2AWYA

Met-dcrh-hr
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
133
structure length
133
Chain Sequence
DVLVKWSEDLANLPSIDTQHKRLVDYINDLYRAARRRDMDKAREVFDALKNYAVEHFGYEERLFADYAYPEATRHKEIHRRFVETVLKWEKQLAAGDPEVVMTTLRGLVDWLVNHIMKEDKKYEAYLRERGVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hemerythrin-like domain protein DcrH
publication title Structural Basis for O(2) Sensing by the Hemerythrin-like Domain of a Bacterial Chemotaxis Protein: Substrate Tunnel and Fluxional N Terminus
pubmed doi rcsb
source organism Desulfovibrio vulgaris
molecule tags Oxygen storage/transport
total genus 59
structure length 133
sequence length 133
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01814 Hemerythrin Hemerythrin HHE cation binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.50 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Hemerythrin-like 2awyA00
4XPWA 3AGUA 1HMOA 1HMDA 2AWYA 3WHNA 4XPXA 2AVKA 2HMQA 4XPYA 4XQ1A 2MHRA 2AWCA 1A7DA 3WAQA 1I4ZA 1A7EA 3AGTA 2HMZA 1I4YA
chains in the Genus database with same CATH superfamily
3W8IA 2NUPA 2KJGA 3NKEA 4U5FE 3U0CA 1D1BA 2D5RB 1APCA 1G4US 2F22A 3MBGA 3UMIA 1D0YA 5BQIA 1V74B 4JTAB 3EG9A 1VK5A 3JSEO 1G4WR 2OU6A 2KNHA 2R03A 3FAJA 3HTKC 2WVQA 3L1MA 4IJJA 1A0BA 3N0TA 4J30B 4P6IC 3M15A 3DE9A 2NUTB 2R7QA 3EJNA 4GEHA 5DS6A 2P0NA 3ASOC 3IHUA 4CIHA 3MX3A 4U9DA 3C8GA 4P9TA 4O6YA 3ZTZA 1ORYA 1NZEA 3KYJA 3EH1A 5DS4A 3K1IA 3MFNA 4CX9A 2TMVP 3EPVA 2CCYA 4AK9A 1OQCA 1VLSA 1YYXA 2L6HA 4C3EA 3PHF2 3AGTA 4DOZA 3HNLA 4KNWA 3ZC4A 3RW0A 2EILC 2R05A 3E70C 4MVOA 4MQ9F 5E33A 3RQFA 3RF3A 1M57C 1EI7A 3ABLC 1YARO 3GWNA 3L8IA 3TK0A 3U5SA 4O6NA 4LDKA 3PCVA 5FZTA 4E0HA 1FFHA 4G78A 1WATA 3C8GB 4LDQA 4MVUA 1QPUA 3M79A 4MVZA 4YT2A 2QE9A 4DJ9A 3B0PA 3CSKA 4RDAA 4EBKA 3QVZA 2Y3DA 1TQGA 1VOMA 4MW3A 2C04A 2W45A 3S27A 2QLAA 3F46A 5EHHA 2XM0A 1Z6AA 1TWCA 4CS9C 2P61A 1MMAA 2DI3A 1M2VB 2OEXA 2XLDA 1Q0KA 2YL7A 4EKWA 2W4MA 3TOLA 4FAPB 1YJGA 3UGPA 2NSGA 3EGXA 3NMIA 1A7EA 4ONSA 4ULVA 4GYTA 4PK4A 3S29A 4XLPF 3US6A 3JZ0A 2ETSA 2P1AA 1SMYF 2FGYA 2G3KA 2R02A 2LD6A 3LUTB 3K33A 3Q6NA 2LFFA 3JYYA 4D4XA 3GEIA 5A6AA 4PFOA 1HMDA 2QUPA 2J7PD 3PMRA 2XLVA 3MYFA 4XWJA 3WHNA 4JZAA 4PJNA 2KSFA 1O87A 3KKBA 4A4AA 2EPKX 1LVKA 2B0JA 2DB4A 1ZW2A 4O7GA 3JRMO 2M64A 4MS2A 1MNEA 3EH2A 5B3SC 2OOCA 1D1CA 1QQ3A 2XS1A 3B71A 4JEBA 1Q0GA 4E18A 1FAPB 1CGOA 1Z3IX 1E84A 3NMKA 4N6HA 4WJ0A 4HE8D 1WTYA 3TJ5A 1EA8A 3R2PA 1ORJA 3RKOF 2VH3A 2ZXWC 3NYJA 3WG7C 1CPRA 1M2OA 1PCXA 2JD3A 256BA 3V7OA 4AE4A 2YKZA 1NLXA 3DM5A 2AWYA 2FAPB 3VAYA 4HFFB 5DVWA 2HJ3A 2A68F 2L6GA 2XL8A 2OKUA 2Q4FA 2YEVA 3FOOA 1ZYRF 2XLMA 3GM3A 4JCHA 4BJTA 1H9TA 3POVA 2DYSC 2WVNA 3LAYA 3DJNB 3NKDA 4XEFA 4Z9IA 5A6KA 3T9OA 1PV3A 2IM8A 4W8KA 1XZPA 3LS0A 4YWQA 1HE9A 2UUIA 3ITFA 3ZDLA 2BE5F 3C63A 1HY5A 3VRCA 2VB6A 2YL1A 3DE8A 1I4ZA 1OR3A 1ZHTA 2A0BA 3FVYA 4AE4B 3PDMP 3LJBA 1OW6A 1S05A 3M4BA 2ZXPA 4LDRA 1OXKA 3J06A 3HLZA 4FWVA 5JP7A 2DYRC 2R7VA 3OA1A 4CDVA 5KYWA 3I5QA 4YT4A 3BEHA 2KQ9A 3G4XA 3LEOA 5F28E 2AVKA 3H2VA 3SNHA 4Q7CA 4MVSA 3UMHA 5F5FA 4I1OB 2CYDA 4XQ1A 1T01A 4Z9HA 1Z7Qc 3HNIA 4DRHB 2RSEB 1E85A 4JJFA 3V5XA 2AWCA 1AUEA 3DJUB 1HE1A 3ABMC 1A7DA 1D1AA 3S28A 2V26A 3BRJA 2V3CC 4PJMA 2PP4A 4IWBA 3K1IC 3VYWA 1RKEA 1OCRC 2L81A 3O39A 3EZHA 4CSAA 2HMZA 3U8VA 2H7OA 4YN0B 4YT8A 5AC5A 4OIQF 1O3UA 2GFHA 3EGDA 3GM1A 1EKYA 1LE4A 4JRZA 2D4UA 3B29A 3JTLO 3QTHA 4JIOA 5JSLA 2EIMC 4MTGA 1BR1A 1HW1A 1JR8A 1XZQA 3EZIA 4J32B 4WGYA 1OCCC 2YQYA 2HV7A 3LLKA 5AGFA 2J8WA 1LS1A 2YWAA 4Q4ZF 2PFDA 1DOVA 1O5HA 1TWGA 1H6GA 1KU2A 3S84A 2EPNA 1RKEB 3HKKA 2XLWA 1A7VA 4W8PA 3NRHA 2XL4A 1TWAA 4BG0A 4E0IA 5B3IA 3GANA 3DI5A 1L7CA 2Q00A 4U5CE 5GPGB 2O9XA 4RBNA 3TD7A 3JYHA 1BDJB 1LI7A 2NUPB 1Z63A 4BJ6A 3TOMA 5KYUA 3MYIA 1OW7A 2L9JA 3DM9B 3FXHA 1T6QA 2YLGA 1NG1A 1MMDA 1UFBA 4ULWA 3EG9B 4Q5SF 4PFPA 3K6BA 4E7SA 5JVEA 3AG2C 3RVZA 3NDBB 1GS9A 3RYLA 1VMAA 3U8PA 4N06A 1QZXA 4NC3A 3TJ6A 2HSBA 2LSEA 1J8MF 2KC3A 2Q9AA 1WASA 4FX5A 3DMDA 3K7DA 4LLCA 4N6CA 4U9EA 3SP1A 4JE9A 2IOQA 2R7RA 2Q9BA 1D0XA 4XPYA 2NSFA 1N1CA 4MTFA 3ATPA 2XRHA 3IPMO 5A6BD 3I5PA 2EPLX 3F47A 4XEVA 4IAQA 3FHDA 3W4YA 5L0DA 1ZHYA 4H54A 2XLEA 4OD5A 2IXOA 5L0FA 3IQ5A 2Y3BA 1LI5A 2J9VA 4U5HA 3RVYA 3ZQVA 3DXJF 1YA7O 2IYLD 3RQEA 5A69A 1VYKA 2CDQA 3V5YA 4QI2A 4Z9JA 4NCQA 2OEVA 2IBFA 1I4YA 4CDYA 2A6HF 2Q3TA 2XSEA 3DZAA 2YRFA 4WABA 2WL8A 3VM6A 4JKVA 2OCCC 4R32A 1TFOB 1ZVZA 3JCUQ 3MLGA 5DLJA 2EINC 4D4NA 3KH2A 2R7TA 3R7CA 2ICWG 3SYNA 3O55A 4OIPF 2R7XA 5COGA 2HMQA 4G7OF 3HNJA 1KTMA 3H65A 4BJ1A 3EGXB 4C7OA 3ZTMA 2WVOA 4PJLA 4OIRF 5L3QA 1FMWA 1RKCA 2OJED 3GM2A 4NQFA 1K04A 2LFDA 3T6BA 2CGEA 2P7VA 3WAQA 1JOGA 5KYNA 2J7PA 3C8ZA 4JVSA 2H7BA 2LIGA 1BR4A 1PD0A 2PF4E 3SXYA 2XLHA 4IRUA 3FDQA 1MMNA 4LERA 2JX0A 5DQTA 1YDIA 1EQ1A 1R4TA 1UG7A 4XPWA 5T1DB 4CDAA 5KYYA 1V4AA 1PD1A 3Q6MA 4ZLDA 4IGGA 1ORSC 4J7YA 4JCZA 1GGQA 2HV6A 2Y39A 2XXAA 4YJWA 1YZCA 4C7OB 3TULA 3I4UA 5L0GA 3ZQYA 3ZG1A 2NPUA 3JRTA 3LEVA 2R7UA 1RMVA 1Z5ZA 2HJMA 2G3VA 3NYMA 3C7JA 2HFIA 4JEAA 4YL1A 1MNDA 1YLMA 2MHRA 2OJQA 2DGJA 3VF0A 4A2NB 1OKKD 2VCBA 5KYYB 4NTAA 2QTVA 2W9YA 2ZPAA 3A11A 3Q7LA 1OCOC 3KMIA 1U89A 2L7AA 4CSAC 4H4KC 3C18A 4M63A 3RIPA 4JTDB 5L0HA 3DWWA 3U2LA 5A6JA 2J0WA 2PNOA 5JUAA 5EK0A 4PJJA 4BPMA 4LLEA 3KYIA 2E87A 1RCPA 5COMA 1SYQA 2HKVA 3C62A 1G8XA 1NU7D 3EHMA 2Y3HA 5F5HA 1XWJA 3KL4A 3ZSUA 3SEOA 4K7BA 1T5OA 3ABKC 4IAOA 2L6FA 3ZWIA 4DBRA 1ZW3A 2KK1A 2CW0F 3FMSA 3K66A 3M4CA 1NFNA 4EBBA 1M6TA 1ZHXA 3SZRA 1VB5A 3UR3C 2X51A 5KYWB 2JPUA 4ER9A 2LP4A 4G0HA 4XEKA 1FFTC 3X2QC 4O6MA 1WOLA 5JT4A 2GDCA 3EQLF 4DRIB 4ZLCA 5EGYA 1RJ9A 5L0CA 3CEXA 1FTSA 5D91A 1TR2A 5FCLA 1LIHA 4PR9A 2A69F 2H8AA 3IQTA 2YLIA 2MYSA 3JSZA 2Z15A 1ZZPA 4I3MA 5L3VA 3ZIBA 1K05A 4JURI 3GODA 3FAPB 4JJGA 4RD9A 1Q0FA 4KC9A 1LE2A 2VC9A 1E83A 3T6JA 1GM5A 5B1BC 2W4BA 1W2WA 3OEOA 4MVQA 4U5EE 5T3TA 3HNKA 4MVMA 3IQCA 3EGDB 2Q7RA 2Q9CA 2R25A 2XS8A 1ST6A 1TKNA 2QY9A 4BJ5A 4F4BA 3W8HA 4C3DA 1LPEA 3X1OA 1FNTc 1OCZC 3GEEA 4E7ZA 2HZ8A 1JRAA 2HSQA 2J46A 1ZHWA 2J45A 3C8GD 4HEAJ 1HMOA 1QSPA 3AG1C 1C02A 3GWLA 5JS5A 4KI2A 2IXNA 4MW8A 1U0BB 1C17M 2ASRA 2YL3A 5DQZA 3LNMB 1F1MA 3ECSA 3B0VC 2PX3A 2CNWD 2GAQA 3B9QA 2R7OA 3UNGC 1WWPA 2NG1A 3QVYA 5COFA 5BQGA 4CS7A 1NSGB 3DAGA 4MTOA 1VTMP 1GQAA 4FESA 5E2QA 5KYUB 2PBEA 4CS8A 3UGOA 2J9WA 4U5DE 4DRJB 4EBJA 3CAXA 5HSWA 3G4ZA 3DD7A 1Q0DA 4JC7A 3IQ6A 1CGNA 4DVZA 1QVXA 3QW1A 4EWCA 3AQBA 3EFOA 2CNWA 4CJOA 4K0DA 2VCCA 4OINF 5K0IA 1M2VA 3GORA 3U3FA 2H7VC 4YL0A 1BR2A 1Q0MA 5A6BA 3EHNA 2KYHA 3NG1A 1U6HA 2EIJC 1VLTA 1QKRA 4CJGA 5IY5C 1A41A 2A1DD 5L0JA 1CGME 1R5ID 1S7ZA 4YK5A 5B1AC 2BL2A 5E3AA 3SXKA 2QNLA 4YL3A 3HJCA 3QZCA 4N4WA 1Y6DA 1H9GA 2X0CA 1QLEC 3ZVRA 3AOUA 2AU5A 2I8BA 3EFOB 2YZSA 1OW8A 2PX0A 3DKAA 3O10A 1I5NA 3AG4C 2UUHA 3V5ZA 1IW7F 4XTKA 4DVYP 2BC5A 3Q7GA 1H7IA 1T6IA 2IXMA 2A0UA 2FFHA 2P6VA 3U2MA 1JAFA 3W2WA 2EPOA 2Y69C 4DXWA 2YHSA 3LESA 1IZMA 1T9KA 1AEPA 1JPNA 5JRAA 1RXQA 4YT5A 3AQCA 4NY3A 3G50A 3JT1A 2AP3A 4K1OA 5T3WA 5KYXA 2OG2A 1TWHA 2YL0A 2ZXOA 1JPJA 2GWWA 2XM4A 1YVIA 4JW1A 3SXZA 5L0IA 2LK4A 2VASA 3AJMA 2RD9A 4QI0A 1WN0A 1OXBA 3QMKA 4I1MA 4BEMJ 3S90A 2I15A 1KNYA 2C03A 1YA9A 2A6EF 3CZ6A 1K40A 4IB4A 3NYLA 2HUJA 1B68A 5D92A 4L6RA 4CS9A 5DS5A 3LNRA 2KW3C 1NFOA 2XLOA 3DAFA 3GEHA 4UDVA 2VCAA 1LKXA 2LCHA 5AC4A 4U5BE 1VYIA 5KYXB 2Y3GA 3B0UX 3N2ZB 3QW0A 4X0RA 3A9CA 2J9UA 2XXAB 3LS1A 4NTFA 3ASNC 3O6XA 1MQVA 1YYJA 3NMJA 3U9MA 4OD4A 2R7SA 2GA0A 4PACA 1JMWA 2G62A 1Z23A 1OKKA 2J0XA 4XPXA 1LS4A 3N24A 4DBQA 1CPQA 1OR2A 3KPHA 4NTBA 4QDLA 3T4RA 3RFYA 1FR0A 2ZXRA 3SXMA 2B0HA 3FOPA 1YAUO 1J8YF 3UMKA 4CIPA 1SF8A 1ZU4A 4XLNF 1BZ4A 3IEEA 2WB7A 3CQZA 1FMVA 1C03A 3E9VA 3TQOA 1TFKB 5E3CA 4E17A 2R7WA 1YZAA 4JTCB 4G7HF 1MMGA 3K1HA 3M1CB 3OWTA 3S0XA 2WZLA 1Y4CA 4MNDA 2EIKC 1ZHZA 2XL6A 1WGWA 4BJ6C 4BJ5C 1NU9C 1E2XA 4HFKB 4O79A 5JLIA 1T6UA 4C3BA 1SZIA 1DOWA 1SR2A 4EUKB 4OIOF 3L0IA 2EPMX 3AGUA 3T6GB 4BEJA 2R9RB 3U9JA 4U5GA 4EHPA 2MWQA 2IXPA 2YVKA 1L3PA 4CBEA 4G7ZF 5CI9A 4KNVA 3LLIA 1D0ZA 1V54C 3L8JA 3WODF 3AG3C 2HS5A 5TJ5E 1HW2A 1BBHA 2LQGA 4I44A 2M4EA 4J7TA 1E86A 2KGOA 1M56C 3RH3A 3W2VA 4EIYA 3L34A 1V55C 4AX2A 4B6IA 4CS8C 5CIVA 3U3BA 1NBBA 1ZU5A 4KBLA 5HV9A 1G5ZA 4IARA 4LACB 4MVRA 2ZD9A 4AL1A 2YLDA 3H2UA 2WZFA 2NUTA 1AVOB 3RQGA 4AL0A 2J9BA 4GQHA 3S9OA 1RJ9B 2WZGA 4ANJA 2OQMA 5CI8A 5BQHA 1LM3B 4WGZA 5BUOA 4P9FA
chains in the Genus database with same CATH topology
4XPWA 3AGUA 1HMOA 1HMDA 2AWYA 3WHNA 4XPXA 2AVKA 2HMQA 4XPYA 4XQ1A 2MHRA 2AWCA 1A7DA 3WAQA 1I4ZA 1A7EA 3AGTA 2HMZA 1I4YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XPW A;  3AGU A;  1HMO A;  1HMD A;  2AWY A;  3WHN A;  4XPX A;  2AVK A;  2HMQ A;  4XPY A;  4XQ1 A;  2MHR A;  2AWC A;  1A7D A;  3WAQ A;  1I4Z A;  1A7E A;  3AGT A;  2HMZ A;  1I4Y A; 
#chains in the Genus database with same CATH topology
 3W8I A;  2NUP A;  2KJG A;  3NKE A;  4U5F E;  3U0C A;  1D1B A;  2D5R B;  1APC A;  1G4U S;  2F22 A;  3MBG A;  3UMI A;  1D0Y A;  5BQI A;  1V74 B;  4JTA B;  3EG9 A;  1VK5 A;  3JSE O;  1G4W R;  2OU6 A;  2KNH A;  2R03 A;  3FAJ A;  3HTK C;  2WVQ A;  3L1M A;  4IJJ A;  1A0B A;  3N0T A;  4J30 B;  4P6I C;  3M15 A;  3DE9 A;  2NUT B;  2R7Q A;  3EJN A;  4GEH A;  5DS6 A;  2P0N A;  3ASO C;  3IHU A;  4CIH A;  3MX3 A;  4U9D A;  3C8G A;  4P9T A;  4O6Y A;  3ZTZ A;  1ORY A;  1NZE A;  3KYJ A;  3EH1 A;  5DS4 A;  3K1I A;  3MFN A;  4CX9 A;  2TMV P;  3EPV A;  2CCY A;  4AK9 A;  1OQC A;  1VLS A;  1YYX A;  2L6H A;  4C3E A;  3PHF 2;  3AGT A;  4DOZ A;  3HNL A;  4KNW A;  3ZC4 A;  3RW0 A;  2EIL C;  2R05 A;  3E70 C;  4MVO A;  4MQ9 F;  5E33 A;  3RQF A;  3RF3 A;  1M57 C;  1EI7 A;  3ABL C;  1YAR O;  3GWN A;  3L8I A;  3TK0 A;  3U5S A;  4O6N A;  4LDK A;  3PCV A;  5FZT A;  4E0H A;  1FFH A;  4G78 A;  1WAT A;  3C8G B;  4LDQ A;  4MVU A;  1QPU A;  3M79 A;  4MVZ A;  4YT2 A;  2QE9 A;  4DJ9 A;  3B0P A;  3CSK A;  4RDA A;  4EBK A;  3QVZ A;  2Y3D A;  1TQG A;  1VOM A;  4MW3 A;  2C04 A;  2W45 A;  3S27 A;  2QLA A;  3F46 A;  5EHH A;  2XM0 A;  1Z6A A;  1TWC A;  4CS9 C;  2P61 A;  1MMA A;  2DI3 A;  1M2V B;  2OEX A;  2XLD A;  1Q0K A;  2YL7 A;  4EKW A;  2W4M A;  3TOL A;  4FAP B;  1YJG A;  3UGP A;  2NSG A;  3EGX A;  3NMI A;  1A7E A;  4ONS A;  4ULV A;  4GYT A;  4PK4 A;  3S29 A;  4XLP F;  3US6 A;  3JZ0 A;  2ETS A;  2P1A A;  1SMY F;  2FGY A;  2G3K A;  2R02 A;  2LD6 A;  3LUT B;  3K33 A;  3Q6N A;  2LFF A;  3JYY A;  4D4X A;  3GEI A;  5A6A A;  4PFO A;  1HMD A;  2QUP A;  2J7P D;  3PMR A;  2XLV A;  3MYF A;  4XWJ A;  3WHN A;  4JZA A;  4PJN A;  2KSF A;  1O87 A;  3KKB A;  4A4A A;  2EPK X;  1LVK A;  2B0J A;  2DB4 A;  1ZW2 A;  4O7G A;  3JRM O;  2M64 A;  4MS2 A;  1MNE A;  3EH2 A;  5B3S C;  2OOC A;  1D1C A;  1QQ3 A;  2XS1 A;  3B71 A;  4JEB A;  1Q0G A;  4E18 A;  1FAP B;  1CGO A;  1Z3I X;  1E84 A;  3NMK A;  4N6H A;  4WJ0 A;  4HE8 D;  1WTY A;  3TJ5 A;  1EA8 A;  3R2P A;  1ORJ A;  3RKO F;  2VH3 A;  2ZXW C;  3NYJ A;  3WG7 C;  1CPR A;  1M2O A;  1PCX A;  2JD3 A;  256B A;  3V7O A;  4AE4 A;  2YKZ A;  1NLX A;  3DM5 A;  2AWY A;  2FAP B;  3VAY A;  4HFF B;  5DVW A;  2HJ3 A;  2A68 F;  2L6G A;  2XL8 A;  2OKU A;  2Q4F A;  2YEV A;  3FOO A;  1ZYR F;  2XLM A;  3GM3 A;  4JCH A;  4BJT A;  1H9T A;  3POV A;  2DYS C;  2WVN A;  3LAY A;  3DJN B;  3NKD A;  4XEF A;  4Z9I A;  5A6K A;  3T9O A;  1PV3 A;  2IM8 A;  4W8K A;  1XZP A;  3LS0 A;  4YWQ A;  1HE9 A;  2UUI A;  3ITF A;  3ZDL A;  2BE5 F;  3C63 A;  1HY5 A;  3VRC A;  2VB6 A;  2YL1 A;  3DE8 A;  1I4Z A;  1OR3 A;  1ZHT A;  2A0B A;  3FVY A;  4AE4 B;  3PDM P;  3LJB A;  1OW6 A;  1S05 A;  3M4B A;  2ZXP A;  4LDR A;  1OXK A;  3J06 A;  3HLZ A;  4FWV A;  5JP7 A;  2DYR C;  2R7V A;  3OA1 A;  4CDV A;  5KYW A;  3I5Q A;  4YT4 A;  3BEH A;  2KQ9 A;  3G4X A;  3LEO A;  5F28 E;  2AVK A;  3H2V A;  3SNH A;  4Q7C A;  4MVS A;  3UMH A;  5F5F A;  4I1O B;  2CYD A;  4XQ1 A;  1T01 A;  4Z9H A;  1Z7Q c;  3HNI A;  4DRH B;  2RSE B;  1E85 A;  4JJF A;  3V5X A;  2AWC A;  1AUE A;  3DJU B;  1HE1 A;  3ABM C;  1A7D A;  1D1A A;  3S28 A;  2V26 A;  3BRJ A;  2V3C C;  4PJM A;  2PP4 A;  4IWB A;  3K1I C;  3VYW A;  1RKE A;  1OCR C;  2L81 A;  3O39 A;  3EZH A;  4CSA A;  2HMZ A;  3U8V A;  2H7O A;  4YN0 B;  4YT8 A;  5AC5 A;  4OIQ F;  1O3U A;  2GFH A;  3EGD A;  3GM1 A;  1EKY A;  1LE4 A;  4JRZ A;  2D4U A;  3B29 A;  3JTL O;  3QTH A;  4JIO A;  5JSL A;  2EIM C;  4MTG A;  1BR1 A;  1HW1 A;  1JR8 A;  1XZQ A;  3EZI A;  4J32 B;  4WGY A;  1OCC C;  2YQY A;  2HV7 A;  3LLK A;  5AGF A;  2J8W A;  1LS1 A;  2YWA A;  4Q4Z F;  2PFD A;  1DOV A;  1O5H A;  1TWG A;  1H6G A;  1KU2 A;  3S84 A;  2EPN A;  1RKE B;  3HKK A;  2XLW A;  1A7V A;  4W8P A;  3NRH A;  2XL4 A;  1TWA A;  4BG0 A;  4E0I A;  5B3I A;  3GAN A;  3DI5 A;  1L7C A;  2Q00 A;  4U5C E;  5GPG B;  2O9X A;  4RBN A;  3TD7 A;  3JYH A;  1BDJ B;  1LI7 A;  2NUP B;  1Z63 A;  4BJ6 A;  3TOM A;  5KYU A;  3MYI A;  1OW7 A;  2L9J A;  3DM9 B;  3FXH A;  1T6Q A;  2YLG A;  1NG1 A;  1MMD A;  1UFB A;  4ULW A;  3EG9 B;  4Q5S F;  4PFP A;  3K6B A;  4E7S A;  5JVE A;  3AG2 C;  3RVZ A;  3NDB B;  1GS9 A;  3RYL A;  1VMA A;  3U8P A;  4N06 A;  1QZX A;  4NC3 A;  3TJ6 A;  2HSB A;  2LSE A;  1J8M F;  2KC3 A;  2Q9A A;  1WAS A;  4FX5 A;  3DMD A;  3K7D A;  4LLC A;  4N6C A;  4U9E A;  3SP1 A;  4JE9 A;  2IOQ A;  2R7R A;  2Q9B A;  1D0X A;  4XPY A;  2NSF A;  1N1C A;  4MTF A;  3ATP A;  2XRH A;  3IPM O;  5A6B D;  3I5P A;  2EPL X;  3F47 A;  4XEV A;  4IAQ A;  3FHD A;  3W4Y A;  5L0D A;  1ZHY A;  4H54 A;  2XLE A;  4OD5 A;  2IXO A;  5L0F A;  3IQ5 A;  2Y3B A;  1LI5 A;  2J9V A;  4U5H A;  3RVY A;  3ZQV A;  3DXJ F;  1YA7 O;  2IYL D;  3RQE A;  5A69 A;  1VYK A;  2CDQ A;  3V5Y A;  4QI2 A;  4Z9J A;  4NCQ A;  2OEV A;  2IBF A;  1I4Y A;  4CDY A;  2A6H F;  2Q3T A;  2XSE A;  3DZA A;  2YRF A;  4WAB A;  2WL8 A;  3VM6 A;  4JKV A;  2OCC C;  4R32 A;  1TFO B;  1ZVZ A;  3JCU Q;  3MLG A;  5DLJ A;  2EIN C;  4D4N A;  3KH2 A;  2R7T A;  3R7C A;  2ICW G;  3SYN A;  3O55 A;  4OIP F;  2R7X A;  5COG A;  2HMQ A;  4G7O F;  3HNJ A;  1KTM A;  3H65 A;  4BJ1 A;  3EGX B;  4C7O A;  3ZTM A;  2WVO A;  4PJL A;  4OIR F;  5L3Q A;  1FMW A;  1RKC A;  2OJE D;  3GM2 A;  4NQF A;  1K04 A;  2LFD A;  3T6B A;  2CGE A;  2P7V A;  3WAQ A;  1JOG A;  5KYN A;  2J7P A;  3C8Z A;  4JVS A;  2H7B A;  2LIG A;  1BR4 A;  1PD0 A;  2PF4 E;  3SXY A;  2XLH A;  4IRU A;  3FDQ A;  1MMN A;  4LER A;  2JX0 A;  5DQT A;  1YDI A;  1EQ1 A;  1R4T A;  1UG7 A;  4XPW A;  5T1D B;  4CDA A;  5KYY A;  1V4A A;  1PD1 A;  3Q6M A;  4ZLD A;  4IGG A;  1ORS C;  4J7Y A;  4JCZ A;  1GGQ A;  2HV6 A;  2Y39 A;  2XXA A;  4YJW A;  1YZC A;  4C7O B;  3TUL A;  3I4U A;  5L0G A;  3ZQY A;  3ZG1 A;  2NPU A;  3JRT A;  3LEV A;  2R7U A;  1RMV A;  1Z5Z A;  2HJM A;  2G3V A;  3NYM A;  3C7J A;  2HFI A;  4JEA A;  4YL1 A;  1MND A;  1YLM A;  2MHR A;  2OJQ A;  2DGJ A;  3VF0 A;  4A2N B;  1OKK D;  2VCB A;  5KYY B;  4NTA A;  2QTV A;  2W9Y A;  2ZPA A;  3A11 A;  3Q7L A;  1OCO C;  3KMI A;  1U89 A;  2L7A A;  4CSA C;  4H4K C;  3C18 A;  4M63 A;  3RIP A;  4JTD B;  5L0H A;  3DWW A;  3U2L A;  5A6J A;  2J0W A;  2PNO A;  5JUA A;  5EK0 A;  4PJJ A;  4BPM A;  4LLE A;  3KYI A;  2E87 A;  1RCP A;  5COM A;  1SYQ A;  2HKV A;  3C62 A;  1G8X A;  1NU7 D;  3EHM A;  2Y3H A;  5F5H A;  1XWJ A;  3KL4 A;  3ZSU A;  3SEO A;  4K7B A;  1T5O A;  3ABK C;  4IAO A;  2L6F A;  3ZWI A;  4DBR A;  1ZW3 A;  2KK1 A;  2CW0 F;  3FMS A;  3K66 A;  3M4C A;  1NFN A;  4EBB A;  1M6T A;  1ZHX A;  3SZR A;  1VB5 A;  3UR3 C;  2X51 A;  5KYW B;  2JPU A;  4ER9 A;  2LP4 A;  4G0H A;  4XEK A;  1FFT C;  3X2Q C;  4O6M A;  1WOL A;  5JT4 A;  2GDC A;  3EQL F;  4DRI B;  4ZLC A;  5EGY A;  1RJ9 A;  5L0C A;  3CEX A;  1FTS A;  5D91 A;  1TR2 A;  5FCL A;  1LIH A;  4PR9 A;  2A69 F;  2H8A A;  3IQT A;  2YLI A;  2MYS A;  3JSZ A;  2Z15 A;  1ZZP A;  4I3M A;  5L3V A;  3ZIB A;  1K05 A;  4JUR I;  3GOD A;  3FAP B;  4JJG A;  4RD9 A;  1Q0F A;  4KC9 A;  1LE2 A;  2VC9 A;  1E83 A;  3T6J A;  1GM5 A;  5B1B C;  2W4B A;  1W2W A;  3OEO A;  4MVQ A;  4U5E E;  5T3T A;  3HNK A;  4MVM A;  3IQC A;  3EGD B;  2Q7R A;  2Q9C A;  2R25 A;  2XS8 A;  1ST6 A;  1TKN A;  2QY9 A;  4BJ5 A;  4F4B A;  3W8H A;  4C3D A;  1LPE A;  3X1O A;  1FNT c;  1OCZ C;  3GEE A;  4E7Z A;  2HZ8 A;  1JRA A;  2HSQ A;  2J46 A;  1ZHW A;  2J45 A;  3C8G D;  4HEA J;  1HMO A;  1QSP A;  3AG1 C;  1C02 A;  3GWL A;  5JS5 A;  4KI2 A;  2IXN A;  4MW8 A;  1U0B B;  1C17 M;  2ASR A;  2YL3 A;  5DQZ A;  3LNM B;  1F1M A;  3ECS A;  3B0V C;  2PX3 A;  2CNW D;  2GAQ A;  3B9Q A;  2R7O A;  3UNG C;  1WWP A;  2NG1 A;  3QVY A;  5COF A;  5BQG A;  4CS7 A;  1NSG B;  3DAG A;  4MTO A;  1VTM P;  1GQA A;  4FES A;  5E2Q A;  5KYU B;  2PBE A;  4CS8 A;  3UGO A;  2J9W A;  4U5D E;  4DRJ B;  4EBJ A;  3CAX A;  5HSW A;  3G4Z A;  3DD7 A;  1Q0D A;  4JC7 A;  3IQ6 A;  1CGN A;  4DVZ A;  1QVX A;  3QW1 A;  4EWC A;  3AQB A;  3EFO A;  2CNW A;  4CJO A;  4K0D A;  2VCC A;  4OIN F;  5K0I A;  1M2V A;  3GOR A;  3U3F A;  2H7V C;  4YL0 A;  1BR2 A;  1Q0M A;  5A6B A;  3EHN A;  2KYH A;  3NG1 A;  1U6H A;  2EIJ C;  1VLT A;  1QKR A;  4CJG A;  5IY5 C;  1A41 A;  2A1D D;  5L0J A;  1CGM E;  1R5I D;  1S7Z A;  4YK5 A;  5B1A C;  2BL2 A;  5E3A A;  3SXK A;  2QNL A;  4YL3 A;  3HJC A;  3QZC A;  4N4W A;  1Y6D A;  1H9G A;  2X0C A;  1QLE C;  3ZVR A;  3AOU A;  2AU5 A;  2I8B A;  3EFO B;  2YZS A;  1OW8 A;  2PX0 A;  3DKA A;  3O10 A;  1I5N A;  3AG4 C;  2UUH A;  3V5Z A;  1IW7 F;  4XTK A;  4DVY P;  2BC5 A;  3Q7G A;  1H7I A;  1T6I A;  2IXM A;  2A0U A;  2FFH A;  2P6V A;  3U2M A;  1JAF A;  3W2W A;  2EPO A;  2Y69 C;  4DXW A;  2YHS A;  3LES A;  1IZM A;  1T9K A;  1AEP A;  1JPN A;  5JRA A;  1RXQ A;  4YT5 A;  3AQC A;  4NY3 A;  3G50 A;  3JT1 A;  2AP3 A;  4K1O A;  5T3W A;  5KYX A;  2OG2 A;  1TWH A;  2YL0 A;  2ZXO A;  1JPJ A;  2GWW A;  2XM4 A;  1YVI A;  4JW1 A;  3SXZ A;  5L0I A;  2LK4 A;  2VAS A;  3AJM A;  2RD9 A;  4QI0 A;  1WN0 A;  1OXB A;  3QMK A;  4I1M A;  4BEM J;  3S90 A;  2I15 A;  1KNY A;  2C03 A;  1YA9 A;  2A6E F;  3CZ6 A;  1K40 A;  4IB4 A;  3NYL A;  2HUJ A;  1B68 A;  5D92 A;  4L6R A;  4CS9 A;  5DS5 A;  3LNR A;  2KW3 C;  1NFO A;  2XLO A;  3DAF A;  3GEH A;  4UDV A;  2VCA A;  1LKX A;  2LCH A;  5AC4 A;  4U5B E;  1VYI A;  5KYX B;  2Y3G A;  3B0U X;  3N2Z B;  3QW0 A;  4X0R A;  3A9C A;  2J9U A;  2XXA B;  3LS1 A;  4NTF A;  3ASN C;  3O6X A;  1MQV A;  1YYJ A;  3NMJ A;  3U9M A;  4OD4 A;  2R7S A;  2GA0 A;  4PAC A;  1JMW A;  2G62 A;  1Z23 A;  1OKK A;  2J0X A;  4XPX A;  1LS4 A;  3N24 A;  4DBQ A;  1CPQ A;  1OR2 A;  3KPH A;  4NTB A;  4QDL A;  3T4R A;  3RFY A;  1FR0 A;  2ZXR A;  3SXM A;  2B0H A;  3FOP A;  1YAU O;  1J8Y F;  3UMK A;  4CIP A;  1SF8 A;  1ZU4 A;  4XLN F;  1BZ4 A;  3IEE A;  2WB7 A;  3CQZ A;  1FMV A;  1C03 A;  3E9V A;  3TQO A;  1TFK B;  5E3C A;  4E17 A;  2R7W A;  1YZA A;  4JTC B;  4G7H F;  1MMG A;  3K1H A;  3M1C B;  3OWT A;  3S0X A;  2WZL A;  1Y4C A;  4MND A;  2EIK C;  1ZHZ A;  2XL6 A;  1WGW A;  4BJ6 C;  4BJ5 C;  1NU9 C;  1E2X A;  4HFK B;  4O79 A;  5JLI A;  1T6U A;  4C3B A;  1SZI A;  1DOW A;  1SR2 A;  4EUK B;  4OIO F;  3L0I A;  2EPM X;  3AGU A;  3T6G B;  4BEJ A;  2R9R B;  3U9J A;  4U5G A;  4EHP A;  2MWQ A;  2IXP A;  2YVK A;  1L3P A;  4CBE A;  4G7Z F;  5CI9 A;  4KNV A;  3LLI A;  1D0Z A;  1V54 C;  3L8J A;  3WOD F;  3AG3 C;  2HS5 A;  5TJ5 E;  1HW2 A;  1BBH A;  2LQG A;  4I44 A;  2M4E A;  4J7T A;  1E86 A;  2KGO A;  1M56 C;  3RH3 A;  3W2V A;  4EIY A;  3L34 A;  1V55 C;  4AX2 A;  4B6I A;  4CS8 C;  5CIV A;  3U3B A;  1NBB A;  1ZU5 A;  4KBL A;  5HV9 A;  1G5Z A;  4IAR A;  4LAC B;  4MVR A;  2ZD9 A;  4AL1 A;  2YLD A;  3H2U A;  2WZF A;  2NUT A;  1AVO B;  3RQG A;  4AL0 A;  2J9B A;  4GQH A;  3S9O A;  1RJ9 B;  2WZG A;  4ANJ A;  2OQM A;  5CI8 A;  5BQH A;  1LM3 B;  4WGZ A;  5BUO A;  4P9F A; 
#chains in the Genus database with same CATH homology
 4XPW A;  3AGU A;  1HMO A;  1HMD A;  2AWY A;  3WHN A;  4XPX A;  2AVK A;  2HMQ A;  4XPY A;  4XQ1 A;  2MHR A;  2AWC A;  1A7D A;  3WAQ A;  1I4Z A;  1A7E A;  3AGT A;  2HMZ A;  1I4Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...