2AWYA

Met-dcrh-hr
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
133
structure length
133
Chain Sequence
b'DVLVKWSEDLANLPSIDTQHKRLVDYINDLYRAARRRDMDKAREVFDALKNYAVEHFGYEERLFADYAYPEATRHKEIHRRFVETVLKWEKQLAAGDPEVVMTTLRGLVDWLVNHIMKEDKKYEAYLRERGVS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hemerythrin-like domain protein DcrH
publication title Structural Basis for O(2) Sensing by the Hemerythrin-like Domain of a Bacterial Chemotaxis Protein: Substrate Tunnel and Fluxional N Terminus
pubmed doi rcsb
source organism Desulfovibrio vulgaris
molecule tags Oxygen storage/transport
total genus 59
structure length 133
sequence length 133
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01814 Hemerythrin Hemerythrin HHE cation binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.50 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Hemerythrin-like 2awyA00
2AWCA 2AVKA 1HMOA 3WHNA 3WAQA 2AWYA 2HMZA 1A7DA 4XPWA 1A7EA 3AGTA 4XPYA 2HMQA 1HMDA 4XQ1A 1I4ZA 2MHRA 4XPXA 3AGUA 1I4YA
chains in the Genus database with same CATH superfamily
4GEHA 2XL6A 5KYWA 2YEVA 4O7GA 2AVKA 2UUIA 2LK4A 2VASA 4C3DA 3OWTA 4JIOA 4PK4A 4G7OF 3E9VA 4U9DA 1L7CA 2TMVP 1YJGA 3K1HA 2HMZA 4EWCA 2Q9BA 1WTYA 2L9JA 3DM5A 2GAQA 1B68A 3FMSA 1S7ZA 3Q7GA 1OCZC 4C7OB 1PV3A 2F22A 1EI7A 4FX5A 5B1AC 1PCXA 3S90A 1VYKA 1T6UA 2Q00A 1WATA 3DAFA 1CGME 3C8GB 1N1CA 4JE9A 1C03A 5E3AA 2EPMX 1BZ4A 1M2VA 1UG7A 2HV6A 4RBNA 2W4BA 3C7JA 4C3EA 3U9JA 1VTMP 3ABLC 4JKVA 3AQBA 3F47A 4AX2A 3Q6NA 1LI5A 1MMAA 1PD0A 3G4XA 3S9OA 5E3CA 2XLDA 1SMYF 2XLEA 3DWWA 1E85A 3LJBA 1G5ZA 1SYQA 4I1MA 3WAQA 4DVZA 3S84A 3CSKA 1BDJB 1V4AA 3FAPB 4KBLA 3ZDLA 3EH1A 1MQVA 4IWBA 2A69F 4PACA 2R9RB 2VB6A 1LM3B 1OCCC 3W8IA 2XRHA 3MYIA 1A41A 3DE8A 1G4WR 4ULVA 3FOOA 3ZC4A 2FGYA 1C17M 2KGOA 2VCAA 1C02A 3AGTA 1TKNA 5KYYA 2R7WA 5L3VA 3T6BA 2R25A 3VYWA 3ABKC 3J06A 5JLIA 3ZG1A 3GEHA 1D0YA 3JSEO 3JYYA 1YYXA 2O9XA 4MTGA 2XXAA 5TJ5E 3SP1A 3MLGA 3L34A 1OKKD 4MW3A 3M4CA 2OJQA 2G3VA 3QW0A 4XPXA 4JW1A 2V26A 4DRHB 4OIPF 3CEXA 3U8PA 3OEOA 1OCRC 1VLTA 4K0DA 2W9YA 2NUPB 2QNLA 4JZAA 5L0JA 2XLMA 1HW2A 3N24A 3H65A 4ER9A 3IHUA 2R03A 3K6BA 3S29A 2DB4A 2OG2A 4XPWA 1O3UA 3HNIA 4J30B 3KYIA 3GWLA 3L1MA 4N4WA 2XLVA 1VK5A 2XM4A 4GYTA 4I44A 4IARA 1E86A 3TJ5A 2P0NA 2A6EF 1ZU4A 3PHF2 5GPGB 3JSZA 1QVXA 2QTVA 3NRHA 1Z3IX 2PP4A 4AE4A 1VMAA 5L3QA 3QVYA 4WGYA 2R7TA 4J7YA 4LDRA 1RCPA 2OOCA 2W4MA 4OD5A 1ST6A 3ECSA 3HNJA 2VH3A 3T4RA 3T9OA 2YL7A 2NSFA 2KNHA 4IGGA 2XLOA 3QTHA 1FFHA 3DKAA 1YLMA 2EPLX 2QE9A 1NG1A 2Y3BA 2HJMA 2Q9CA 2PX3A 3AQCA 3NMJA 4EKWA 1FR0A 1W2WA 3H2UA 1NLXA 3IPMO 1APCA 2CDQA 1HY5A 4PJNA 1D1AA 4FESA 2NUTA 1VYIA 4I1OB 4JURI 2YKZA 4MVQA 4W8KA 3FHDA 2LFFA 3EGXB 2L6HA 4NQFA 2Q4FA 4Q7CA 3TK0A 4QI2A 1NU7D 2G62A 2R7RA 5T3WA 1IW7F 4D4XA 3MYFA 2L81A 4W8PA 3MFNA 2D4UA 1V74B 2H8AA 2E87A 2LCHA 2YRFA 3DZAA 4P9FA 5T3TA 2J8WA 4BJ5C 4U5GA 3A11A 3DXJF 2UUHA 1J8MF 1XZQA 1QSPA 2CW0F 1T5OA 2BE5F 3KKBA 4XLNF 4G7ZF 1U89A 2AWCA 3KL4A 5DS4A 4EIYA 1HMOA 2GWWA 1LS4A 3GODA 3EFOB 4BJ5A 2J0XA 2X51A 1T6IA 2LQGA 4JTDB 2ASRA 4LDQA 4CS7A 2OEVA 1SR2A 1FAPB 3R2PA 4E17A 1R4TA 5EHHA 5EGYA 2GA0A 2QY9A 1JMWA 3EPVA 2FAPB 2XS8A 4YK5A 3SNHA 3NYLA 2DGJA 2YLIA 3LAYA 3POVA 5JS5A 3EGDB 1AEPA 3GM2A 5COGA 3B9QA 3EHNA 5L0CA 2OEXA 2BC5A 3T6JA 1NSGB 1JPNA 5KYUA 1H9TA 1E83A 1TWHA 2KC3A 4OINF 2J45A 5HSWA 1G4US 4DBRA 2CCYA 1YVIA 256BA 1TWGA 5B1BC 3Q6MA 2LSEA 1RKEB 4BEMJ 3FAJA 2PF4E 3LNMB 4P9TA 4E7SA 3GM3A 1PD1A 2IXNA 4XEVA 4YN0B 1A7DA 4MVOA 5KYXB 1WWPA 3TOMA 1M2OA 3KYJA 2ZXOA 3I5QA 1ZHTA 4MS2A 5F5HA 4IAQA 2WZLA 3C8GA 3O39A 4MVMA 2OQMA 5A6BA 1SF8A 1RJ9B 1S05A 2KW3C 1R5ID 1YYJA 3LS0A 2WVOA 1L3PA 2EPOA 3GANA 1NFNA 3IQCA 2WVNA 3CZ6A 1GS9A 3DD7A 4NY3A 1CGOA 3VF0A 2ZXRA 3U9MA 4MQ9F 1HMDA 2V3CC 2D5RB 2MHRA 2YLGA 3W4YA 5AC4A 3ZVRA 4PJJA 2C04A 4XEKA 4IRUA 3U8VA 2A0UA 2RSEB 2W45A 2IXOA 3M15A 5KYWB 4QI0A 5BQGA 1A7VA 3X1OA 4CSAC 3UMKA 1LVKA 2EIJC 2M64A 1YA7O 3L8IA 4DRJB 4BJTA 4OIQF 1AVOB 4O6YA 1HE9A 2IYLD 1K40A 5JVEA 3C62A 2YVKA 4O6NA 3SXZA 3KMIA 3UR3C 4XPYA 4CSAA 3CQZA 1OR2A 2R02A 3ZIBA 4HFFB 3ZTZA 5B3SC 3FVYA 5DS6A 4E7ZA 2HMQA 2KSFA 4NTAA 4EBJA 1TFOB 3LS1A 1M2VB 2HFIA 2LIGA 4JEBA 3NYJA 5A6AA 5IY5C 2HSBA 5HV9A 5K0IA 2XS1A 1I5NA 2G3KA 3AG4C 4P6IC 2Q9AA 5D92A 4CDVA 5F5FA 5AC5A 2MYSA 3RIPA 1ZVZA 1FNTc 1BR4A 2VC9A 2OJED 4O79A 4FWVA 4U9EA 1Z6AA 3K66A 4JJFA 5FCLA 1OW7A 3NDBB 4XWJA 5T1DB 2Q7RA 4J32B 2KQ9A 1V55C 3S28A 1FFTC 4MVRA 3S27A 1EKYA 1E2XA 3N0TA 1T01A 2YWAA 3RH3A 2WVQA 1LIHA 2IXMA 3HTKC 1YZAA 2Z15A 4NTFA 1ZHZA 3C8GD 3SZRA 4G0HA 5E33A 5A6BD 5CI9A 1OCOC 2XM0A 2PNOA 2BL2A 2XXAB 2H7OA 1QZXA 3SYNA 1NBBA 1GM5A 1XZPA 2VCBA 1WASA 3UNGC 1TFKB 4LERA 3WHNA 3ASNC 3RW0A 3G4ZA 2JD3A 3BRJA 4YT5A 1OXKA 3LLKA 4I3MA 2A0BA 1FMWA 4LACB 2QLAA 1BR2A 1Q0DA 5DS5A 4CIHA 2R7SA 4O6MA 1ZZPA 3AG3C 3V5YA 2KK1A 2WB7A 3E70C 4PFOA 5DQZA 4F4BA 5BQHA 4CS8C 2I15A 1DOVA 3O10A 5COMA 1ZYRF 4ZLDA 2A6HF 3KPHA 4N6HA 4JTAB 2ZD9A 3M1CB 3RKOF 2EIMC 3US6A 2CYDA 1G8XA 2JPUA 5BQIA 2R7OA 3IQTA 2PBEA 5COFA 4XQ1A 1Q0KA 2Y39A 1QKRA 3UMIA 1MMNA 2WZFA 3AG2C 3AGUA 3ATPA 4JRZA 4CS8A 4XTKA 3W2VA 1YARO 3DE9A 3HJCA 1ZW2A 3TULA 3C18A 3OA1A 4ULWA 5L0DA 4DXWA 2HKVA 4JVSA 3K33A 5L0IA 3DAGA 5L0GA 3AJMA 1CGNA 4AL1A 3WODF 4PR9A 4E18A 3SXKA 3BEHA 3SXYA 1Z7Qc 3B0VC 4E0IA 1YA9A 4KNVA 4EBBA 4BJ6C 4ONSA 4NTBA 1ZW3A 2J7PA 2XLHA 1TWAA 4UDVA 1TWCA 2H7BA 1OW6A 5KYNA 2J46A 3JRMO 3IEEA 3GEEA 4WGZA 1ZHWA 1QLEC 3DJNB 3RFYA 3O55A 1U0BB 1V54C 4MVUA 3RYLA 2IBFA 3ZTMA 1HE1A 3CAXA 1CPRA 1RKCA 4JTCB 1ORJA 4BJ6A 3N2ZB 4PFPA 1MMGA 3EJNA 3EG9A 3V7OA 4AK9A 4Q5SF 1U6HA 3AG1C 2ZXPA 3K7DA 1OR3A 4HFKB 4JEAA 1LKXA 4MTOA 4WABA 2VCCA 3FOPA 3FXHA 2YL1A 1H9GA 3RQFA 2A68F 2NPUA 3G50A 1Z23A 1KNYA 1QQ3A 4CJOA 4U5HA 2YL0A 5JRAA 4MVZA 3NYMA 4BG0A 5L0HA 4NCQA 2ICWG 4EBKA 4C7OA 3NKDA 1OXBA 1KU2A 4MNDA 1ZHYA 2R7UA 2Y69C 3B29A 5JP7A 4MVSA 2KJGA 1RXQA 3C63A 4AL0A 3U3FA 4LLEA 1A0BA 4EHPA 2XSEA 1VLSA 2ZPAA 4C3BA 3IQ6A 3FDQA 3ITFA 1Q0FA 3DMDA 3L8JA 3KH2A 4G78A 5L0FA 3QZCA 4OIOF 3R7CA 3K1IC 4BPMA 5KYUB 3MBGA 1GQAA 2EINC 2HS5A 2KYHA 2PX0A 2H7VC 1I4YA 3DM9B 4JCHA 5D91A 3VAYA 4U5CE 3EHMA 2DYSC 1WGWA 1Z63A 1XWJA 4XEFA 3EH2A 2R7QA 1JR8A 2OKUA 3K1IA 5FZTA 4OD4A 1D0XA 1TQGA 3V5XA 1JAFA 1K05A 2GDCA 1Q0GA 4U5EE 5A6JA 3T6GB 2M4EA 5A6KA 3HKKA 4LDKA 5JSLA 2L7AA 4FAPB 1K04A 4CBEA 1HW1A 3NKEA 2LP4A 2MWQA 4J7TA 4PJLA 3DI5A 3A9CA 3I4UA 3TOLA 2R7XA 2Q3TA 1BR1A 5F28E 5CIVA 3W2WA 2J9BA 3ZWIA 4WJ0A 1ORSC 2HSQA 2NSGA 4QDLA 5CI8A 4HE8D 2J7PD 1J8YF 4L6RA 4CDYA 2GFHA 2HZ8A 3C8ZA 2L6GA 4MTFA 2ETSA 1I4ZA 2OCCC 3EZIA 4HEAJ 4R32A 1D1BA 3ZQYA 2NG1A 3ASOC 3NMKA 2NUPA 4M63A 4CX9A 2Y3GA 1VB5A 3GORA 3LEOA 4YT2A 2AP3A 2OU6A 1FTSA 2YLDA 3H2VA 1MMDA 4JC7A 3EQLF 1O87A 3NMIA 1EA8A 1T9KA 4Q4ZF 3PMRA 4X0RA 1ZHXA 2XL4A 1IZMA 4CDAA 4D4NA 1EQ1A 5E2QA 2CNWA 1CPQA 3LLIA 3B0PA 4N6CA 1LS1A 4A4AA 1H7IA 1AUEA 1JPJA 2P7VA 1MNEA 3JZ0A 1LPEA 2EPKX 2P61A 3ZQVA 1M56C 3UMHA 5A69A 4B6IA 2CGEA 2DYRC 3GWNA 4GQHA 2PFDA 2P6VA 5KYYB 4U5DE 3TD7A 4RD9A 2LFDA 3LUTB 3U5SA 2YHSA 2EILC 2AU5A 3SEOA 4CIPA 3UGOA 5EK0A 1FMVA 3LNRA 2YQYA 2IXPA 2Y3HA 2A1DD 3X2QC 1GGQA 5B3IA 1E84A 3EGXA 2AWYA 1NZEA 3F46A 1MNDA 3M79A 2B0JA 3RQGA 1Q0MA 1NU9C 3LEVA 4LLCA 3HLZA 5DQTA 2P1AA 1WN0A 3JRTA 5JUAA 3L0IA 3VM6A 2ZXWC 4N06A 1KTMA 1M57C 4K1OA 5DVWA 4NC3A 1A7EA 3WG7C 1OW8A 1M6TA 2FFHA 3JTLO 4AE4B 3DJUB 1ZU5A 4YT4A 3LESA 2XL8A 2EPNA 5DLJA 2B0HA 4YL0A 3M4BA 4RDAA 2HJ3A 1ORYA 4Z9IA 1DOWA 3EFOA 3VRCA 1YAUO 2WZGA 4BEJA 4YWQA 3V5ZA 3SXMA 3U3BA 1Y4CA 2LD6A 4DBQA 3O6XA 2HV7A 4XLPF 4MW8A 3QW1A 1JRAA 4YL3A 2L6FA 3GM1A 4CS9C 3EZHA 2NUTB 4EUKB 3RQEA 2HUJA 2IOQA 3EGDA 4KC9A 1RMVA 3PCVA 3AOUA 4DJ9A 2QUPA 4ANJA 2J0WA 3TJ6A 1NFOA 4DVYP 1SZIA 3PDMP 3GEIA 4CJGA 4H54A 4CS9A 4DOZA 2YL3A 2CNWD 3U2MA 3RVYA 4YJWA 5BUOA 1LE4A 1T6QA 4IAOA 4IB4A 1RKEA 4BJ1A 1TR2A 4YT8A 4Z9HA 4G7HF 2DI3A 4KI2A 2IM8A 1OQCA 4U5BE 3HNKA 1F1MA 3JCUQ 4H4KC 4ZLCA 5KYXA 1D0ZA 5AGFA 2J9WA 1BBHA 4Z9JA 2R7VA 1LI7A 4PJMA 3JYHA 4U5FE 1JOGA 1H6GA 2EIKC 2J9VA 1WOLA 1YDIA 4E0HA 1YZCA 1LE2A 1D1CA 1RJ9A 3W8HA 2I8BA 2R05A 1UFBA 4IJJA 2J9UA 3B71A 3U2LA 2C03A 3RVZA 3U0CA 3MX3A 2Y3DA 3JT1A 4DRIB 1OKKA 3QMKA 1VOMA 3Q7LA 4JJGA 1QPUA 4KNWA 4OIRF 2WL8A 3TQOA 3ZSUA 4A2NB 2X0CA 5JT4A 3QVZA 1Z5ZA 3NG1A 1Y6DA 2JX0A 3HNLA 4JCZA 3I5PA 3B0UX 2XLWA 3UGPA 4YL1A 1O5HA 2RD9A 3ABMC 4K7BA 3RF3A 2YZSA 3EG9B 3IQ5A 3S0XA
chains in the Genus database with same CATH topology
2AWCA 2AVKA 1HMOA 3WHNA 3WAQA 2AWYA 2HMZA 1A7DA 4XPWA 1A7EA 3AGTA 4XPYA 2HMQA 1HMDA 4XQ1A 1I4ZA 2MHRA 4XPXA 3AGUA 1I4YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AWC A;  2AVK A;  1HMO A;  3WHN A;  3WAQ A;  2AWY A;  2HMZ A;  1A7D A;  4XPW A;  1A7E A;  3AGT A;  4XPY A;  2HMQ A;  1HMD A;  4XQ1 A;  1I4Z A;  2MHR A;  4XPX A;  3AGU A;  1I4Y A; 
#chains in the Genus database with same CATH topology
 4GEH A;  2XL6 A;  5KYW A;  2YEV A;  4O7G A;  2AVK A;  2UUI A;  2LK4 A;  2VAS A;  4C3D A;  3OWT A;  4JIO A;  4PK4 A;  4G7O F;  3E9V A;  4U9D A;  1L7C A;  2TMV P;  1YJG A;  3K1H A;  2HMZ A;  4EWC A;  2Q9B A;  1WTY A;  2L9J A;  3DM5 A;  2GAQ A;  1B68 A;  3FMS A;  1S7Z A;  3Q7G A;  1OCZ C;  4C7O B;  1PV3 A;  2F22 A;  1EI7 A;  4FX5 A;  5B1A C;  1PCX A;  3S90 A;  1VYK A;  1T6U A;  2Q00 A;  1WAT A;  3DAF A;  1CGM E;  3C8G B;  1N1C A;  4JE9 A;  1C03 A;  5E3A A;  2EPM X;  1BZ4 A;  1M2V A;  1UG7 A;  2HV6 A;  4RBN A;  2W4B A;  3C7J A;  4C3E A;  3U9J A;  1VTM P;  3ABL C;  4JKV A;  3AQB A;  3F47 A;  4AX2 A;  3Q6N A;  1LI5 A;  1MMA A;  1PD0 A;  3G4X A;  3S9O A;  5E3C A;  2XLD A;  1SMY F;  2XLE A;  3DWW A;  1E85 A;  3LJB A;  1G5Z A;  1SYQ A;  4I1M A;  3WAQ A;  4DVZ A;  3S84 A;  3CSK A;  1BDJ B;  1V4A A;  3FAP B;  4KBL A;  3ZDL A;  3EH1 A;  1MQV A;  4IWB A;  2A69 F;  4PAC A;  2R9R B;  2VB6 A;  1LM3 B;  1OCC C;  3W8I A;  2XRH A;  3MYI A;  1A41 A;  3DE8 A;  1G4W R;  4ULV A;  3FOO A;  3ZC4 A;  2FGY A;  1C17 M;  2KGO A;  2VCA A;  1C02 A;  3AGT A;  1TKN A;  5KYY A;  2R7W A;  5L3V A;  3T6B A;  2R25 A;  3VYW A;  3ABK C;  3J06 A;  5JLI A;  3ZG1 A;  3GEH A;  1D0Y A;  3JSE O;  3JYY A;  1YYX A;  2O9X A;  4MTG A;  2XXA A;  5TJ5 E;  3SP1 A;  3MLG A;  3L34 A;  1OKK D;  4MW3 A;  3M4C A;  2OJQ A;  2G3V A;  3QW0 A;  4XPX A;  4JW1 A;  2V26 A;  4DRH B;  4OIP F;  3CEX A;  3U8P A;  3OEO A;  1OCR C;  1VLT A;  4K0D A;  2W9Y A;  2NUP B;  2QNL A;  4JZA A;  5L0J A;  2XLM A;  1HW2 A;  3N24 A;  3H65 A;  4ER9 A;  3IHU A;  2R03 A;  3K6B A;  3S29 A;  2DB4 A;  2OG2 A;  4XPW A;  1O3U A;  3HNI A;  4J30 B;  3KYI A;  3GWL A;  3L1M A;  4N4W A;  2XLV A;  1VK5 A;  2XM4 A;  4GYT A;  4I44 A;  4IAR A;  1E86 A;  3TJ5 A;  2P0N A;  2A6E F;  1ZU4 A;  3PHF 2;  5GPG B;  3JSZ A;  1QVX A;  2QTV A;  3NRH A;  1Z3I X;  2PP4 A;  4AE4 A;  1VMA A;  5L3Q A;  3QVY A;  4WGY A;  2R7T A;  4J7Y A;  4LDR A;  1RCP A;  2OOC A;  2W4M A;  4OD5 A;  1ST6 A;  3ECS A;  3HNJ A;  2VH3 A;  3T4R A;  3T9O A;  2YL7 A;  2NSF A;  2KNH A;  4IGG A;  2XLO A;  3QTH A;  1FFH A;  3DKA A;  1YLM A;  2EPL X;  2QE9 A;  1NG1 A;  2Y3B A;  2HJM A;  2Q9C A;  2PX3 A;  3AQC A;  3NMJ A;  4EKW A;  1FR0 A;  1W2W A;  3H2U A;  1NLX A;  3IPM O;  1APC A;  2CDQ A;  1HY5 A;  4PJN A;  1D1A A;  4FES A;  2NUT A;  1VYI A;  4I1O B;  4JUR I;  2YKZ A;  4MVQ A;  4W8K A;  3FHD A;  2LFF A;  3EGX B;  2L6H A;  4NQF A;  2Q4F A;  4Q7C A;  3TK0 A;  4QI2 A;  1NU7 D;  2G62 A;  2R7R A;  5T3W A;  1IW7 F;  4D4X A;  3MYF A;  2L81 A;  4W8P A;  3MFN A;  2D4U A;  1V74 B;  2H8A A;  2E87 A;  2LCH A;  2YRF A;  3DZA A;  4P9F A;  5T3T A;  2J8W A;  4BJ5 C;  4U5G A;  3A11 A;  3DXJ F;  2UUH A;  1J8M F;  1XZQ A;  1QSP A;  2CW0 F;  1T5O A;  2BE5 F;  3KKB A;  4XLN F;  4G7Z F;  1U89 A;  2AWC A;  3KL4 A;  5DS4 A;  4EIY A;  1HMO A;  2GWW A;  1LS4 A;  3GOD A;  3EFO B;  4BJ5 A;  2J0X A;  2X51 A;  1T6I A;  2LQG A;  4JTD B;  2ASR A;  4LDQ A;  4CS7 A;  2OEV A;  1SR2 A;  1FAP B;  3R2P A;  4E17 A;  1R4T A;  5EHH A;  5EGY A;  2GA0 A;  2QY9 A;  1JMW A;  3EPV A;  2FAP B;  2XS8 A;  4YK5 A;  3SNH A;  3NYL A;  2DGJ A;  2YLI A;  3LAY A;  3POV A;  5JS5 A;  3EGD B;  1AEP A;  3GM2 A;  5COG A;  3B9Q A;  3EHN A;  5L0C A;  2OEX A;  2BC5 A;  3T6J A;  1NSG B;  1JPN A;  5KYU A;  1H9T A;  1E83 A;  1TWH A;  2KC3 A;  4OIN F;  2J45 A;  5HSW A;  1G4U S;  4DBR A;  2CCY A;  1YVI A;  256B A;  1TWG A;  5B1B C;  3Q6M A;  2LSE A;  1RKE B;  4BEM J;  3FAJ A;  2PF4 E;  3LNM B;  4P9T A;  4E7S A;  3GM3 A;  1PD1 A;  2IXN A;  4XEV A;  4YN0 B;  1A7D A;  4MVO A;  5KYX B;  1WWP A;  3TOM A;  1M2O A;  3KYJ A;  2ZXO A;  3I5Q A;  1ZHT A;  4MS2 A;  5F5H A;  4IAQ A;  2WZL A;  3C8G A;  3O39 A;  4MVM A;  2OQM A;  5A6B A;  1SF8 A;  1RJ9 B;  1S05 A;  2KW3 C;  1R5I D;  1YYJ A;  3LS0 A;  2WVO A;  1L3P A;  2EPO A;  3GAN A;  1NFN A;  3IQC A;  2WVN A;  3CZ6 A;  1GS9 A;  3DD7 A;  4NY3 A;  1CGO A;  3VF0 A;  2ZXR A;  3U9M A;  4MQ9 F;  1HMD A;  2V3C C;  2D5R B;  2MHR A;  2YLG A;  3W4Y A;  5AC4 A;  3ZVR A;  4PJJ A;  2C04 A;  4XEK A;  4IRU A;  3U8V A;  2A0U A;  2RSE B;  2W45 A;  2IXO A;  3M15 A;  5KYW B;  4QI0 A;  5BQG A;  1A7V A;  3X1O A;  4CSA C;  3UMK A;  1LVK A;  2EIJ C;  2M64 A;  1YA7 O;  3L8I A;  4DRJ B;  4BJT A;  4OIQ F;  1AVO B;  4O6Y A;  1HE9 A;  2IYL D;  1K40 A;  5JVE A;  3C62 A;  2YVK A;  4O6N A;  3SXZ A;  3KMI A;  3UR3 C;  4XPY A;  4CSA A;  3CQZ A;  1OR2 A;  2R02 A;  3ZIB A;  4HFF B;  3ZTZ A;  5B3S C;  3FVY A;  5DS6 A;  4E7Z A;  2HMQ A;  2KSF A;  4NTA A;  4EBJ A;  1TFO B;  3LS1 A;  1M2V B;  2HFI A;  2LIG A;  4JEB A;  3NYJ A;  5A6A A;  5IY5 C;  2HSB A;  5HV9 A;  5K0I A;  2XS1 A;  1I5N A;  2G3K A;  3AG4 C;  4P6I C;  2Q9A A;  5D92 A;  4CDV A;  5F5F A;  5AC5 A;  2MYS A;  3RIP A;  1ZVZ A;  1FNT c;  1BR4 A;  2VC9 A;  2OJE D;  4O79 A;  4FWV A;  4U9E A;  1Z6A A;  3K66 A;  4JJF A;  5FCL A;  1OW7 A;  3NDB B;  4XWJ A;  5T1D B;  2Q7R A;  4J32 B;  2KQ9 A;  1V55 C;  3S28 A;  1FFT C;  4MVR A;  3S27 A;  1EKY A;  1E2X A;  3N0T A;  1T01 A;  2YWA A;  3RH3 A;  2WVQ A;  1LIH A;  2IXM A;  3HTK C;  1YZA A;  2Z15 A;  4NTF A;  1ZHZ A;  3C8G D;  3SZR A;  4G0H A;  5E33 A;  5A6B D;  5CI9 A;  1OCO C;  2XM0 A;  2PNO A;  2BL2 A;  2XXA B;  2H7O A;  1QZX A;  3SYN A;  1NBB A;  1GM5 A;  1XZP A;  2VCB A;  1WAS A;  3UNG C;  1TFK B;  4LER A;  3WHN A;  3ASN C;  3RW0 A;  3G4Z A;  2JD3 A;  3BRJ A;  4YT5 A;  1OXK A;  3LLK A;  4I3M A;  2A0B A;  1FMW A;  4LAC B;  2QLA A;  1BR2 A;  1Q0D A;  5DS5 A;  4CIH A;  2R7S A;  4O6M A;  1ZZP A;  3AG3 C;  3V5Y A;  2KK1 A;  2WB7 A;  3E70 C;  4PFO A;  5DQZ A;  4F4B A;  5BQH A;  4CS8 C;  2I15 A;  1DOV A;  3O10 A;  5COM A;  1ZYR F;  4ZLD A;  2A6H F;  3KPH A;  4N6H A;  4JTA B;  2ZD9 A;  3M1C B;  3RKO F;  2EIM C;  3US6 A;  2CYD A;  1G8X A;  2JPU A;  5BQI A;  2R7O A;  3IQT A;  2PBE A;  5COF A;  4XQ1 A;  1Q0K A;  2Y39 A;  1QKR A;  3UMI A;  1MMN A;  2WZF A;  3AG2 C;  3AGU A;  3ATP A;  4JRZ A;  4CS8 A;  4XTK A;  3W2V A;  1YAR O;  3DE9 A;  3HJC A;  1ZW2 A;  3TUL A;  3C18 A;  3OA1 A;  4ULW A;  5L0D A;  4DXW A;  2HKV A;  4JVS A;  3K33 A;  5L0I A;  3DAG A;  5L0G A;  3AJM A;  1CGN A;  4AL1 A;  3WOD F;  4PR9 A;  4E18 A;  3SXK A;  3BEH A;  3SXY A;  1Z7Q c;  3B0V C;  4E0I A;  1YA9 A;  4KNV A;  4EBB A;  4BJ6 C;  4ONS A;  4NTB A;  1ZW3 A;  2J7P A;  2XLH A;  1TWA A;  4UDV A;  1TWC A;  2H7B A;  1OW6 A;  5KYN A;  2J46 A;  3JRM O;  3IEE A;  3GEE A;  4WGZ A;  1ZHW A;  1QLE C;  3DJN B;  3RFY A;  3O55 A;  1U0B B;  1V54 C;  4MVU A;  3RYL A;  2IBF A;  3ZTM A;  1HE1 A;  3CAX A;  1CPR A;  1RKC A;  4JTC B;  1ORJ A;  4BJ6 A;  3N2Z B;  4PFP A;  1MMG A;  3EJN A;  3EG9 A;  3V7O A;  4AK9 A;  4Q5S F;  1U6H A;  3AG1 C;  2ZXP A;  3K7D A;  1OR3 A;  4HFK B;  4JEA A;  1LKX A;  4MTO A;  4WAB A;  2VCC A;  3FOP A;  3FXH A;  2YL1 A;  1H9G A;  3RQF A;  2A68 F;  2NPU A;  3G50 A;  1Z23 A;  1KNY A;  1QQ3 A;  4CJO A;  4U5H A;  2YL0 A;  5JRA A;  4MVZ A;  3NYM A;  4BG0 A;  5L0H A;  4NCQ A;  2ICW G;  4EBK A;  4C7O A;  3NKD A;  1OXB A;  1KU2 A;  4MND A;  1ZHY A;  2R7U A;  2Y69 C;  3B29 A;  5JP7 A;  4MVS A;  2KJG A;  1RXQ A;  3C63 A;  4AL0 A;  3U3F A;  4LLE A;  1A0B A;  4EHP A;  2XSE A;  1VLS A;  2ZPA A;  4C3B A;  3IQ6 A;  3FDQ A;  3ITF A;  1Q0F A;  3DMD A;  3L8J A;  3KH2 A;  4G78 A;  5L0F A;  3QZC A;  4OIO F;  3R7C A;  3K1I C;  4BPM A;  5KYU B;  3MBG A;  1GQA A;  2EIN C;  2HS5 A;  2KYH A;  2PX0 A;  2H7V C;  1I4Y A;  3DM9 B;  4JCH A;  5D91 A;  3VAY A;  4U5C E;  3EHM A;  2DYS C;  1WGW A;  1Z63 A;  1XWJ A;  4XEF A;  3EH2 A;  2R7Q A;  1JR8 A;  2OKU A;  3K1I A;  5FZT A;  4OD4 A;  1D0X A;  1TQG A;  3V5X A;  1JAF A;  1K05 A;  2GDC A;  1Q0G A;  4U5E E;  5A6J A;  3T6G B;  2M4E A;  5A6K A;  3HKK A;  4LDK A;  5JSL A;  2L7A A;  4FAP B;  1K04 A;  4CBE A;  1HW1 A;  3NKE A;  2LP4 A;  2MWQ A;  4J7T A;  4PJL A;  3DI5 A;  3A9C A;  3I4U A;  3TOL A;  2R7X A;  2Q3T A;  1BR1 A;  5F28 E;  5CIV A;  3W2W A;  2J9B A;  3ZWI A;  4WJ0 A;  1ORS C;  2HSQ A;  2NSG A;  4QDL A;  5CI8 A;  4HE8 D;  2J7P D;  1J8Y F;  4L6R A;  4CDY A;  2GFH A;  2HZ8 A;  3C8Z A;  2L6G A;  4MTF A;  2ETS A;  1I4Z A;  2OCC C;  3EZI A;  4HEA J;  4R32 A;  1D1B A;  3ZQY A;  2NG1 A;  3ASO C;  3NMK A;  2NUP A;  4M63 A;  4CX9 A;  2Y3G A;  1VB5 A;  3GOR A;  3LEO A;  4YT2 A;  2AP3 A;  2OU6 A;  1FTS A;  2YLD A;  3H2V A;  1MMD A;  4JC7 A;  3EQL F;  1O87 A;  3NMI A;  1EA8 A;  1T9K A;  4Q4Z F;  3PMR A;  4X0R A;  1ZHX A;  2XL4 A;  1IZM A;  4CDA A;  4D4N A;  1EQ1 A;  5E2Q A;  2CNW A;  1CPQ A;  3LLI A;  3B0P A;  4N6C A;  1LS1 A;  4A4A A;  1H7I A;  1AUE A;  1JPJ A;  2P7V A;  1MNE A;  3JZ0 A;  1LPE A;  2EPK X;  2P61 A;  3ZQV A;  1M56 C;  3UMH A;  5A69 A;  4B6I A;  2CGE A;  2DYR C;  3GWN A;  4GQH A;  2PFD A;  2P6V A;  5KYY B;  4U5D E;  3TD7 A;  4RD9 A;  2LFD A;  3LUT B;  3U5S A;  2YHS A;  2EIL C;  2AU5 A;  3SEO A;  4CIP A;  3UGO A;  5EK0 A;  1FMV A;  3LNR A;  2YQY A;  2IXP A;  2Y3H A;  2A1D D;  3X2Q C;  1GGQ A;  5B3I A;  1E84 A;  3EGX A;  2AWY A;  1NZE A;  3F46 A;  1MND A;  3M79 A;  2B0J A;  3RQG A;  1Q0M A;  1NU9 C;  3LEV A;  4LLC A;  3HLZ A;  5DQT A;  2P1A A;  1WN0 A;  3JRT A;  5JUA A;  3L0I A;  3VM6 A;  2ZXW C;  4N06 A;  1KTM A;  1M57 C;  4K1O A;  5DVW A;  4NC3 A;  1A7E A;  3WG7 C;  1OW8 A;  1M6T A;  2FFH A;  3JTL O;  4AE4 B;  3DJU B;  1ZU5 A;  4YT4 A;  3LES A;  2XL8 A;  2EPN A;  5DLJ A;  2B0H A;  4YL0 A;  3M4B A;  4RDA A;  2HJ3 A;  1ORY A;  4Z9I A;  1DOW A;  3EFO A;  3VRC A;  1YAU O;  2WZG A;  4BEJ A;  4YWQ A;  3V5Z A;  3SXM A;  3U3B A;  1Y4C A;  2LD6 A;  4DBQ A;  3O6X A;  2HV7 A;  4XLP F;  4MW8 A;  3QW1 A;  1JRA A;  4YL3 A;  2L6F A;  3GM1 A;  4CS9 C;  3EZH A;  2NUT B;  4EUK B;  3RQE A;  2HUJ A;  2IOQ A;  3EGD A;  4KC9 A;  1RMV A;  3PCV A;  3AOU A;  4DJ9 A;  2QUP A;  4ANJ A;  2J0W A;  3TJ6 A;  1NFO A;  4DVY P;  1SZI A;  3PDM P;  3GEI A;  4CJG A;  4H54 A;  4CS9 A;  4DOZ A;  2YL3 A;  2CNW D;  3U2M A;  3RVY A;  4YJW A;  5BUO A;  1LE4 A;  1T6Q A;  4IAO A;  4IB4 A;  1RKE A;  4BJ1 A;  1TR2 A;  4YT8 A;  4Z9H A;  4G7H F;  2DI3 A;  4KI2 A;  2IM8 A;  1OQC A;  4U5B E;  3HNK A;  1F1M A;  3JCU Q;  4H4K C;  4ZLC A;  5KYX A;  1D0Z A;  5AGF A;  2J9W A;  1BBH A;  4Z9J A;  2R7V A;  1LI7 A;  4PJM A;  3JYH A;  4U5F E;  1JOG A;  1H6G A;  2EIK C;  2J9V A;  1WOL A;  1YDI A;  4E0H A;  1YZC A;  1LE2 A;  1D1C A;  1RJ9 A;  3W8H A;  2I8B A;  2R05 A;  1UFB A;  4IJJ A;  2J9U A;  3B71 A;  3U2L A;  2C03 A;  3RVZ A;  3U0C A;  3MX3 A;  2Y3D A;  3JT1 A;  4DRI B;  1OKK A;  3QMK A;  1VOM A;  3Q7L A;  4JJG A;  1QPU A;  4KNW A;  4OIR F;  2WL8 A;  3TQO A;  3ZSU A;  4A2N B;  2X0C A;  5JT4 A;  3QVZ A;  1Z5Z A;  3NG1 A;  1Y6D A;  2JX0 A;  3HNL A;  4JCZ A;  3I5P A;  3B0U X;  2XLW A;  3UGP A;  4YL1 A;  1O5H A;  2RD9 A;  3ABM C;  4K7B A;  3RF3 A;  2YZS A;  3EG9 B;  3IQ5 A;  3S0X A; 
#chains in the Genus database with same CATH homology
 2AWC A;  2AVK A;  1HMO A;  3WHN A;  3WAQ A;  2AWY A;  2HMZ A;  1A7D A;  4XPW A;  1A7E A;  3AGT A;  4XPY A;  2HMQ A;  1HMD A;  4XQ1 A;  1I4Z A;  2MHR A;  4XPX A;  3AGU A;  1I4Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...