2AWYA

Met-dcrh-hr
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
133
structure length
133
Chain Sequence
DVLVKWSEDLANLPSIDTQHKRLVDYINDLYRAARRRDMDKAREVFDALKNYAVEHFGYEERLFADYAYPEATRHKEIHRRFVETVLKWEKQLAAGDPEVVMTTLRGLVDWLVNHIMKEDKKYEAYLRERGVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for O(2) Sensing by the Hemerythrin-like Domain of a Bacterial Chemotaxis Protein: Substrate Tunnel and Fluxional N Terminus
pubmed doi rcsb
source organism Desulfovibrio vulgaris
molecule tags Oxygen storage/transport
molecule keywords hemerythrin-like domain protein DcrH
total genus 59
structure length 133
sequence length 133
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01814 Hemerythrin Hemerythrin HHE cation binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.50 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Hemerythrin-like 2awyA00
2AVKA 2AWYA 1I4ZA 4XPWA 4XPYA 4XPXA 1I4YA 1A7EA 2AWCA 3AGUA 4XQ1A 3WAQA 2MHRA 1HMDA 2HMQA 1HMOA 2HMZA 3AGTA 3WHNA 1A7DA
chains in the Genus database with same CATH superfamily
3NMIA 3GM1A 1U89A 3I4UA 4IAQA 1OW8A 1FTSA 4O6NA 4DRJB 5EHHA 1VLTA 4PR9A 4MVZA 5DQTA 1FAPB 3NYMA 4LERA 3MYIA 4U5HA 5L0DA 1YJGA 2R25A 1XZPA 3DE9A 4JJFA 2Q9BA 2QTVA 4CS9A 3DMDA 3X1OA 3O10A 2IXOA 4JE9A 2EILC 4KI2A 3GANA 4CBEA 1CGNA 1ZHZA 1QPUA 2EPLX 4MS2A 1E84A 4OD5A 3EGXB 4HFFB 3UGPA 5L0CA 3EHNA 2YEVA 1RKEA 3IQTA 3IQ5A 3ZWIA 1QQ3A 5D92A 5DS6A 1JR8A 3F47A 2ASRA 2J9WA 3DKAA 4JW1A 4PACA 3K6BA 1TQGA 3AG4C 2LK4A 3K1HA 3SEOA 1FNTc 2HKVA 1MMGA 2J46A 2A1DD 3MLGA 2LP4A 1PD1A 2IXNA 3ASNC 2DGJA 4MVSA 3RQGA 3L8JA 3U9JA 2XRHA 2J0XA 1RKCA 3FMSA 2Q9AA 2ZXRA 3GWNA 3S29A 1OCZC 1YZAA 4Z9JA 3T6JA 1YYXA 3E9VA 4EBBA 3S90A 2HJMA 3WAQA 4P6IC 3RFYA 3VF0A 3DAGA 1C03A 3NRHA 2J9BA 3L1MA 1SMYF 2OEVA 3ABMC 4CIHA 4ULVA 3DM5A 3Q7GA 2LFDA 3ZC4A 1SR2A 1FFHA 2EINC 4PJJA 2XM0A 3C8GA 3W4YA 2KYHA 5DLJA 4AX2A 4XTKA 4IGGA 2R7TA 1VMAA 2A6HF 2Y3BA 3QTHA 4JTDB 4O6YA 4OIPF 4IARA 3QVZA 1TKNA 3EFOB 4C7OA 2J9VA 2JD3A 4XPWA 5HSWA 2PX0A 3C8GD 5TJ5E 4PJLA 3VAYA 3W8IA 3SP1A 1O3UA 3B9QA 3MFNA 2I15A 4ZLDA 2NUPB 3T6GB 3UR3C 2L9JA 3GEHA 2Y3DA 1LIHA 4R32A 1M57C 2L6HA 2KW3C 1NFNA 1OKKD 1A41A 3K33A 4KC9A 2LD6A 2NUTA 4ANJA 4CIPA 2WVOA 5E2QA 4HE8D 2W45A 1Q0KA 5JVEA 3FHDA 3V7OA 2HV7A 3KYJA 4I1MA 4DBRA 3LUTB 5A6KA 3K7DA 3OA1A 4NTFA 4PK4A 2R05A 3RIPA 2MWQA 1WATA 2MYSA 4JVSA 5CIVA 1YDIA 4I44A 1OKKA 3ATPA 4RDAA 3QZCA 1AVOB 1EQ1A 1T9KA 2HMQA 3B71A 4LLCA 4N06A 3I5PA 3NDBB 3G4XA 1WN0A 2FAPB 3HNLA 1PV3A 1VB5A 3C18A 2J45A 3ITFA 4JRZA 4PFOA 4G78A 4JEBA 3ZVRA 4OINF 3MYFA 4JTCB 3SXYA 3NMJA 2EIJC 1MMAA 2YRFA 1NG1A 4ULWA 1LE2A 1TWCA 4BJ6A 3VYWA 5JUAA 1OQCA 2I8BA 2ZXOA 1HE9A 3N2ZB 2P6VA 1OCRC 2XSEA 1GGQA 4JIOA 3T6BA 4BEJA 1U0BB 2OEXA 1LKXA 4LDRA 2A0BA 4O79A 3JT1A 4ONSA 2WL8A 4BJ5C 4I3MA 4E7ZA 4YT4A 5KYYB 4MW8A 2DI3A 3U8VA 1SF8A 2KC3A 5KYYA 3Q6MA 3ECSA 2AU5A 2NSGA 1ZHWA 4QI2A 2A69F 3DJNB 4G0HA 2BE5F 4CSAA 4JURI 2XS8A 3EH1A 2Y3GA 3UGOA 3PCVA 3VM6A 2KK1A 4J7TA 1NZEA 2WVQA 1ZHXA 4YL3A 4AL1A 4KNVA 1HW1A 4MVRA 3RW0A 5AGFA 1PD0A 2GAQA 3NG1A 2GA0A 1JOGA 1KU2A 2OU6A 4YL1A 1H7IA 1KNYA 5COMA 5L3VA 2NPUA 3KMIA 1VYKA 2R03A 2V26A 3JYHA 1Y6DA 1J8MF 3EGXA 2OOCA 4O7GA 4BEMJ 5DS4A 3WODF 1A7VA 4E18A 2YLIA 1Q0GA 2P1AA 1I5NA 3DJUB 3FOOA 3U8PA 4CS8C 3LESA 4D4XA 3PMRA 4QDLA 2R7OA 3IQCA 1G8XA 3FOPA 4YT2A 2P7VA 4G7ZF 1Q0DA 1YVIA 3K66A 1E2XA 4U9EA 1CPQA 3ZDLA 3ZQYA 2RD9A 3EGDB 1ORYA 3HKKA 3RQFA 4D4NA 3LLKA 3O6XA 5KYXB 2OKUA 4FESA 4XWJA 1WASA 2R7SA 4XEFA 5F5FA 3LEOA 5KYWA 5JT4A 1LI5A 3F46A 1CPRA 1MNDA 4GQHA 4M63A 3HNJA 4IB4A 5BQIA 4Z9IA 1JPJA 2HV6A 4CJGA 1ZZPA 1B68A 1BR2A 3PDMP 1ZHTA 2H7BA 2HS5A 4CDYA 2KSFA 1GM5A 2XXAA 3S0XA 3UNGC 4C7OB 2CW0F 5BQGA 2PP4A 1VYIA 2EPNA 4EBKA 2IM8A 3RH3A 3HNKA 4Q4ZF 3DM9B 4PJNA 4H4KC 5FZTA 4O6MA 5KYUA 4MVMA 1JPNA 2Y3HA 3FAPB 3M79A 5CI9A 1RMVA 3R2PA 4LDKA 4XPXA 3LS0A 5GPGB 2IXMA 3UMHA 4WABA 1QZXA 2O9XA 2WZGA 1D0ZA 5B1BC 2YVKA 5A6BD 1MMNA 1TWHA 4U5BE 2R02A 2EPKX 2YLGA 4MQ9F 4NCQA 1OR3A 4RD9A 3PHF2 3FAJA 5HV9A 3AGTA 3ZQVA 1TWAA 2DYRC 5E33A 4CS9C 2F22A 2ZXWC 1I4YA 3HTKC 3FDQA 1UG7A 2M4EA 2YHSA 2YL0A 1OR2A 3C8GB 3Q7LA 4U5GA 2VCAA 3K1IA 3KH2A 5JRAA 4PJMA 1NU7D 4X0RA 2H7VC 1C17M 1ZVZA 2P61A 3U3BA 1E83A 1M2VA 3RQEA 1WWPA 2WVNA 2XS1A 4MNDA 2HSBA 1MNEA 3EZHA 2XL6A 1FR0A 3M15A 2WZLA 2IBFA 2B0HA 2PFDA 1D1AA 2X0CA 3SZRA 3UMKA 2CGEA 4F4BA 4P9FA 3U2LA 3TJ5A 4K0DA 2PF4E 2ZPAA 1ZYRF 4B6IA 5BQHA 1M2OA 1VLSA 4JCZA 2XLOA 1J8YF 1Z6AA 4MVOA 4NY3A 4DJ9A 4BJTA 2VASA 2AWCA 1TWGA 1QKRA 4MTFA 4JKVA 4E17A 2RSEB 3O39A 3BRJA 4YT8A 4AK9A 1BDJB 2J7PA 1VK5A 1D0XA 3WG7C 4E0IA 3GEIA 3IHUA 4J7YA 1JAFA 1IZMA 2VC9A 2GWWA 4Z9HA 2J9UA 2X51A 1V4AA 2H8AA 2Q4FA 1NFOA 2KQ9A 2UUHA 3LAYA 4BPMA 5A6AA 2YQYA 2CNWD 5L0HA 1KTMA 2J7PD 3LEVA 4IWBA 2AWYA 2ZXPA 2E87A 2YZSA 5L0JA 3C8ZA 2B0JA 2OJED 3AGUA 1HY5A 3LNRA 3SXMA 1S7ZA 3G4ZA 3A9CA 3B29A 5E3AA 3RVYA 3NKEA 3ZTMA 2TMVP 1RCPA 2XXAB 2ZD9A 1T5OA 2CNWA 4U5FE 4ZLCA 1ST6A 3B0PA 4IAOA 4RBNA 5FCLA 5JS5A 2YL7A 4DBQA 3SNHA 5E3CA 5COGA 2NUPA 1L7CA 5JLIA 3EGDA 1W2WA 2AP3A 3E70C 5T3WA 4WGZA 4EHPA 5AC4A 1Y4CA 2OJQA 3EJNA 4LLEA 5L0IA 4DVYP 1LE4A 3DAFA 3WHNA 4QI0A 2C04A 3KKBA 5DQZA 1S05A 1ZW2A 2R7WA 1SZIA 4JC7A 3U3FA 5EGYA 2YWAA 3RKOF 2R7VA 5KYWB 3W8HA 3HJCA 4EIYA 4U9DA 1LM3B 3EHMA 5EK0A 5L0GA 1WGWA 3DWWA 2FFHA 4OIRF 4BJ5A 4MTOA 3JCUQ 3V5YA 3H2VA 3LNMB 4NC3A 4A4AA 1YA7O 2Q9CA 1YLMA 3ZG1A 3GODA 1EI7A 5DS5A 4G7HF 2J8WA 3JRMO 5KYUB 3DI5A 4JTAB 3N24A 2XM4A 2HJ3A 4L6RA 5B1AC 2Q3TA 1T01A 4Q7CA 1UFBA 3SXKA 2YL3A 3ABKC 2G3KA 2VB6A 1D0YA 1QVXA 4U5CE 5D91A 1LI7A 2R7QA 4OIOF 1A7DA 1VOMA 2FGYA 1K04A 2QE9A 4A2NB 1IW7F 2LQGA 4N6HA 4UDVA 4E7SA 2XLVA 3AQCA 2R9RB 2HFIA 1I4ZA 3LLIA 3C62A 1R4TA 4DXWA 1EA8A 1Q0FA 3CQZA 3HLZA 1WOLA 3AG3C 3TULA 3U5SA 1HMDA 2IOQA 3J06A 1Z3IX 3QMKA 4K7BA 1NLXA 1GQAA 1V54C 4N6CA 3V5ZA 2JPUA 1BR4A 2MHRA 3W2WA 1VTMP 5COFA 1RKEB 3US6A 5B3SC 3S84A 2W4BA 4IRUA 5KYNA 1FMVA 1T6QA 3RF3A 1BR1A 3NMKA 4I1OB 1WTYA 5L0FA 1FFTC 2C03A 2L6FA 4DVZA 3LJBA 1QSPA 3M4CA 5K0IA 3TK0A 1OCOC 3M1CB 2EIMC 2R7RA 2P0NA 4LDQA 1TR2A 3FXHA 3JTLO 2GDCA 5T1DB 1JRAA 2OQMA 4K1OA 1GS9A 2PX3A 4XPYA 4AE4A 1M6TA 2EPMX 2NUTB 4CS8A 3IQ6A 3FVYA 3AG1C 1G4WR 1Q0MA 1TFKB 3POVA 3CEXA 1U6HA 1YAUO 4NTAA 2Q7RA 3ABLC 3K1IC 1D1BA 3TOMA 1T6IA 2CCYA 2H7OA 1OW7A 3N0TA 2QY9A 3EG9A 3W2VA 1APCA 3MBGA 1H6GA 2ICWG 3H65A 4KBLA 4U5EE 1Z5ZA 1M2VB 2QUPA 1QLEC 3EG9B 3L34A 4HFKB 2IYLD 4IJJA 4LACB 4OIQF 3I5QA 3SXZA 2CYDA 4YK5A 2G62A 2VH3A 3MX3A 4MW3A 4MVQA 3S9OA 4DRHB 1A0BA 3X2QC 2KGOA 3IPMO 4OD4A 4YT5A 3S28A 2L81A 4XEKA 4BG0A 4CJOA 4W8KA 4ER9A 5L3QA 2EPOA 4H54A 5JSLA 4BJ1A 4WGYA 2XL4A 3EFOA 3LS1A 2QLAA 2PNOA 4G7OF 3JZ0A 2HZ8A 2YKZA 5A6JA 3ZTZA 5F28E 1FMWA 3QW1A 2BL2A 4JCHA 2A68F 3KL4A 2EIKC 3H2UA 2HSQA 1LVKA 3AOUA 2OG2A 3CSKA 3GM2A 4YN0B 4EWCA 4FAPB 1XZQA 5IY5C 1E86A 1T6UA 1ZU5A 4N4WA 4XLNF 4CS7A 3V5XA 2J0WA 3R7CA 4XEVA 3TOLA 2CDQA 5A6BA 2JX0A 3JYYA 2A0UA 2L6GA 1CGME 2WB7A 5DVWA 1YZCA 4P9TA 1NSGB 2M64A 4XQ1A 3HNIA 3VRCA 4JZAA 4AE4B 2YLDA 3EZIA 2AVKA 2Y69C 1MMDA 4NTBA 1OCCC 3QW0A 2Y39A 1O87A 4J32B 1G4US 1PCXA 2L7AA 4FX5A 5AC5A 5B3IA 2IXPA 3NYLA 1HMOA 3C63A 2GFHA 4GYTA 3GEEA 3CAXA 3KPHA 2XLMA 3IEEA 1ZW3A 1BBHA 3DXJF 2LCHA 3NYJA 4XLPF 1HW2A 2YL1A 4FWVA 1ORJA 4CDAA 1DOWA 2V3CC 3OEOA 1ZHYA 4WJ0A 3BEHA 1C02A 1ORSC 1G5ZA 3GORA 3A11A 3AG2C 3ZIBA 1NU9C 1YA9A 3AQBA 3ZSUA 3O55A 3JSEO 4YL0A 2LFFA 3T4RA 1Z23A 1YYJA 3JRTA 1LS4A 2UUIA 4JEAA 1NBBA 3TD7A 3Q6NA 3UMIA 4YWQA 2KJGA 1M56C 4CX9A 1V55C 1OXBA 4W8PA 3TJ6A 1Z63A 2BC5A 3EH2A 3M4BA 2VCBA 4BJ6C 1E85A 2XLDA 4C3DA 1YARO 2XLHA 3NKDA 3EQLF 1L3PA 1LS1A 1OW6A 3EPVA 2WZFA 4EKWA 1K40A 1BZ4A 2W9YA 5T3TA 2R7XA 4NQFA 1XWJA 1H9TA 2ETSA 2D4UA 1V74B 3C7JA 1K05A 1O5HA 1JMWA 2A6EF 3CZ6A 3DD7A 4J30B 5F5HA 3L8IA 4AL0A 4DRIB 2DYSC 3GM3A 1LPEA 1ZU4A 2PBEA 1DOVA 4CDVA 5CI8A 4E0HA 1TFOB 4MVUA 1AEPA 3L0IA 2QNLA 2XLEA 1A7EA 1SYQA 4PFPA 4KNWA 2XL8A 3T9OA 3GWLA 4HEAJ 2HMZA 5KYXA 3AJMA 4MTGA 3B0VC 4EUKB 3KYIA 1N1CA 2Q00A 3TQOA 2W4MA 1AUEA 4EBJA 2HUJA 3DE8A 4C3EA 5JP7A 1OXKA 4Q5SF 2LSEA 256BA 1RJ9A 2XLWA 4GEHA 1EKYA 4CSAC 3JSZA 5A69A 4DOZA 2G3VA 4C3BA 3QVYA 2NSFA 1RXQA 5BUOA 2R7UA 1R5ID 1D1CA 1CGOA 1MQVA 1RJ9B 1F1MA 2D5RB 3G50A 3U0CA 3ASOC 3DZAA 2DB4A 3S27A 3B0UX 2Z15A 3RYLA 3OWTA 2LIGA 4JJGA 1HE1A 2NG1A 1H9GA 3SYNA 3U2MA 4YJWA 2KNHA 2VCCA 3RVZA 1Z7Qc 3U9MA 4U5DE 2OCCC
chains in the Genus database with same CATH topology
2AVKA 2AWYA 1I4ZA 4XPWA 4XPYA 4XPXA 1I4YA 1A7EA 2AWCA 3AGUA 4XQ1A 3WAQA 2MHRA 1HMDA 2HMQA 1HMOA 2HMZA 3AGTA 3WHNA 1A7DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AVK A;  2AWY A;  1I4Z A;  4XPW A;  4XPY A;  4XPX A;  1I4Y A;  1A7E A;  2AWC A;  3AGU A;  4XQ1 A;  3WAQ A;  2MHR A;  1HMD A;  2HMQ A;  1HMO A;  2HMZ A;  3AGT A;  3WHN A;  1A7D A; 
#chains in the Genus database with same CATH topology
 3NMI A;  3GM1 A;  1U89 A;  3I4U A;  4IAQ A;  1OW8 A;  1FTS A;  4O6N A;  4DRJ B;  5EHH A;  1VLT A;  4PR9 A;  4MVZ A;  5DQT A;  1FAP B;  3NYM A;  4LER A;  3MYI A;  4U5H A;  5L0D A;  1YJG A;  2R25 A;  1XZP A;  3DE9 A;  4JJF A;  2Q9B A;  2QTV A;  4CS9 A;  3DMD A;  3X1O A;  3O10 A;  2IXO A;  4JE9 A;  2EIL C;  4KI2 A;  3GAN A;  4CBE A;  1CGN A;  1ZHZ A;  1QPU A;  2EPL X;  4MS2 A;  1E84 A;  4OD5 A;  3EGX B;  4HFF B;  3UGP A;  5L0C A;  3EHN A;  2YEV A;  1RKE A;  3IQT A;  3IQ5 A;  3ZWI A;  1QQ3 A;  5D92 A;  5DS6 A;  1JR8 A;  3F47 A;  2ASR A;  2J9W A;  3DKA A;  4JW1 A;  4PAC A;  3K6B A;  1TQG A;  3AG4 C;  2LK4 A;  3K1H A;  3SEO A;  1FNT c;  2HKV A;  1MMG A;  2J46 A;  2A1D D;  3MLG A;  2LP4 A;  1PD1 A;  2IXN A;  3ASN C;  2DGJ A;  4MVS A;  3RQG A;  3L8J A;  3U9J A;  2XRH A;  2J0X A;  1RKC A;  3FMS A;  2Q9A A;  2ZXR A;  3GWN A;  3S29 A;  1OCZ C;  1YZA A;  4Z9J A;  3T6J A;  1YYX A;  3E9V A;  4EBB A;  3S90 A;  2HJM A;  3WAQ A;  4P6I C;  3RFY A;  3VF0 A;  3DAG A;  1C03 A;  3NRH A;  2J9B A;  3L1M A;  1SMY F;  2OEV A;  3ABM C;  4CIH A;  4ULV A;  3DM5 A;  3Q7G A;  2LFD A;  3ZC4 A;  1SR2 A;  1FFH A;  2EIN C;  4PJJ A;  2XM0 A;  3C8G A;  3W4Y A;  2KYH A;  5DLJ A;  4AX2 A;  4XTK A;  4IGG A;  2R7T A;  1VMA A;  2A6H F;  2Y3B A;  3QTH A;  4JTD B;  4O6Y A;  4OIP F;  4IAR A;  3QVZ A;  1TKN A;  3EFO B;  4C7O A;  2J9V A;  2JD3 A;  4XPW A;  5HSW A;  2PX0 A;  3C8G D;  5TJ5 E;  4PJL A;  3VAY A;  3W8I A;  3SP1 A;  1O3U A;  3B9Q A;  3MFN A;  2I15 A;  4ZLD A;  2NUP B;  3T6G B;  3UR3 C;  2L9J A;  3GEH A;  2Y3D A;  1LIH A;  4R32 A;  1M57 C;  2L6H A;  2KW3 C;  1NFN A;  1OKK D;  1A41 A;  3K33 A;  4KC9 A;  2LD6 A;  2NUT A;  4ANJ A;  4CIP A;  2WVO A;  5E2Q A;  4HE8 D;  2W45 A;  1Q0K A;  5JVE A;  3FHD A;  3V7O A;  2HV7 A;  3KYJ A;  4I1M A;  4DBR A;  3LUT B;  5A6K A;  3K7D A;  3OA1 A;  4NTF A;  4PK4 A;  2R05 A;  3RIP A;  2MWQ A;  1WAT A;  2MYS A;  4JVS A;  5CIV A;  1YDI A;  4I44 A;  1OKK A;  3ATP A;  4RDA A;  3QZC A;  1AVO B;  1EQ1 A;  1T9K A;  2HMQ A;  3B71 A;  4LLC A;  4N06 A;  3I5P A;  3NDB B;  3G4X A;  1WN0 A;  2FAP B;  3HNL A;  1PV3 A;  1VB5 A;  3C18 A;  2J45 A;  3ITF A;  4JRZ A;  4PFO A;  4G78 A;  4JEB A;  3ZVR A;  4OIN F;  3MYF A;  4JTC B;  3SXY A;  3NMJ A;  2EIJ C;  1MMA A;  2YRF A;  1NG1 A;  4ULW A;  1LE2 A;  1TWC A;  4BJ6 A;  3VYW A;  5JUA A;  1OQC A;  2I8B A;  2ZXO A;  1HE9 A;  3N2Z B;  2P6V A;  1OCR C;  2XSE A;  1GGQ A;  4JIO A;  3T6B A;  4BEJ A;  1U0B B;  2OEX A;  1LKX A;  4LDR A;  2A0B A;  4O79 A;  3JT1 A;  4ONS A;  2WL8 A;  4BJ5 C;  4I3M A;  4E7Z A;  4YT4 A;  5KYY B;  4MW8 A;  2DI3 A;  3U8V A;  1SF8 A;  2KC3 A;  5KYY A;  3Q6M A;  3ECS A;  2AU5 A;  2NSG A;  1ZHW A;  4QI2 A;  2A69 F;  3DJN B;  4G0H A;  2BE5 F;  4CSA A;  4JUR I;  2XS8 A;  3EH1 A;  2Y3G A;  3UGO A;  3PCV A;  3VM6 A;  2KK1 A;  4J7T A;  1NZE A;  2WVQ A;  1ZHX A;  4YL3 A;  4AL1 A;  4KNV A;  1HW1 A;  4MVR A;  3RW0 A;  5AGF A;  1PD0 A;  2GAQ A;  3NG1 A;  2GA0 A;  1JOG A;  1KU2 A;  2OU6 A;  4YL1 A;  1H7I A;  1KNY A;  5COM A;  5L3V A;  2NPU A;  3KMI A;  1VYK A;  2R03 A;  2V26 A;  3JYH A;  1Y6D A;  1J8M F;  3EGX A;  2OOC A;  4O7G A;  4BEM J;  5DS4 A;  3WOD F;  1A7V A;  4E18 A;  2YLI A;  1Q0G A;  2P1A A;  1I5N A;  3DJU B;  3FOO A;  3U8P A;  4CS8 C;  3LES A;  4D4X A;  3PMR A;  4QDL A;  2R7O A;  3IQC A;  1G8X A;  3FOP A;  4YT2 A;  2P7V A;  4G7Z F;  1Q0D A;  1YVI A;  3K66 A;  1E2X A;  4U9E A;  1CPQ A;  3ZDL A;  3ZQY A;  2RD9 A;  3EGD B;  1ORY A;  3HKK A;  3RQF A;  4D4N A;  3LLK A;  3O6X A;  5KYX B;  2OKU A;  4FES A;  4XWJ A;  1WAS A;  2R7S A;  4XEF A;  5F5F A;  3LEO A;  5KYW A;  5JT4 A;  1LI5 A;  3F46 A;  1CPR A;  1MND A;  4GQH A;  4M63 A;  3HNJ A;  4IB4 A;  5BQI A;  4Z9I A;  1JPJ A;  2HV6 A;  4CJG A;  1ZZP A;  1B68 A;  1BR2 A;  3PDM P;  1ZHT A;  2H7B A;  2HS5 A;  4CDY A;  2KSF A;  1GM5 A;  2XXA A;  3S0X A;  3UNG C;  4C7O B;  2CW0 F;  5BQG A;  2PP4 A;  1VYI A;  2EPN A;  4EBK A;  2IM8 A;  3RH3 A;  3HNK A;  4Q4Z F;  3DM9 B;  4PJN A;  4H4K C;  5FZT A;  4O6M A;  5KYU A;  4MVM A;  1JPN A;  2Y3H A;  3FAP B;  3M79 A;  5CI9 A;  1RMV A;  3R2P A;  4LDK A;  4XPX A;  3LS0 A;  5GPG B;  2IXM A;  3UMH A;  4WAB A;  1QZX A;  2O9X A;  2WZG A;  1D0Z A;  5B1B C;  2YVK A;  5A6B D;  1MMN A;  1TWH A;  4U5B E;  2R02 A;  2EPK X;  2YLG A;  4MQ9 F;  4NCQ A;  1OR3 A;  4RD9 A;  3PHF 2;  3FAJ A;  5HV9 A;  3AGT A;  3ZQV A;  1TWA A;  2DYR C;  5E33 A;  4CS9 C;  2F22 A;  2ZXW C;  1I4Y A;  3HTK C;  3FDQ A;  1UG7 A;  2M4E A;  2YHS A;  2YL0 A;  1OR2 A;  3C8G B;  3Q7L A;  4U5G A;  2VCA A;  3K1I A;  3KH2 A;  5JRA A;  4PJM A;  1NU7 D;  4X0R A;  2H7V C;  1C17 M;  1ZVZ A;  2P61 A;  3U3B A;  1E83 A;  1M2V A;  3RQE A;  1WWP A;  2WVN A;  2XS1 A;  4MND A;  2HSB A;  1MNE A;  3EZH A;  2XL6 A;  1FR0 A;  3M15 A;  2WZL A;  2IBF A;  2B0H A;  2PFD A;  1D1A A;  2X0C A;  3SZR A;  3UMK A;  2CGE A;  4F4B A;  4P9F A;  3U2L A;  3TJ5 A;  4K0D A;  2PF4 E;  2ZPA A;  1ZYR F;  4B6I A;  5BQH A;  1M2O A;  1VLS A;  4JCZ A;  2XLO A;  1J8Y F;  1Z6A A;  4MVO A;  4NY3 A;  4DJ9 A;  4BJT A;  2VAS A;  2AWC A;  1TWG A;  1QKR A;  4MTF A;  4JKV A;  4E17 A;  2RSE B;  3O39 A;  3BRJ A;  4YT8 A;  4AK9 A;  1BDJ B;  2J7P A;  1VK5 A;  1D0X A;  3WG7 C;  4E0I A;  3GEI A;  3IHU A;  4J7Y A;  1JAF A;  1IZM A;  2VC9 A;  2GWW A;  4Z9H A;  2J9U A;  2X51 A;  1V4A A;  2H8A A;  2Q4F A;  1NFO A;  2KQ9 A;  2UUH A;  3LAY A;  4BPM A;  5A6A A;  2YQY A;  2CNW D;  5L0H A;  1KTM A;  2J7P D;  3LEV A;  4IWB A;  2AWY A;  2ZXP A;  2E87 A;  2YZS A;  5L0J A;  3C8Z A;  2B0J A;  2OJE D;  3AGU A;  1HY5 A;  3LNR A;  3SXM A;  1S7Z A;  3G4Z A;  3A9C A;  3B29 A;  5E3A A;  3RVY A;  3NKE A;  3ZTM A;  2TMV P;  1RCP A;  2XXA B;  2ZD9 A;  1T5O A;  2CNW A;  4U5F E;  4ZLC A;  1ST6 A;  3B0P A;  4IAO A;  4RBN A;  5FCL A;  5JS5 A;  2YL7 A;  4DBQ A;  3SNH A;  5E3C A;  5COG A;  2NUP A;  1L7C A;  5JLI A;  3EGD A;  1W2W A;  2AP3 A;  3E70 C;  5T3W A;  4WGZ A;  4EHP A;  5AC4 A;  1Y4C A;  2OJQ A;  3EJN A;  4LLE A;  5L0I A;  4DVY P;  1LE4 A;  3DAF A;  3WHN A;  4QI0 A;  2C04 A;  3KKB A;  5DQZ A;  1S05 A;  1ZW2 A;  2R7W A;  1SZI A;  4JC7 A;  3U3F A;  5EGY A;  2YWA A;  3RKO F;  2R7V A;  5KYW B;  3W8H A;  3HJC A;  4EIY A;  4U9D A;  1LM3 B;  3EHM A;  5EK0 A;  5L0G A;  1WGW A;  3DWW A;  2FFH A;  4OIR F;  4BJ5 A;  4MTO A;  3JCU Q;  3V5Y A;  3H2V A;  3LNM B;  4NC3 A;  4A4A A;  1YA7 O;  2Q9C A;  1YLM A;  3ZG1 A;  3GOD A;  1EI7 A;  5DS5 A;  4G7H F;  2J8W A;  3JRM O;  5KYU B;  3DI5 A;  4JTA B;  3N24 A;  2XM4 A;  2HJ3 A;  4L6R A;  5B1A C;  2Q3T A;  1T01 A;  4Q7C A;  1UFB A;  3SXK A;  2YL3 A;  3ABK C;  2G3K A;  2VB6 A;  1D0Y A;  1QVX A;  4U5C E;  5D91 A;  1LI7 A;  2R7Q A;  4OIO F;  1A7D A;  1VOM A;  2FGY A;  1K04 A;  2QE9 A;  4A2N B;  1IW7 F;  2LQG A;  4N6H A;  4UDV A;  4E7S A;  2XLV A;  3AQC A;  2R9R B;  2HFI A;  1I4Z A;  3LLI A;  3C62 A;  1R4T A;  4DXW A;  1EA8 A;  1Q0F A;  3CQZ A;  3HLZ A;  1WOL A;  3AG3 C;  3TUL A;  3U5S A;  1HMD A;  2IOQ A;  3J06 A;  1Z3I X;  3QMK A;  4K7B A;  1NLX A;  1GQA A;  1V54 C;  4N6C A;  3V5Z A;  2JPU A;  1BR4 A;  2MHR A;  3W2W A;  1VTM P;  5COF A;  1RKE B;  3US6 A;  5B3S C;  3S84 A;  2W4B A;  4IRU A;  5KYN A;  1FMV A;  1T6Q A;  3RF3 A;  1BR1 A;  3NMK A;  4I1O B;  1WTY A;  5L0F A;  1FFT C;  2C03 A;  2L6F A;  4DVZ A;  3LJB A;  1QSP A;  3M4C A;  5K0I A;  3TK0 A;  1OCO C;  3M1C B;  2EIM C;  2R7R A;  2P0N A;  4LDQ A;  1TR2 A;  3FXH A;  3JTL O;  2GDC A;  5T1D B;  1JRA A;  2OQM A;  4K1O A;  1GS9 A;  2PX3 A;  4XPY A;  4AE4 A;  1M6T A;  2EPM X;  2NUT B;  4CS8 A;  3IQ6 A;  3FVY A;  3AG1 C;  1G4W R;  1Q0M A;  1TFK B;  3POV A;  3CEX A;  1U6H A;  1YAU O;  4NTA A;  2Q7R A;  3ABL C;  3K1I C;  1D1B A;  3TOM A;  1T6I A;  2CCY A;  2H7O A;  1OW7 A;  3N0T A;  2QY9 A;  3EG9 A;  3W2V A;  1APC A;  3MBG A;  1H6G A;  2ICW G;  3H65 A;  4KBL A;  4U5E E;  1Z5Z A;  1M2V B;  2QUP A;  1QLE C;  3EG9 B;  3L34 A;  4HFK B;  2IYL D;  4IJJ A;  4LAC B;  4OIQ F;  3I5Q A;  3SXZ A;  2CYD A;  4YK5 A;  2G62 A;  2VH3 A;  3MX3 A;  4MW3 A;  4MVQ A;  3S9O A;  4DRH B;  1A0B A;  3X2Q C;  2KGO A;  3IPM O;  4OD4 A;  4YT5 A;  3S28 A;  2L81 A;  4XEK A;  4BG0 A;  4CJO A;  4W8K A;  4ER9 A;  5L3Q A;  2EPO A;  4H54 A;  5JSL A;  4BJ1 A;  4WGY A;  2XL4 A;  3EFO A;  3LS1 A;  2QLA A;  2PNO A;  4G7O F;  3JZ0 A;  2HZ8 A;  2YKZ A;  5A6J A;  3ZTZ A;  5F28 E;  1FMW A;  3QW1 A;  2BL2 A;  4JCH A;  2A68 F;  3KL4 A;  2EIK C;  3H2U A;  2HSQ A;  1LVK A;  3AOU A;  2OG2 A;  3CSK A;  3GM2 A;  4YN0 B;  4EWC A;  4FAP B;  1XZQ A;  5IY5 C;  1E86 A;  1T6U A;  1ZU5 A;  4N4W A;  4XLN F;  4CS7 A;  3V5X A;  2J0W A;  3R7C A;  4XEV A;  3TOL A;  2CDQ A;  5A6B A;  2JX0 A;  3JYY A;  2A0U A;  2L6G A;  1CGM E;  2WB7 A;  5DVW A;  1YZC A;  4P9T A;  1NSG B;  2M64 A;  4XQ1 A;  3HNI A;  3VRC A;  4JZA A;  4AE4 B;  2YLD A;  3EZI A;  2AVK A;  2Y69 C;  1MMD A;  4NTB A;  1OCC C;  3QW0 A;  2Y39 A;  1O87 A;  4J32 B;  1G4U S;  1PCX A;  2L7A A;  4FX5 A;  5AC5 A;  5B3I A;  2IXP A;  3NYL A;  1HMO A;  3C63 A;  2GFH A;  4GYT A;  3GEE A;  3CAX A;  3KPH A;  2XLM A;  3IEE A;  1ZW3 A;  1BBH A;  3DXJ F;  2LCH A;  3NYJ A;  4XLP F;  1HW2 A;  2YL1 A;  4FWV A;  1ORJ A;  4CDA A;  1DOW A;  2V3C C;  3OEO A;  1ZHY A;  4WJ0 A;  3BEH A;  1C02 A;  1ORS C;  1G5Z A;  3GOR A;  3A11 A;  3AG2 C;  3ZIB A;  1NU9 C;  1YA9 A;  3AQB A;  3ZSU A;  3O55 A;  3JSE O;  4YL0 A;  2LFF A;  3T4R A;  1Z23 A;  1YYJ A;  3JRT A;  1LS4 A;  2UUI A;  4JEA A;  1NBB A;  3TD7 A;  3Q6N A;  3UMI A;  4YWQ A;  2KJG A;  1M56 C;  4CX9 A;  1V55 C;  1OXB A;  4W8P A;  3TJ6 A;  1Z63 A;  2BC5 A;  3EH2 A;  3M4B A;  2VCB A;  4BJ6 C;  1E85 A;  2XLD A;  4C3D A;  1YAR O;  2XLH A;  3NKD A;  3EQL F;  1L3P A;  1LS1 A;  1OW6 A;  3EPV A;  2WZF A;  4EKW A;  1K40 A;  1BZ4 A;  2W9Y A;  5T3T A;  2R7X A;  4NQF A;  1XWJ A;  1H9T A;  2ETS A;  2D4U A;  1V74 B;  3C7J A;  1K05 A;  1O5H A;  1JMW A;  2A6E F;  3CZ6 A;  3DD7 A;  4J30 B;  5F5H A;  3L8I A;  4AL0 A;  4DRI B;  2DYS C;  3GM3 A;  1LPE A;  1ZU4 A;  2PBE A;  1DOV A;  4CDV A;  5CI8 A;  4E0H A;  1TFO B;  4MVU A;  1AEP A;  3L0I A;  2QNL A;  2XLE A;  1A7E A;  1SYQ A;  4PFP A;  4KNW A;  2XL8 A;  3T9O A;  3GWL A;  4HEA J;  2HMZ A;  5KYX A;  3AJM A;  4MTG A;  3B0V C;  4EUK B;  3KYI A;  1N1C A;  2Q00 A;  3TQO A;  2W4M A;  1AUE A;  4EBJ A;  2HUJ A;  3DE8 A;  4C3E A;  5JP7 A;  1OXK A;  4Q5S F;  2LSE A;  256B A;  1RJ9 A;  2XLW A;  4GEH A;  1EKY A;  4CSA C;  3JSZ A;  5A69 A;  4DOZ A;  2G3V A;  4C3B A;  3QVY A;  2NSF A;  1RXQ A;  5BUO A;  2R7U A;  1R5I D;  1D1C A;  1CGO A;  1MQV A;  1RJ9 B;  1F1M A;  2D5R B;  3G50 A;  3U0C A;  3ASO C;  3DZA A;  2DB4 A;  3S27 A;  3B0U X;  2Z15 A;  3RYL A;  3OWT A;  2LIG A;  4JJG A;  1HE1 A;  2NG1 A;  1H9G A;  3SYN A;  3U2M A;  4YJW A;  2KNH A;  2VCC A;  3RVZ A;  1Z7Q c;  3U9M A;  4U5D E;  2OCC C; 
#chains in the Genus database with same CATH homology
 2AVK A;  2AWY A;  1I4Z A;  4XPW A;  4XPY A;  4XPX A;  1I4Y A;  1A7E A;  2AWC A;  3AGU A;  4XQ1 A;  3WAQ A;  2MHR A;  1HMD A;  2HMQ A;  1HMO A;  2HMZ A;  3AGT A;  3WHN A;  1A7D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...