA 4ZINA 2G5ZB 3ST0A 3AI5A 3NT9A 3GL4A 4NWSA 2G6EA 4ZF5A 2OTBA 1YFPA 1QY3A 1XQMA 1JC1A 3GJ1A 3GB3A 4P1QA 3DQIA 2G6XA 2JADA 3DQ9A 4JFGA 4XGYA 1EMEA 4B30B 5BTTA 3BXCA 2OKWA 4KW9A 2IB5A 2WSNA 4IK3A 4KPIA 4HVFA 3RWTA 2WIQA 4ANJA 1UISA 3GEXA 2WURA 1G7KA 3U8PA 3NEDA 4W73A 2HQKA 4H48A 2WHSA 2O2BA 2BTJA 1HCJA 1EMGA 1S6ZA 4W6BA 2ZO7A 1BFPA 4N3DA 5FVIA 2POXA 2QRFA 2G2SB 2DUGA 1QYFA 4ZF4A 3E5TA 5F9GA 2A46A 1GGXA 4Q7UA 3PIBA 5EXUA 4EMQA 3SVCA 2OTEA 3O78A 1JC0A 2FZUA 5BTTB 3M24A 2RH7A 4IZNA 3SVNA 3DQ1A 1Q4BA 2IB6A 4DXPA 4P76A 4Z4KA 2Z6XA 3SSVA 2Q57A 4W75A 3S05A 4L1IA 3ST3A 4XOVA 4LJDC 5HZOA 4AR7A 4W6UA 5H88A 5FVFA 4W6JA 3CD1A 2H5RA 1CV7A 3W1CA 4DKMA 4Q9WA 3EVUA 4OGSA 4KGEA 5EB7A 2HCGA 3UFZA 2G3DB 4W76A 2AWMA 2OJKA 5EBJA 2QLHA 2VADA 2H8QA 5H87A 3LF3A 2YDZA 2H5OA 4XVPA 1QYQA 3M22A 1Q73A 2C9IA 3TMRA 1EMCA 4KEXA 3H1OA 4DXNA 3EKJA 3DQHA 2OKYA 3DQMA 2H5PA 1H6RA 2V4EA 3EK8A 3SG4A 3G9AA 3SSYA 2GX0A 3ZUFA 4JC2A 3OSQA 4DXMA 2H5QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RRX A;  1GL4 A;  5DPI A;  3DQO A;  3NEZ A;  3CD9 A;  2AWL A;  2VVI A;  1QYO A;  1H4U A;  4IK1 A;  5EJU A;  4W72 A;  2IE2 A;  2EMN A;  3DQ2 A;  4W6R A;  5HBD A;  3EKH A;  4IK5 A;  4W74 A;  4W6N A;  2A53 B;  5DRG A;  2O24 A;  3SVU A;  2O29 A;  3AKO A;  5HZU A;  5T3I A;  3DQ7 A;  4H3M A;  5DPJ A;  2VAE A;  1W7S A;  3EK7 A;  2YE1 A;  1GFL A;  4L12 A;  2A56 B;  3I19 A;  3BX9 A;  2V4E B;  4I2Y A;  1MOU A;  5DY6 A;  2Z1O A;  4HQ9 A;  3ST4 A;  4JRB A;  3DQC A;  4OHS A;  1Z1Q A;  2A47 A;  3PJ5 A;  3RWA A;  2QZ0 A;  3U8A A;  4ZFS A;  4DXO A;  2YFP A;  3DPX A;  3SSL A;  3SSH A;  3DQ6 A;  2HGD A;  3DQK A;  1C4F A;  4PPK A;  3VHT B;  4EUL A;  2QLG A;  5BQL A;  3U0N A;  2HFC A;  3DQA A;  4ZBL A;  2OGR A;  3LSA A;  5BT0 A;  3BXA A;  4W6T A;  3H1R A;  1XSS A;  1KYR A;  4AS8 A;  2Y0G A;  3ST2 A;  3CGL A;  3WLC A;  5LTR A;  5DTY A;  4KGF A;  4KW4 A;  2DDD A;  2A48 A;  1JBY A;  2WSO A;  2DD9 A;  4Q7T A;  3BXB A;  1EMA A;  5EXC I;  1YJF A;  2HJO A;  4W7D A;  2Z6Y A;  4GF6 B;  4HE4 A;  1Q4D A;  5DPG A;  2DUF A;  2V4E C;  4W6C A;  1OXD A;  5LTQ A;  4OQW A;  4XL5 A;  2IOV A;  2H9W A;  5DPH A;  4Z4M A;  5DQM A;  4DXI A;  2QLG B;  4ORN A;  4PPJ A;  5KTG A;  3DPZ A;  3DQ5 A;  4Q9X A;  1F09 A;  4W6G A;  3SVS A;  4PFE A;  3IP2 A;  1YHI A;  4W6H A;  3ZUL A;  2GW3 A;  4W7F A;  1OXF A;  2G3O A;  4LQU A;  4W7A A;  1W7U A;  3OSR A;  5HGE A;  2WIS A;  5DQB A;  4TZA A;  5FHV A;  2VZX A;  4OY4 A;  3ED8 A;  2EMD A;  3IR8 A;  1OXE A;  2Q6P A;  1KYS A;  4ZIO A;  3CB9 A;  1Z1P A;  2YE0 A;  5J2O A;  2QT2 A;  3DQ8 A;  2WHT A;  4IK4 A;  2DDC A;  2ARL A;  3DQD A;  3NT3 A;  5LTP A;  4W7E A;  1F0B A;  4KA9 A;  3DQN A;  4OJ0 A;  4W6P A;  4R6B A;  2VVH A;  4DKN A;  3E5W A;  1MOV A;  5H89 A;  1Q4A A;  3LF4 B;  3ZUJ A;  3CBE A;  4W7C A;  3PJB A;  5DTX A;  1MYW A;  4W77 A;  3SS0 A;  4W6A A;  3SG3 A;  3K1K A;  2PXS A;  3SRY A;  3EVR A;  3VIC A;  3P28 A;  4JF9 A;  1XAE A;  2DUE A;  3VHT A;  2DUH A;  3AI4 A;  4W7X A;  3V3D A;  1W7T A;  2EMO A;  3CFF A;  4KF5 A;  4UTS A;  3UG0 A;  4LQT A;  1RMO A;  4W7R A;  3SVE A;  5LK4 A;  3SSK A;  4H3L A;  5HZT A;  3VK1 A;  2FL1 A;  5HW9 A;  4DXQ A;  2QU1 A;  1ZGQ A;  3KCT A;  4RYS A;  1RMM A;  4J88 A;  3W1D A;  1EMB A;  4LJB A;  4KAG A;  3EVP A;  4KF4 A;  4Q7R A;  1RMP A;  1EML A;  2A54 B;  2AWK A;  4L13 A;  4IK9 A;  3WCK A;  4W69 A;  3CFA A;  3EK4 A;  3P8U A;  1KP5 A;  2QLI A;  3ZTF A;  2G16 B;  3DQ4 A;  3SST A;  2A50 B;  4LW5 A;  4EDS A;  3GJ2 A;  4PPL A;  3SVB A;  3SVD A;  1YHG A;  2Z6Z A;  1YJ2 A;  4J89 A;  2GX2 A;  4XOW A;  5FVG A;  4HQC A;  3SV5 A;  4W6D A;  2ZO6 A;  3O77 A;  3DQ3 A;  3U0L A;  3A8S A;  4ZF3 A;  1B9C A;  1ZGP A;  1QXT A;  4JGE A;  5DU0 A;  3DQL A;  5AQB B;  2C9J A;  2ZMU A;  3U8C A;  1RM9 A;  1YHH A;  1JBZ A;  3U0M A;  3LS3 A;  2FWQ A;  2GW4 B;  1KYP A;  1YZW A;  2HRS A;  5DTL A;  2VVJ A;  3SVR A;  2PXW A;  3SG7 A;  2B3Q A;  1Q4E A;  3LVA A;  3SVO A;  3DQF A;  3EVV A;  3KCS A;  2ZMW A;  2G6Y A;  4BDU A;  2P4M A;  4W6O A;  4GES B;  5EB6 A;  4J8A A;  3NF0 A;  3OGO A;  4U2V A;  4KF5 C;  2B3P A;  4W6M A;  3LA1 A;  4W6F A;  5HZS A;  1ZUX A;  3ADF A;  3E5V A;  4H47 A;  1HUY A;  1EMF A;  4KW8 A;  2ICR A;  3U0K A;  5EHU A;  4GOB A;  4IK8 A;  1Q4C A;  2AH8 A;  4W6L A;  5DRF A;  2WHU A;  4B5Y A;  2HQZ A;  4HQ8 A;  4ZB1 A;  2QLE A;  2AHA A;  1XA9 A;  2DUI A;  4RTC A;  3DQJ A;  4H3N A;  3DPW A;  4W6S A;  5EXB A;  5DTZ A;  3SG5 A;  4EDO A;  1ZGO A;  3SG2 A;  3LVD A;  2DD7 A;  4W6I A;  1EMM A;  4B30 A;  2AWJ A;  4JEO A;  4RYW A;  3WLD A;  3SSP A;  4LJD A;  2HGY A;  3DQU A;  4R6D A;  4W6K A;  3TMT A;  2HPW A;  1EMK A;  3DQE A;  2H6V A;  3LVC A;  3PJ7 A;  2A52 B;  4TZG A;  3CFH A;  1XMZ A;  3SG6 A;  4EN1 A;  3MGF A;  4LJC A;  4ZIN A;  2G5Z B;  3ST0 A;  3AI5 A;  3NT9 A;  3GL4 A;  4NWS A;  2G6E A;  4ZF5 A;  2OTB A;  1YFP A;  1QY3 A;  1XQM A;  1JC1 A;  3GJ1 A;  3GB3 A;  4P1Q A;  3DQI A;  2G6X A;  2JAD A;  3DQ9 A;  4JFG A;  4XGY A;  1EME A;  4B30 B;  5BTT A;  3BXC A;  2OKW A;  4KW9 A;  2IB5 A;  2WSN A;  4IK3 A;  4KPI A;  4HVF A;  3RWT A;  2WIQ A;  4ANJ A;  1UIS A;  3GEX A;  2WUR A;  1G7K A;  3U8P A;  3NED A;  4W73 A;  2HQK A;  4H48 A;  2WHS A;  2O2B A;  2BTJ A;  1HCJ A;  1EMG A;  1S6Z A;  4W6B A;  2ZO7 A;  1BFP A;  4N3D A;  5FVI A;  2POX A;  2QRF A;  2G2S B;  2DUG A;  1QYF A;  4ZF4 A;  3E5T A;  5F9G A;  2A46 A;  1GGX A;  4Q7U A;  3PIB A;  5EXU A;  4EMQ A;  3SVC A;  2OTE A;  3O78 A;  1JC0 A;  2FZU A;  5BTT B;  3M24 A;  2RH7 A;  4IZN A;  3SVN A;  3DQ1 A;  1Q4B A;  2IB6 A;  4DXP A;  4P76 A;  4Z4K A;  2Z6X A;  3SSV A;  2Q57 A;  4W75 A;  3S05 A;  4L1I A;  3ST3 A;  4XOV A;  4LJD C;  5HZO A;  4AR7 A;  4W6U A;  5H88 A;  5FVF A;  4W6J A;  3CD1 A;  2H5R A;  1CV7 A;  3W1C A;  4DKM A;  4Q9W A;  3EVU A;  4OGS A;  4KGE A;  5EB7 A;  2HCG A;  3UFZ A;  2G3D B;  4W76 A;  2AWM A;  2OJK A;  5EBJ A;  2QLH A;  2VAD A;  2H8Q A;  5H87 A;  3LF3 A;  2YDZ A;  2H5O A;  4XVP A;  1QYQ A;  3M22 A;  1Q73 A;  2C9I A;  3TMR A;  1EMC A;  4KEX A;  3H1O A;  4DXN A;  3EKJ A;  3DQH A;  2OKY A;  3DQM A;  2H5P A;  1H6R A;  2V4E A;  3EK8 A;  3SG4 A;  3G9A A;  3SSY A;  2GX0 A;  3ZUF A;  4JC2 A;  3OSQ A;  4DXM A;  2H5Q A; 
#chains in the Genus database with same CATH topology
 1RRX A;  1GL4 A;  5DPI A;  3DQO A;  3NEZ A;  3CD9 A;  2AWL A;  2VVI A;  1QYO A;  1H4U A;  4IK1 A;  5EJU A;  4W72 A;  2IE2 A;  2EMN A;  3DQ2 A;  4W6R A;  5HBD A;  3EKH A;  4IK5 A;  4W74 A;  4W6N A;  2A53 B;  5DRG A;  2O24 A;  3SVU A;  2O29 A;  3AKO A;  5HZU A;  5T3I A;  3DQ7 A;  4H3M A;  5DPJ A;  2VAE A;  1W7S A;  3EK7 A;  2YE1 A;  1GFL A;  4L12 A;  2A56 B;  3I19 A;  3BX9 A;  2V4E B;  4I2Y A;  1MOU A;  5DY6 A;  2Z1O A;  4HQ9 A;  3ST4 A;  4JRB A;  3DQC A;  4OHS A;  1Z1Q A;  2A47 A;  3PJ5 A;  3RWA A;  2QZ0 A;  3U8A A;  4ZFS A;  4DXO A;  2YFP A;  3DPX A;  3SSL A;  3SSH A;  3DQ6 A;  2HGD A;  3DQK A;  1C4F A;  4PPK A;  3VHT B;  4EUL A;  2QLG A;  5BQL A;  3U0N A;  2HFC A;  3DQA A;  4ZBL A;  2OGR A;  3LSA A;  5BT0 A;  3BXA A;  4W6T A;  3H1R A;  1XSS A;  1KYR A;  4AS8 A;  2Y0G A;  3ST2 A;  3CGL A;  3WLC A;  5LTR A;  5DTY A;  4KGF A;  4KW4 A;  2DDD A;  2A48 A;  1JBY A;  2WSO A;  2DD9 A;  4Q7T A;  3BXB A;  1EMA A;  5EXC I;  1YJF A;  2HJO A;  4W7D A;  2Z6Y A;  4GF6 B;  4HE4 A;  1Q4D A;  5DPG A;  2DUF A;  2V4E C;  4W6C A;  1OXD A;  5LTQ A;  4OQW A;  4XL5 A;  2IOV A;  2H9W A;  5DPH A;  4Z4M A;  5DQM A;  4DXI A;  2QLG B;  4ORN A;  4PPJ A;  5KTG A;  3DPZ A;  3DQ5 A;  4Q9X A;  1F09 A;  4W6G A;  3SVS A;  4PFE A;  3IP2 A;  1YHI A;  4W6H A;  3ZUL A;  2GW3 A;  4W7F A;  1OXF A;  2G3O A;  4LQU A;  4W7A A;  1W7U A;  3OSR A;  5HGE A;  2WIS A;  5DQB A;  4TZA A;  5FHV A;  2VZX A;  4OY4 A;  3ED8 A;  2EMD A;  3IR8 A;  1OXE A;  2Q6P A;  1KYS A;  4ZIO A;  3CB9 A;  1Z1P A;  2YE0 A;  5J2O A;  2QT2 A;  3DQ8 A;  2WHT A;  4IK4 A;  2DDC A;  2ARL A;  3DQD A;  3NT3 A;  5LTP A;  4W7E A;  1F0B A;  4KA9 A;  3DQN A;  4OJ0 A;  4W6P A;  4R6B A;  2VVH A;  4DKN A;  3E5W A;  1MOV A;  5H89 A;  1Q4A A;  3LF4 B;  3ZUJ A;  3CBE A;  4W7C A;  3PJB A;  5DTX A;  1MYW A;  4W77 A;  3SS0 A;  4W6A A;  3SG3 A;  3K1K A;  2PXS A;  3SRY A;  3EVR A;  3VIC A;  3P28 A;  4JF9 A;  1XAE A;  2DUE A;  3VHT A;  2DUH A;  3AI4 A;  4W7X A;  3V3D A;  1W7T A;  2EMO A;  3CFF A;  4KF5 A;  4UTS A;  3UG0 A;  4LQT A;  1RMO A;  4W7R A;  3SVE A;  5LK4 A;  3SSK A;  4H3L A;  5HZT A;  3VK1 A;  2FL1 A;  5HW9 A;  4DXQ A;  2QU1 A;  1ZGQ A;  3KCT A;  4RYS A;  1RMM A;  4J88 A;  3W1D A;  1EMB A;  4LJB A;  4KAG A;  3EVP A;  4KF4 A;  4Q7R A;  1RMP A;  1EML A;  2A54 B;  2AWK A;  4L13 A;  4IK9 A;  3WCK A;  4W69 A;  3CFA A;  3EK4 A;  3P8U A;  1KP5 A;  2QLI A;  3ZTF A;  2G16 B;  3DQ4 A;  3SST A;  2A50 B;  4LW5 A;  4EDS A;  3GJ2 A;  4PPL A;  3SVB A;  3SVD A;  1YHG A;  2Z6Z A;  1YJ2 A;  4J89 A;  2GX2 A;  4XOW A;  5FVG A;  4HQC A;  3SV5 A;  4W6D A;  2ZO6 A;  3O77 A;  3DQ3 A;  3U0L A;  3A8S A;  4ZF3 A;  1B9C A;  1ZGP A;  1QXT A;  4JGE A;  5DU0 A;  3DQL A;  5AQB B;  2C9J A;  2ZMU A;  3U8C A;  1RM9 A;  1YHH A;  1JBZ A;  3U0M A;  3LS3 A;  2FWQ A;  2GW4 B;  1KYP A;  1YZW A;  2HRS A;  5DTL A;  2VVJ A;  3SVR A;  2PXW A;  3SG7 A;  2B3Q A;  1Q4E A;  3LVA A;  3SVO A;  3DQF A;  3EVV A;  3KCS A;  2ZMW A;  2G6Y A;  4BDU A;  2P4M A;  4W6O A;  4GES B;  5EB6 A;  4J8A A;  3NF0 A;  3OGO A;  4U2V A;  4KF5 C;  2B3P A;  4W6M A;  3LA1 A;  4W6F A;  5HZS A;  1ZUX A;  3ADF A;  3E5V A;  4H47 A;  1HUY A;  1EMF A;  4KW8 A;  2ICR A;  3U0K A;  5EHU A;  4GOB A;  4IK8 A;  1Q4C A;  2AH8 A;  4W6L A;  5DRF A;  2WHU A;  4B5Y A;  2HQZ A;  4HQ8 A;  4ZB1 A;  2QLE A;  2AHA A;  1XA9 A;  2DUI A;  4RTC A;  3DQJ A;  4H3N A;  3DPW A;  4W6S A;  5EXB A;  5DTZ A;  3SG5 A;  4EDO A;  1ZGO A;  3SG2 A;  3LVD A;  2DD7 A;  4W6I A;  1EMM A;  4B30 A;  2AWJ A;  4JEO A;  4RYW A;  3WLD A;  3SSP A;  4LJD A;  2HGY A;  3DQU A;  4R6D A;  4W6K A;  3TMT A;  2HPW A;  1EMK A;  3DQE A;  2H6V A;  3LVC A;  3PJ7 A;  2A52 B;  4TZG A;  3CFH A;  1XMZ A;  3SG6 A;  4EN1 A;  3MGF A;  4LJC A;  4ZIN A;  2G5Z B;  3ST0 A;  3AI5 A;  3NT9 A;  3GL4 A;  4NWS A;  2G6E A;  4ZF5 A;  2OTB A;  1YFP A;  1QY3 A;  1XQM A;  1JC1 A;  3GJ1 A;  3GB3 A;  4P1Q A;  3DQI A;  2G6X A;  2JAD A;  3DQ9 A;  4JFG A;  4XGY A;  1EME A;  4B30 B;  5BTT A;  3BXC A;  2OKW A;  4KW9 A;  2IB5 A;  2WSN A;  4IK3 A;  4KPI A;  4HVF A;  3RWT A;  2WIQ A;  4ANJ A;  1UIS A;  3GEX A;  2WUR A;  1G7K A;  3U8P A;  3NED A;  4W73 A;  2HQK A;  4H48 A;  2WHS A;  2O2B A;  2BTJ A;  1HCJ A;  1EMG A;  1S6Z A;  4W6B A;  2ZO7 A;  1BFP A;  4N3D A;  5FVI A;  2POX A;  2QRF A;  2G2S B;  2DUG A;  1QYF A;  4ZF4 A;  3E5T A;  5F9G A;  2A46 A;  1GGX A;  4Q7U A;  3PIB A;  5EXU A;  4EMQ A;  3SVC A;  2OTE A;  3O78 A;  1JC0 A;  2FZU A;  5BTT B;  3M24 A;  2RH7 A;  4IZN A;  3SVN A;  3DQ1 A;  1Q4B A;  2IB6 A;  4DXP A;  4P76 A;  4Z4K A;  2Z6X A;  3SSV A;  2Q57 A;  4W75 A;  3S05 A;  4L1I A;  3ST3 A;  4XOV A;  4LJD C;  5HZO A;  4AR7 A;  4W6U A;  5H88 A;  5FVF A;  4W6J A;  3CD1 A;  2H5R A;  1CV7 A;  3W1C A;  4DKM A;  4Q9W A;  3EVU A;  4OGS A;  4KGE A;  5EB7 A;  2HCG A;  3UFZ A;  2G3D B;  4W76 A;  2AWM A;  2OJK A;  5EBJ A;  2QLH A;  2VAD A;  2H8Q A;  5H87 A;  3LF3 A;  2YDZ A;  2H5O A;  4XVP A;  1QYQ A;  3M22 A;  1Q73 A;  2C9I A;  3TMR A;  1EMC A;  4KEX A;  3H1O A;  4DXN A;  3EKJ A;  3DQH A;  2OKY A;  3DQM A;  2H5P A;  1H6R A;  2V4E A;  3EK8 A;  3SG4 A;  3G9A A;  3SSY A;  2GX0 A;  3ZUF A;  4JC2 A;  3OSQ A;  4DXM A;  2H5Q A; 
#chains in the Genus database with same CATH homology
 1RRX A;  1GL4 A;  5DPI A;  3DQO A;  3NEZ A;  3CD9 A;  2AWL A;  2VVI A;  1QYO A;  1H4U A;  4IK1 A;  5EJU A;  4W72 A;  2IE2 A;  2EMN A;  3DQ2 A;  4W6R A;  5HBD A;  3EKH A;  4IK5 A;  4W74 A;  4W6N A;  2A53 B;  5DRG A;  2O24 A;  3SVU A;  2O29 A;  3AKO A;  5HZU A;  5T3I A;  3DQ7 A;  4H3M A;  5DPJ A;  2VAE A;  1W7S A;  3EK7 A;  2YE1 A;  1GFL A;  4L12 A;  2A56 B;  3I19 A;  3BX9 A;  2V4E B;  4I2Y A;  1MOU A;  5DY6 A;  2Z1O A;  4HQ9 A;  3ST4 A;  4JRB A;  3DQC A;  4OHS A;  1Z1Q A;  2A47 A;  3PJ5 A;  3RWA A;  2QZ0 A;  3U8A A;  4ZFS A;  4DXO A;  2YFP A;  3DPX A;  3SSL A;  3SSH A;  3DQ6 A;  2HGD A;  3DQK A;  1C4F A;  4PPK A;  3VHT B;  4EUL A;  2QLG A;  5BQL A;  3U0N A;  2HFC A;  3DQA A;  4ZBL A;  2OGR A;  3LSA A;  5BT0 A;  3BXA A;  4W6T A;  3H1R A;  1XSS A;  1KYR A;  4AS8 A;  2Y0G A;  3ST2 A;  3CGL A;  3WLC A;  5LTR A;  5DTY A;  4KGF A;  4KW4 A;  2DDD A;  2A48 A;  1JBY A;  2WSO A;  2DD9 A;  4Q7T A;  3BXB A;  1EMA A;  5EXC I;  1YJF A;  2HJO A;  4W7D A;  2Z6Y A;  4GF6 B;  4HE4 A;  1Q4D A;  5DPG A;  2DUF A;  2V4E C;  4W6C A;  1OXD A;  5LTQ A;  4OQW A;  4XL5 A;  2IOV A;  2H9W A;  5DPH A;  4Z4M A;  5DQM A;  4DXI A;  2QLG B;  4ORN A;  4PPJ A;  5KTG A;  3DPZ A;  3DQ5 A;  4Q9X A;  1F09 A;  4W6G A;  3SVS A;  4PFE A;  3IP2 A;  1YHI A;  4W6H A;  3ZUL A;  2GW3 A;  4W7F A;  1OXF A;  2G3O A;  4LQU A;  4W7A A;  1W7U A;  3OSR A;  5HGE A;  2WIS A;  5DQB A;  4TZA A;  5FHV A;  2VZX A;  4OY4 A;  3ED8 A;  2EMD A;  3IR8 A;  1OXE A;  2Q6P A;  1KYS A;  4ZIO A;  3CB9 A;  1Z1P A;  2YE0 A;  5J2O A;  2QT2 A;  3DQ8 A;  2WHT A;  4IK4 A;  2DDC A;  2ARL A;  3DQD A;  3NT3 A;  5LTP A;  4W7E A;  1F0B A;  4KA9 A;  3DQN A;  4OJ0 A;  4W6P A;  4R6B A;  2VVH A;  4DKN A;  3E5W A;  1MOV A;  5H89 A;  1Q4A A;  3LF4 B;  3ZUJ A;  3CBE A;  4W7C A;  3PJB A;  5DTX A;  1MYW A;  4W77 A;  3SS0 A;  4W6A A;  3SG3 A;  3K1K A;  2PXS A;  3SRY A;  3EVR A;  3VIC A;  3P28 A;  4JF9 A;  1XAE A;  2DUE A;  3VHT A;  2DUH A;  3AI4 A;  4W7X A;  3V3D A;  1W7T A;  2EMO A;  3CFF A;  4KF5 A;  4UTS A;  3UG0 A;  4LQT A;  1RMO A;  4W7R A;  3SVE A;  5LK4 A;  3SSK A;  4H3L A;  5HZT A;  3VK1 A;  2FL1 A;  5HW9 A;  4DXQ A;  2QU1 A;  1ZGQ A;  3KCT A;  4RYS A;  1RMM A;  4J88 A;  3W1D A;  1EMB A;  4LJB A;  4KAG A;  3EVP A;  4KF4 A;  4Q7R A;  1RMP A;  1EML A;  2A54 B;  2AWK A;  4L13 A;  4IK9 A;  3WCK A;  4W69 A;  3CFA A;  3EK4 A;  3P8U A;  1KP5 A;  2QLI A;  3ZTF A;  2G16 B;  3DQ4 A;  3SST A;  2A50 B;  4LW5 A;  4EDS A;  3GJ2 A;  4PPL A;  3SVB A;  3SVD A;  1YHG A;  2Z6Z A;  1YJ2 A;  4J89 A;  2GX2 A;  4XOW A;  5FVG A;  4HQC A;  3SV5 A;  4W6D A;  2ZO6 A;  3O77 A;  3DQ3 A;  3U0L A;  3A8S A;  4ZF3 A;  1B9C A;  1ZGP A;  1QXT A;  4JGE A;  5DU0 A;  3DQL A;  5AQB B;  2C9J A;  2ZMU A;  3U8C A;  1RM9 A;  1YHH A;  1JBZ A;  3U0M A;  3LS3 A;  2FWQ A;  2GW4 B;  1KYP A;  1YZW A;  2HRS A;  5DTL A;  2VVJ A;  3SVR A;  2PXW A;  3SG7 A;  2B3Q A;  1Q4E A;  3LVA A;  3SVO A;  3DQF A;  3EVV A;  3KCS A;  2ZMW A;  2G6Y A;  4BDU A;  2P4M A;  4W6O A;  4GES B;  5EB6 A;  4J8A A;  3NF0 A;  3OGO A;  4U2V A;  4KF5 C;  2B3P A;  4W6M A;  3LA1 A;  4W6F A;  5HZS A;  1ZUX A;  3ADF A;  3E5V A;  4H47 A;  1HUY A;  1EMF A;  4KW8 A;  2ICR A;  3U0K A;  5EHU A;  4GOB A;  4IK8 A;  1Q4C A;  2AH8 A;  4W6L A;  5DRF A;  2WHU A;  4B5Y A;  2HQZ A;  4HQ8 A;  4ZB1 A;  2QLE A;  2AHA A;  1XA9 A;  2DUI A;  4RTC A;  3DQJ A;  4H3N A;  3DPW A;  4W6S A;  5EXB A;  5DTZ A;  3SG5 A;  4EDO A;  1ZGO A;  3SG2 A;  3LVD A;  2DD7 A;  4W6I A;  1EMM A;  4B30 A;  2AWJ A;  4JEO A;  4RYW A;  3WLD A;  3SSP A;  4LJD A;  2HGY A;  3DQU A;  4R6D A;  4W6K A;  3TMT A;  2HPW A;  1EMK A;  3DQE A;  2H6V A;  3LVC A;  3PJ7 A;  2A52 B;  4TZG A;  3CFH A;  1XMZ A;  3SG6 A;  4EN1 A;  3MGF A;  4LJC A;  4ZIN A;  2G5Z B;  3ST0 A;  3AI5 A;  3NT9 A;  3GL4 A;  4NWS A;  2G6E A;  4ZF5 A;  2OTB A;  1YFP A;  1QY3 A;  1XQM A;  1JC1 A;  3GJ1 A;  3GB3 A;  4P1Q A;  3DQI A;  2G6X A;  2JAD A;  3DQ9 A;  4JFG A;  4XGY A;  1EME A;  4B30 B;  5BTT A;  3BXC A;  2OKW A;  4KW9 A;  2IB5 A;  2WSN A;  4IK3 A;  4KPI A;  4HVF A;  3RWT A;  2WIQ A;  4ANJ A;  1UIS A;  3GEX A;  2WUR A;  1G7K A;  3U8P A;  3NED A;  4W73 A;  2HQK A;  4H48 A;  2WHS A;  2O2B A;  2BTJ A;  1HCJ A;  1EMG A;  1S6Z A;  4W6B A;  2ZO7 A;  1BFP A;  4N3D A;  5FVI A;  2POX A;  2QRF A;  2G2S B;  2DUG A;  1QYF A;  4ZF4 A;  3E5T A;  5F9G A;  2A46 A;  1GGX A;  4Q7U A;  3PIB A;  5EXU A;  4EMQ A;  3SVC A;  2OTE A;  3O78 A;  1JC0 A;  2FZU A;  5BTT B;  3M24 A;  2RH7 A;  4IZN A;  3SVN A;  3DQ1 A;  1Q4B A;  2IB6 A;  4DXP A;  4P76 A;  4Z4K A;  2Z6X A;  3SSV A;  2Q57 A;  4W75 A;  3S05 A;  4L1I A;  3ST3 A;  4XOV A;  4LJD C;  5HZO A;  4AR7 A;  4W6U A;  5H88 A;  5FVF A;  4W6J A;  3CD1 A;  2H5R A;  1CV7 A;  3W1C A;  4DKM A;  4Q9W A;  3EVU A;  4OGS A;  4KGE A;  5EB7 A;  2HCG A;  3UFZ A;  2G3D B;  4W76 A;  2AWM A;  2OJK A;  5EBJ A;  2QLH A;  2VAD A;  2H8Q A;  5H87 A;  3LF3 A;  2YDZ A;  2H5O A;  4XVP A;  1QYQ A;  3M22 A;  1Q73 A;  2C9I A;  3TMR A;  1EMC A;  4KEX A;  3H1O A;  4DXN A;  3EKJ A;  3DQH A;  2OKY A;  3DQM A;  2H5P A;  1H6R A;  2V4E A;  3EK8 A;  3SG4 A;  3G9A A;  3SSY A;  2GX0 A;  3ZUF A;  4JC2 A;  3OSQ A;  4DXM A;  2H5Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...