2AWYA

Met-dcrh-hr
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
133
structure length
133
Chain Sequence
DVLVKWSEDLANLPSIDTQHKRLVDYINDLYRAARRRDMDKAREVFDALKNYAVEHFGYEERLFADYAYPEATRHKEIHRRFVETVLKWEKQLAAGDPEVVMTTLRGLVDWLVNHIMKEDKKYEAYLRERGVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for O(2) Sensing by the Hemerythrin-like Domain of a Bacterial Chemotaxis Protein: Substrate Tunnel and Fluxional N Terminus
pubmed doi rcsb
source organism Desulfovibrio vulgaris
molecule tags Oxygen storage/transport
molecule keywords hemerythrin-like domain protein DcrH
total genus 59
structure length 133
sequence length 133
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01814 Hemerythrin Hemerythrin HHE cation binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.50 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Hemerythrin-like 2awyA00
4XPWA 1A7DA 2AWCA 2MHRA 3WHNA 1I4YA 3AGTA 4XPYA 4XQ1A 2AWYA 3WAQA 1HMDA 1I4ZA 4XPXA 2HMQA 3AGUA 1A7EA 1HMOA 2AVKA 2HMZA
chains in the Genus database with same CATH superfamily
2I15A 1TWAA 1QVXA 2L7AA 1M57C 3V5ZA 1H9TA 5KYYA 3E9VA 3S84A 4DBRA 2CNWD 1O5HA 2OCCC 3RIPA 5A6KA 3NYMA 2IXNA 1NU9C 4C3EA 1TWGA 1S7ZA 2CCYA 2ETSA 4K7BA 3DAGA 2EPLX 1KU2A 2NSFA 3O10A 2QTVA 3S29A 3ZQVA 4NCQA 4CSAC 1OW6A 1OCCC 2HFIA 1YLMA 3OEOA 5AC5A 1RJ9A 3LAYA 4N06A 1YZAA 3ZTMA 4HE8D 4E7SA 1YA7O 5B3SC 3IQCA 4KC9A 2BC5A 1PCXA 1CGME 3W4YA 3B0PA 5COMA 1D1CA 1T5OA 2VC9A 3HNKA 2DB4A 1Q0DA 1NZEA 3PDMP 2Y3GA 4G7HF 2YLGA 4YL3A 1RJ9B 2NPUA 2JD3A 2Y3BA 3JRTA 1Z63A 1R4TA 1XZPA 4RD9A 3TJ6A 2AWCA 5E3CA 1ZHXA 4P6IC 4YT5A 1EA8A 1JRAA 2LP4A 3EH2A 3SEOA 4I1MA 4CJGA 4JEBA 2IOQA 1O3UA 1VYIA 5L0FA 2XLMA 2PP4A 5L0DA 1JR8A 4EWCA 1VLTA 4W8KA 4KI2A 4H4KC 5JSLA 2WVOA 1YJGA 3V5XA 2ZXPA 4GQHA 1MNEA 4MVMA 1NU7D 2XLWA 4G0HA 4MS2A 4MQ9F 5L0HA 4WABA 3K1IA 4J30B 4LDRA 4YT2A 2P1AA 5T1DB 3JTLO 3WHNA 1OCRC 1K40A 1RXQA 2WVQA 3C8GB 1LVKA 3N2ZB 3DJUB 5E33A 3SP1A 2J0XA 1ST6A 3EGXB 3JT1A 5BQIA 4BJ6A 3N24A 4AK9A 1A0BA 2LFFA 3HNJA 3GANA 4NC3A 3HTKC 4NTBA 2VCCA 2IXMA 1OKKA 1QSPA 2Q3TA 1GGQA 1HE1A 2F22A 4L6RA 1VLSA 2G3VA 1SR2A 3QW1A 3SXYA 3VM6A 1GS9A 3GEIA 2DGJA 1I4YA 1N1CA 1ORJA 4U5HA 3DM5A 4BPMA 1ZYRF 3DJNB 3FXHA 2IXPA 3K6BA 4C7OB 1Z6AA 1TQGA 2AU5A 4K0DA 2L6HA 2XL8A 4JE9A 5F5HA 1APCA 3U3BA 3ZQYA 5B3IA 4IAQA 4XPXA 3EZHA 4OIPF 1LPEA 4DJ9A 3FAJA 4XPWA 3M15A 3FVYA 2J7PD 4QI0A 2PFDA 4OD4A 3PHF2 4YN0B 3UNGC 5DQTA 4ULVA 3M1CB 3U5SA 3L8IA 3TULA 1T6UA 3FAPB 1BR1A 2KGOA 3ABMC 2UUIA 2PNOA 1Z5ZA 3AG1C 4LLEA 1SYQA 2MWQA 3K33A 3NRHA 5T3WA 2WZFA 3F46A 3NG1A 1VK5A 2KSFA 2M4EA 3DAFA 3M79A 4MW8A 3RKOF 3TD7A 1Q0FA 1UFBA 4LDKA 3KYJA 4MVUA 3T6JA 4GEHA 1W2WA 3G4XA 4XEFA 1FR0A 3ZWIA 1MMDA 1VB5A 4KNWA 2XXAB 4XQ1A 5DS6A 1DOVA 3F47A 1M56C 5L0IA 3AGUA 1H6GA 1Z3IX 3U8VA 1ORYA 2AVKA 4NY3A 4KBLA 1YYJA 3JRMO 4AL0A 2GAQA 3M4CA 1U6HA 2J9BA 3A11A 4E0IA 3VF0A 2XLHA 3H65A 3QMKA 3IQ6A 1ZHWA 2EIJC 1G4US 3DD7A 3DZAA 2XM0A 4LLCA 4YT4A 2GFHA 2A0BA 3ZG1A 4YK5A 3KMIA 1HW1A 2Q7RA 4DXWA 3IEEA 3LUTB 1G8XA 3ZIBA 3L1MA 1C03A 1OXBA 3Q7LA 3T6GB 3ASOC 1OR2A 2O9XA 4CS9C 4PJNA 4O6MA 2DYRC 5DVWA 1LE4A 4PJJA 3T4RA 4UDVA 3CEXA 2L81A 3C18A 4GYTA 3QVZA 3FDQA 1PD1A 4JURI 2NSGA 4BJTA 1FMWA 3B71A 3O55A 5E2QA 4RBNA 3B0UX 2LQGA 5IY5C 4W8PA 2DYSC 4WGYA 4U5GA 4XEKA 3U9MA 2EINC 4IWBA 1PD0A 3NMJA 1QQ3A 2H8AA 4P9TA 4PR9A 4CIHA 4ONSA 3LJBA 4WGZA 2EIMC 2HJMA 5L3VA 3R7CA 4WJ0A 1FFTC 1ZW3A 2VCAA 3G50A 1D0YA 1YAUO 3MX3A 4MVZA 4YWQA 1OW8A 3EQLF 2G3KA 3KYIA 5D91A 3U0CA 1BR2A 2Q00A 1NG1A 2AP3A 1V55C 2Q9AA 3B29A 3AQCA 2OOCA 3I5QA 3O39A 4HFFB 1AEPA 4Z9JA 3U2LA 4BG0A 4CX9A 2J45A 4E18A 1ZW2A 2A6EF 1FAPB 3POVA 4MVRA 1D0ZA 3EFOA 3X1OA 1NSGB 5A6JA 4QI2A 2LCHA 1NFOA 4MTGA 4U5FE 2QY9A 2P7VA 3L34A 1FTSA 2GA0A 2HZ8A 1Y4CA 3DKAA 3WODF 4EBBA 2CGEA 3TK0A 2L6FA 2Y69C 2V26A 2IBFA 2R7OA 2LIGA 3SXZA 3MLGA 2R7XA 2QE9A 3FOPA 4O7GA 1U0BB 3O6XA 4MVQA 3LS0A 1E2XA 4E0HA 5JLIA 4K1OA 1CPQA 3IPMO 1TWCA 3MYFA 3EFOB 3VRCA 1H9GA 2AWYA 3S27A 1HMDA 2FGYA 3W8IA 5EK0A 1YA9A 5F5FA 4BJ1A 1LM3B 3J06A 1HE9A 2J7PA 2OJQA 2Y39A 3DM9B 4HFKB 3UR3C 3S28A 2KK1A 5JVEA 3EZIA 4CS9A 2XXAA 1D1BA 1LE2A 1IW7F 2W45A 4FX5A 3US6A 1BDJB 5EHHA 1K04A 1E85A 2J9VA 5L0JA 3EHMA 3G4ZA 3U2MA 4LDQA 4IAOA 4XWJA 2MHRA 3JSEO 2WVNA 4A2NB 4D4XA 5JRAA 2XS1A 3DE9A 1I4ZA 2PF4E 5BQHA 3SYNA 3AG3C 3EGXA 4DVYP 2P61A 4E17A 5A6AA 4BJ5C 1QKRA 3GM1A 1ZHZA 2CYDA 3C63A 2R02A 2TMVP 2XSEA 3TQOA 1G4WR 1MQVA 1AUEA 1ZHTA 2KW3C 3UMKA 4ZLCA 2GDCA 3FMSA 2ICWG 3QW0A 4J32B 2YL7A 1FMVA 5EGYA 3DE8A 4PJMA 5E3AA 2HMQA 4EBJA 2ASRA 2OG2A 2LD6A 3EJNA 1SF8A 3MBGA 3W8HA 4EKWA 2YEVA 4H54A 2W4BA 3MYIA 1RKEA 3SXMA 1E83A 2NUTA 2H7VC 2R7QA 2VCBA 1YARO 5DS4A 4LACB 3LEOA 4OINF 1WTYA 1M2VA 1JPNA 3ABKC 3ASNC 4N4WA 3TOMA 1T6IA 2YQYA 3EHNA 3B0VC 1OXKA 3Q6NA 2PX3A 2EPNA 2NUPA 2W9YA 4U5DE 3RF3A 4DOZA 3IHUA 1ZZPA 4NQFA 3OA1A 2QUPA 3RVZA 3LLIA 1C17M 4IARA 1E84A 1RMVA 1O87A 1V4AA 4PFPA 1VYKA 1EKYA 5K0IA 4OD5A 4F4BA 1CGNA 2VASA 2L6GA 2BE5F 1F1MA 3U9JA 2OJED 3JYYA 2V3CC 3TOLA 4JJFA 4JCHA 1LKXA 2A69F 4OIOF 2L9JA 4FAPB 2YKZA 2FAPB 3SNHA 1WOLA 4XEVA 1OCOC 4G7OF 3R2PA 1WATA 2HUJA 2YL1A 4DRJB 5CIVA 2YRFA 1JMWA 3Q6MA 3RH3A 4Z9HA 4MVOA 5D92A 5L0CA 4XLPF 1RKCA 3X2QC 5B1BC 2C04A 2W4MA 2CNWA 4JVSA 3VYWA 1OKKD 4AX2A 3AOUA 3LESA 2Y3HA 3U3FA 2HV6A 1ZU5A 2R25A 2OQMA 1A7EA 1QZXA 5FCLA 4J7YA 3HJCA 3ZSUA 2XS8A 4M63A 1J8YF 5JUAA 3K1HA 4HEAJ 2MYSA 3DWWA 1RKEB 5AGFA 1L3PA 3NYJA 2M64A 3RFYA 2E87A 2KYHA 3QTHA 2B0JA 2EILC 1SZIA 3CAXA 3K1IC 4CDAA 2EPKX 1VOMA 4U9EA 4C7OA 2Y3DA 4EHPA 2XL6A 3NKEA 4EIYA 4YT8A 1BBHA 1T9KA 2NG1A 2ZXOA 3S90A 2LFDA 1ZVZA 3NMKA 4AE4B 2OEVA 4CS8A 1B68A 3EGDB 3CSKA 1YVIA 3DXJF 3PCVA 2HJ3A 3KL4A 1BZ4A 4I44A 2DI3A 4JZAA 1LIHA 4IGGA 4ZLDA 3RQFA 3QZCA 3TJ5A 1KNYA 1Q0KA 5KYXB 1C02A 3FHDA 1TWHA 2LSEA 3NKDA 4B6IA 4PFOA 3VAYA 3AJMA 4Q4ZF 4MW3A 2WB7A 2Z15A 1I5NA 3A9CA 4Q5SF 4ULWA 2I8BA 4EUKB 2XLEA 3KKBA 3GM2A 4JTCB 2A1DD 3UGOA 3C7JA 1KTMA 1HW2A 4CDYA 1ORSC 5L0GA 2H7OA 4O6YA 5BUOA 1WWPA 3L8JA 3I4UA 1PV3A 1VMAA 5KYWB 2R7TA 5DS5A 3HKKA 4NTFA 3GEHA 5A69A 2XL4A 3T6BA 4RDAA 4A4AA 2YWAA 4Q7CA 1MMGA 1OR3A 1Y6DA 3ECSA 4JRZA 5COFA 5A6BA 4JKVA 4PJLA 3WG7C 4C3DA 5KYWA 2H7BA 3V7OA 3K66A 3IQ5A 4U5CE 5DQZA 1Z23A 2FFHA 3ABLC 4FESA 3UMIA 3LS1A 1QLEC 3CQZA 4D4NA 3ZTZA 4BJ5A 2XLOA 4JC7A 3HNIA 3JCUQ 5L3QA 5COGA 1A7DA 3H2VA 1OQCA 5JT4A 1NLXA 2J9UA 3IQTA 4I1OB 5BQGA 4DBQA 4KNVA 3AG2C 4QDLA 5KYXA 3K7DA 1TFOB 1R5ID 3AQBA 3C8ZA 1GQAA 3GM3A 3GWLA 5GPGB 1DOWA 2WZLA 4OIRF 2PBEA 1JOGA 1J8MF 5CI9A 3SXKA 1K05A 1U89A 3KPHA 1JPJA 3MFNA 5DLJA 1VTMP 4FWVA 4O79A 4AE4A 2IXOA 4EBKA 4ER9A 3LNMB 2X0CA 3EGDA 4XTKA 4BEMJ 1LI7A 3GORA 3JSZA 5HV9A 2XLVA 3HLZA 3CZ6A 5KYYB 5A6BD 4CIPA 4XPYA 1LI5A 4I3MA 1E86A 4U9DA 1LS4A 2A68F 1A41A 2J0WA 1JAFA 2VH3A 3C62A 3NDBB 2Q4FA 3RQEA 2G62A 4NTAA 4PACA 3W2WA 2R7VA 2J9WA 1XWJA 2UUHA 2XM4A 2YL0A 3C8GD 4DRHB 3DI5A 2ZXRA 2P0NA 3I5PA 1CGOA 2EPOA 3JYHA 2Q9CA 2LK4A 4P9FA 4G78A 3RW0A 2WL8A 4DVZA 1TKNA 2R7WA 1BR4A 4IRUA 4MVSA 5F28E 3ZDLA 4E7ZA 1UG7A 2XRHA 3W2VA 1G5ZA 2NUPB 3EG9A 3GWNA 3H2UA 1M2VB 1HMOA 1FFHA 2R03A 4MNDA 1LS1A 2HMZA 1YZCA 1OCZC 1WASA 1SMYF 2HSQA 3EPVA 4IJJA 4BJ6C 5FZTA 2JX0A 3BEHA 4J7TA 1YDIA 2R7UA 1TR2A 3JZ0A 3BRJA 4MTFA 3U8PA 1WN0A 2HKVA 2ZXWC 5KYNA 4U5BE 2YVKA 2KC3A 1XZQA 2KQ9A 1ZU4A 3Q7GA 3AG4C 1Z7Qc 1WGWA 4JIOA 2YLDA 1MNDA 4C3BA 4JJGA 2B0HA 2QNLA 3LNRA 2R7RA 2WZGA 4BEJA 2YHSA 4Z9IA 4YJWA 1NFNA 2J8WA 1TFKB 3RQGA 1HY5A 2YZSA 4JTDB 1AVOB 1RCPA 4CBEA 4XLNF 4CS8C 3T9OA 3UMHA 1A7VA 1MMAA 5HSWA 4JCZA 2A0UA 3EG9B 1EI7A 1FNTc 2R9RB 5AC4A 1D1AA 1EQ1A 2RD9A 1Q0MA 4PK4A 3SZRA 2YL3A 2ZPAA 256BA 3DMDA 3N0TA 4JW1A 3V5YA 2R7SA 5CI8A 2OEXA 2HS5A 3ZC4A 3AGTA 3GEEA 2NUTB 3EH1A 4JTAB 1MMNA 2QLAA 2EPMX 4N6HA 2ZD9A 1ZHYA 1M2OA 2C03A 3E70C 5T3TA 3WAQA 2HV7A 3ZVRA 3FOOA 2KNHA 1M6TA 2D5RB 2GWWA 2VB6A 4R32A 3PMRA 4CSAA 1V74B 4YL0A 3S9OA 2R05A 1QPUA 2CW0F 2IYLD 2OKUA 3RYLA 4AL1A 3NMIA 4JEAA 1GM5A 4OIQF 2HSBA 5JS5A 3M4BA 4U5EE 3S0XA 5KYUB 4G7ZF 5B1AC 2BL2A 1NBBA 1Q0GA 2XLDA 2X51A 2JPUA 2P6VA 1H7IA 4IB4A 4DRIB 4X0RA 3QVYA 3OWTA 4LERA 2YLIA 1OW7A 4ANJA 1CPRA 1S05A 1D0XA 2IM8A 2EIKC 2PX0A 2Q9BA 4CJOA 2RSEB 1L7CA 3UGPA 5JP7A 2D4UA 3NYLA 2OU6A 3LEVA 4N6CA 3GODA 3C8GA 5TJ5E 3LLKA 1T01A 1V54C 4O6NA 2J46A 4YL1A 5KYUA 4CS7A 1IZMA 3L0IA 3KH2A 1T6QA 2A6HF 1YYXA 3RVYA 3ATPA 2KJGA 3HNLA 4MTOA 3B9QA 4CDVA 2CDQA 3ITFA
chains in the Genus database with same CATH topology
4XPWA 1A7DA 2AWCA 2MHRA 3WHNA 1I4YA 3AGTA 4XPYA 4XQ1A 2AWYA 3WAQA 1HMDA 1I4ZA 4XPXA 2HMQA 3AGUA 1A7EA 1HMOA 2AVKA 2HMZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XPW A;  1A7D A;  2AWC A;  2MHR A;  3WHN A;  1I4Y A;  3AGT A;  4XPY A;  4XQ1 A;  2AWY A;  3WAQ A;  1HMD A;  1I4Z A;  4XPX A;  2HMQ A;  3AGU A;  1A7E A;  1HMO A;  2AVK A;  2HMZ A; 
#chains in the Genus database with same CATH topology
 2I15 A;  1TWA A;  1QVX A;  2L7A A;  1M57 C;  3V5Z A;  1H9T A;  5KYY A;  3E9V A;  3S84 A;  4DBR A;  2CNW D;  1O5H A;  2OCC C;  3RIP A;  5A6K A;  3NYM A;  2IXN A;  1NU9 C;  4C3E A;  1TWG A;  1S7Z A;  2CCY A;  2ETS A;  4K7B A;  3DAG A;  2EPL X;  1KU2 A;  2NSF A;  3O10 A;  2QTV A;  3S29 A;  3ZQV A;  4NCQ A;  4CSA C;  1OW6 A;  1OCC C;  2HFI A;  1YLM A;  3OEO A;  5AC5 A;  1RJ9 A;  3LAY A;  4N06 A;  1YZA A;  3ZTM A;  4HE8 D;  4E7S A;  1YA7 O;  5B3S C;  3IQC A;  4KC9 A;  2BC5 A;  1PCX A;  1CGM E;  3W4Y A;  3B0P A;  5COM A;  1D1C A;  1T5O A;  2VC9 A;  3HNK A;  2DB4 A;  1Q0D A;  1NZE A;  3PDM P;  2Y3G A;  4G7H F;  2YLG A;  4YL3 A;  1RJ9 B;  2NPU A;  2JD3 A;  2Y3B A;  3JRT A;  1Z63 A;  1R4T A;  1XZP A;  4RD9 A;  3TJ6 A;  2AWC A;  5E3C A;  1ZHX A;  4P6I C;  4YT5 A;  1EA8 A;  1JRA A;  2LP4 A;  3EH2 A;  3SEO A;  4I1M A;  4CJG A;  4JEB A;  2IOQ A;  1O3U A;  1VYI A;  5L0F A;  2XLM A;  2PP4 A;  5L0D A;  1JR8 A;  4EWC A;  1VLT A;  4W8K A;  4KI2 A;  4H4K C;  5JSL A;  2WVO A;  1YJG A;  3V5X A;  2ZXP A;  4GQH A;  1MNE A;  4MVM A;  1NU7 D;  2XLW A;  4G0H A;  4MS2 A;  4MQ9 F;  5L0H A;  4WAB A;  3K1I A;  4J30 B;  4LDR A;  4YT2 A;  2P1A A;  5T1D B;  3JTL O;  3WHN A;  1OCR C;  1K40 A;  1RXQ A;  2WVQ A;  3C8G B;  1LVK A;  3N2Z B;  3DJU B;  5E33 A;  3SP1 A;  2J0X A;  1ST6 A;  3EGX B;  3JT1 A;  5BQI A;  4BJ6 A;  3N24 A;  4AK9 A;  1A0B A;  2LFF A;  3HNJ A;  3GAN A;  4NC3 A;  3HTK C;  4NTB A;  2VCC A;  2IXM A;  1OKK A;  1QSP A;  2Q3T A;  1GGQ A;  1HE1 A;  2F22 A;  4L6R A;  1VLS A;  2G3V A;  1SR2 A;  3QW1 A;  3SXY A;  3VM6 A;  1GS9 A;  3GEI A;  2DGJ A;  1I4Y A;  1N1C A;  1ORJ A;  4U5H A;  3DM5 A;  4BPM A;  1ZYR F;  3DJN B;  3FXH A;  2IXP A;  3K6B A;  4C7O B;  1Z6A A;  1TQG A;  2AU5 A;  4K0D A;  2L6H A;  2XL8 A;  4JE9 A;  5F5H A;  1APC A;  3U3B A;  3ZQY A;  5B3I A;  4IAQ A;  4XPX A;  3EZH A;  4OIP F;  1LPE A;  4DJ9 A;  3FAJ A;  4XPW A;  3M15 A;  3FVY A;  2J7P D;  4QI0 A;  2PFD A;  4OD4 A;  3PHF 2;  4YN0 B;  3UNG C;  5DQT A;  4ULV A;  3M1C B;  3U5S A;  3L8I A;  3TUL A;  1T6U A;  3FAP B;  1BR1 A;  2KGO A;  3ABM C;  2UUI A;  2PNO A;  1Z5Z A;  3AG1 C;  4LLE A;  1SYQ A;  2MWQ A;  3K33 A;  3NRH A;  5T3W A;  2WZF A;  3F46 A;  3NG1 A;  1VK5 A;  2KSF A;  2M4E A;  3DAF A;  3M79 A;  4MW8 A;  3RKO F;  3TD7 A;  1Q0F A;  1UFB A;  4LDK A;  3KYJ A;  4MVU A;  3T6J A;  4GEH A;  1W2W A;  3G4X A;  4XEF A;  1FR0 A;  3ZWI A;  1MMD A;  1VB5 A;  4KNW A;  2XXA B;  4XQ1 A;  5DS6 A;  1DOV A;  3F47 A;  1M56 C;  5L0I A;  3AGU A;  1H6G A;  1Z3I X;  3U8V A;  1ORY A;  2AVK A;  4NY3 A;  4KBL A;  1YYJ A;  3JRM O;  4AL0 A;  2GAQ A;  3M4C A;  1U6H A;  2J9B A;  3A11 A;  4E0I A;  3VF0 A;  2XLH A;  3H65 A;  3QMK A;  3IQ6 A;  1ZHW A;  2EIJ C;  1G4U S;  3DD7 A;  3DZA A;  2XM0 A;  4LLC A;  4YT4 A;  2GFH A;  2A0B A;  3ZG1 A;  4YK5 A;  3KMI A;  1HW1 A;  2Q7R A;  4DXW A;  3IEE A;  3LUT B;  1G8X A;  3ZIB A;  3L1M A;  1C03 A;  1OXB A;  3Q7L A;  3T6G B;  3ASO C;  1OR2 A;  2O9X A;  4CS9 C;  4PJN A;  4O6M A;  2DYR C;  5DVW A;  1LE4 A;  4PJJ A;  3T4R A;  4UDV A;  3CEX A;  2L81 A;  3C18 A;  4GYT A;  3QVZ A;  3FDQ A;  1PD1 A;  4JUR I;  2NSG A;  4BJT A;  1FMW A;  3B71 A;  3O55 A;  5E2Q A;  4RBN A;  3B0U X;  2LQG A;  5IY5 C;  4W8P A;  2DYS C;  4WGY A;  4U5G A;  4XEK A;  3U9M A;  2EIN C;  4IWB A;  1PD0 A;  3NMJ A;  1QQ3 A;  2H8A A;  4P9T A;  4PR9 A;  4CIH A;  4ONS A;  3LJB A;  4WGZ A;  2EIM C;  2HJM A;  5L3V A;  3R7C A;  4WJ0 A;  1FFT C;  1ZW3 A;  2VCA A;  3G50 A;  1D0Y A;  1YAU O;  3MX3 A;  4MVZ A;  4YWQ A;  1OW8 A;  3EQL F;  2G3K A;  3KYI A;  5D91 A;  3U0C A;  1BR2 A;  2Q00 A;  1NG1 A;  2AP3 A;  1V55 C;  2Q9A A;  3B29 A;  3AQC A;  2OOC A;  3I5Q A;  3O39 A;  4HFF B;  1AEP A;  4Z9J A;  3U2L A;  4BG0 A;  4CX9 A;  2J45 A;  4E18 A;  1ZW2 A;  2A6E F;  1FAP B;  3POV A;  4MVR A;  1D0Z A;  3EFO A;  3X1O A;  1NSG B;  5A6J A;  4QI2 A;  2LCH A;  1NFO A;  4MTG A;  4U5F E;  2QY9 A;  2P7V A;  3L34 A;  1FTS A;  2GA0 A;  2HZ8 A;  1Y4C A;  3DKA A;  3WOD F;  4EBB A;  2CGE A;  3TK0 A;  2L6F A;  2Y69 C;  2V26 A;  2IBF A;  2R7O A;  2LIG A;  3SXZ A;  3MLG A;  2R7X A;  2QE9 A;  3FOP A;  4O7G A;  1U0B B;  3O6X A;  4MVQ A;  3LS0 A;  1E2X A;  4E0H A;  5JLI A;  4K1O A;  1CPQ A;  3IPM O;  1TWC A;  3MYF A;  3EFO B;  3VRC A;  1H9G A;  2AWY A;  3S27 A;  1HMD A;  2FGY A;  3W8I A;  5EK0 A;  1YA9 A;  5F5F A;  4BJ1 A;  1LM3 B;  3J06 A;  1HE9 A;  2J7P A;  2OJQ A;  2Y39 A;  3DM9 B;  4HFK B;  3UR3 C;  3S28 A;  2KK1 A;  5JVE A;  3EZI A;  4CS9 A;  2XXA A;  1D1B A;  1LE2 A;  1IW7 F;  2W45 A;  4FX5 A;  3US6 A;  1BDJ B;  5EHH A;  1K04 A;  1E85 A;  2J9V A;  5L0J A;  3EHM A;  3G4Z A;  3U2M A;  4LDQ A;  4IAO A;  4XWJ A;  2MHR A;  3JSE O;  2WVN A;  4A2N B;  4D4X A;  5JRA A;  2XS1 A;  3DE9 A;  1I4Z A;  2PF4 E;  5BQH A;  3SYN A;  3AG3 C;  3EGX A;  4DVY P;  2P61 A;  4E17 A;  5A6A A;  4BJ5 C;  1QKR A;  3GM1 A;  1ZHZ A;  2CYD A;  3C63 A;  2R02 A;  2TMV P;  2XSE A;  3TQO A;  1G4W R;  1MQV A;  1AUE A;  1ZHT A;  2KW3 C;  3UMK A;  4ZLC A;  2GDC A;  3FMS A;  2ICW G;  3QW0 A;  4J32 B;  2YL7 A;  1FMV A;  5EGY A;  3DE8 A;  4PJM A;  5E3A A;  2HMQ A;  4EBJ A;  2ASR A;  2OG2 A;  2LD6 A;  3EJN A;  1SF8 A;  3MBG A;  3W8H A;  4EKW A;  2YEV A;  4H54 A;  2W4B A;  3MYI A;  1RKE A;  3SXM A;  1E83 A;  2NUT A;  2H7V C;  2R7Q A;  2VCB A;  1YAR O;  5DS4 A;  4LAC B;  3LEO A;  4OIN F;  1WTY A;  1M2V A;  1JPN A;  3ABK C;  3ASN C;  4N4W A;  3TOM A;  1T6I A;  2YQY A;  3EHN A;  3B0V C;  1OXK A;  3Q6N A;  2PX3 A;  2EPN A;  2NUP A;  2W9Y A;  4U5D E;  3RF3 A;  4DOZ A;  3IHU A;  1ZZP A;  4NQF A;  3OA1 A;  2QUP A;  3RVZ A;  3LLI A;  1C17 M;  4IAR A;  1E84 A;  1RMV A;  1O87 A;  1V4A A;  4PFP A;  1VYK A;  1EKY A;  5K0I A;  4OD5 A;  4F4B A;  1CGN A;  2VAS A;  2L6G A;  2BE5 F;  1F1M A;  3U9J A;  2OJE D;  3JYY A;  2V3C C;  3TOL A;  4JJF A;  4JCH A;  1LKX A;  2A69 F;  4OIO F;  2L9J A;  4FAP B;  2YKZ A;  2FAP B;  3SNH A;  1WOL A;  4XEV A;  1OCO C;  4G7O F;  3R2P A;  1WAT A;  2HUJ A;  2YL1 A;  4DRJ B;  5CIV A;  2YRF A;  1JMW A;  3Q6M A;  3RH3 A;  4Z9H A;  4MVO A;  5D92 A;  5L0C A;  4XLP F;  1RKC A;  3X2Q C;  5B1B C;  2C04 A;  2W4M A;  2CNW A;  4JVS A;  3VYW A;  1OKK D;  4AX2 A;  3AOU A;  3LES A;  2Y3H A;  3U3F A;  2HV6 A;  1ZU5 A;  2R25 A;  2OQM A;  1A7E A;  1QZX A;  5FCL A;  4J7Y A;  3HJC A;  3ZSU A;  2XS8 A;  4M63 A;  1J8Y F;  5JUA A;  3K1H A;  4HEA J;  2MYS A;  3DWW A;  1RKE B;  5AGF A;  1L3P A;  3NYJ A;  2M64 A;  3RFY A;  2E87 A;  2KYH A;  3QTH A;  2B0J A;  2EIL C;  1SZI A;  3CAX A;  3K1I C;  4CDA A;  2EPK X;  1VOM A;  4U9E A;  4C7O A;  2Y3D A;  4EHP A;  2XL6 A;  3NKE A;  4EIY A;  4YT8 A;  1BBH A;  1T9K A;  2NG1 A;  2ZXO A;  3S90 A;  2LFD A;  1ZVZ A;  3NMK A;  4AE4 B;  2OEV A;  4CS8 A;  1B68 A;  3EGD B;  3CSK A;  1YVI A;  3DXJ F;  3PCV A;  2HJ3 A;  3KL4 A;  1BZ4 A;  4I44 A;  2DI3 A;  4JZA A;  1LIH A;  4IGG A;  4ZLD A;  3RQF A;  3QZC A;  3TJ5 A;  1KNY A;  1Q0K A;  5KYX B;  1C02 A;  3FHD A;  1TWH A;  2LSE A;  3NKD A;  4B6I A;  4PFO A;  3VAY A;  3AJM A;  4Q4Z F;  4MW3 A;  2WB7 A;  2Z15 A;  1I5N A;  3A9C A;  4Q5S F;  4ULW A;  2I8B A;  4EUK B;  2XLE A;  3KKB A;  3GM2 A;  4JTC B;  2A1D D;  3UGO A;  3C7J A;  1KTM A;  1HW2 A;  4CDY A;  1ORS C;  5L0G A;  2H7O A;  4O6Y A;  5BUO A;  1WWP A;  3L8J A;  3I4U A;  1PV3 A;  1VMA A;  5KYW B;  2R7T A;  5DS5 A;  3HKK A;  4NTF A;  3GEH A;  5A69 A;  2XL4 A;  3T6B A;  4RDA A;  4A4A A;  2YWA A;  4Q7C A;  1MMG A;  1OR3 A;  1Y6D A;  3ECS A;  4JRZ A;  5COF A;  5A6B A;  4JKV A;  4PJL A;  3WG7 C;  4C3D A;  5KYW A;  2H7B A;  3V7O A;  3K66 A;  3IQ5 A;  4U5C E;  5DQZ A;  1Z23 A;  2FFH A;  3ABL C;  4FES A;  3UMI A;  3LS1 A;  1QLE C;  3CQZ A;  4D4N A;  3ZTZ A;  4BJ5 A;  2XLO A;  4JC7 A;  3HNI A;  3JCU Q;  5L3Q A;  5COG A;  1A7D A;  3H2V A;  1OQC A;  5JT4 A;  1NLX A;  2J9U A;  3IQT A;  4I1O B;  5BQG A;  4DBQ A;  4KNV A;  3AG2 C;  4QDL A;  5KYX A;  3K7D A;  1TFO B;  1R5I D;  3AQB A;  3C8Z A;  1GQA A;  3GM3 A;  3GWL A;  5GPG B;  1DOW A;  2WZL A;  4OIR F;  2PBE A;  1JOG A;  1J8M F;  5CI9 A;  3SXK A;  1K05 A;  1U89 A;  3KPH A;  1JPJ A;  3MFN A;  5DLJ A;  1VTM P;  4FWV A;  4O79 A;  4AE4 A;  2IXO A;  4EBK A;  4ER9 A;  3LNM B;  2X0C A;  3EGD A;  4XTK A;  4BEM J;  1LI7 A;  3GOR A;  3JSZ A;  5HV9 A;  2XLV A;  3HLZ A;  3CZ6 A;  5KYY B;  5A6B D;  4CIP A;  4XPY A;  1LI5 A;  4I3M A;  1E86 A;  4U9D A;  1LS4 A;  2A68 F;  1A41 A;  2J0W A;  1JAF A;  2VH3 A;  3C62 A;  3NDB B;  2Q4F A;  3RQE A;  2G62 A;  4NTA A;  4PAC A;  3W2W A;  2R7V A;  2J9W A;  1XWJ A;  2UUH A;  2XM4 A;  2YL0 A;  3C8G D;  4DRH B;  3DI5 A;  2ZXR A;  2P0N A;  3I5P A;  1CGO A;  2EPO A;  3JYH A;  2Q9C A;  2LK4 A;  4P9F A;  4G78 A;  3RW0 A;  2WL8 A;  4DVZ A;  1TKN A;  2R7W A;  1BR4 A;  4IRU A;  4MVS A;  5F28 E;  3ZDL A;  4E7Z A;  1UG7 A;  2XRH A;  3W2V A;  1G5Z A;  2NUP B;  3EG9 A;  3GWN A;  3H2U A;  1M2V B;  1HMO A;  1FFH A;  2R03 A;  4MND A;  1LS1 A;  2HMZ A;  1YZC A;  1OCZ C;  1WAS A;  1SMY F;  2HSQ A;  3EPV A;  4IJJ A;  4BJ6 C;  5FZT A;  2JX0 A;  3BEH A;  4J7T A;  1YDI A;  2R7U A;  1TR2 A;  3JZ0 A;  3BRJ A;  4MTF A;  3U8P A;  1WN0 A;  2HKV A;  2ZXW C;  5KYN A;  4U5B E;  2YVK A;  2KC3 A;  1XZQ A;  2KQ9 A;  1ZU4 A;  3Q7G A;  3AG4 C;  1Z7Q c;  1WGW A;  4JIO A;  2YLD A;  1MND A;  4C3B A;  4JJG A;  2B0H A;  2QNL A;  3LNR A;  2R7R A;  2WZG A;  4BEJ A;  2YHS A;  4Z9I A;  4YJW A;  1NFN A;  2J8W A;  1TFK B;  3RQG A;  1HY5 A;  2YZS A;  4JTD B;  1AVO B;  1RCP A;  4CBE A;  4XLN F;  4CS8 C;  3T9O A;  3UMH A;  1A7V A;  1MMA A;  5HSW A;  4JCZ A;  2A0U A;  3EG9 B;  1EI7 A;  1FNT c;  2R9R B;  5AC4 A;  1D1A A;  1EQ1 A;  2RD9 A;  1Q0M A;  4PK4 A;  3SZR A;  2YL3 A;  2ZPA A;  256B A;  3DMD A;  3N0T A;  4JW1 A;  3V5Y A;  2R7S A;  5CI8 A;  2OEX A;  2HS5 A;  3ZC4 A;  3AGT A;  3GEE A;  2NUT B;  3EH1 A;  4JTA B;  1MMN A;  2QLA A;  2EPM X;  4N6H A;  2ZD9 A;  1ZHY A;  1M2O A;  2C03 A;  3E70 C;  5T3T A;  3WAQ A;  2HV7 A;  3ZVR A;  3FOO A;  2KNH A;  1M6T A;  2D5R B;  2GWW A;  2VB6 A;  4R32 A;  3PMR A;  4CSA A;  1V74 B;  4YL0 A;  3S9O A;  2R05 A;  1QPU A;  2CW0 F;  2IYL D;  2OKU A;  3RYL A;  4AL1 A;  3NMI A;  4JEA A;  1GM5 A;  4OIQ F;  2HSB A;  5JS5 A;  3M4B A;  4U5E E;  3S0X A;  5KYU B;  4G7Z F;  5B1A C;  2BL2 A;  1NBB A;  1Q0G A;  2XLD A;  2X51 A;  2JPU A;  2P6V A;  1H7I A;  4IB4 A;  4DRI B;  4X0R A;  3QVY A;  3OWT A;  4LER A;  2YLI A;  1OW7 A;  4ANJ A;  1CPR A;  1S05 A;  1D0X A;  2IM8 A;  2EIK C;  2PX0 A;  2Q9B A;  4CJO A;  2RSE B;  1L7C A;  3UGP A;  5JP7 A;  2D4U A;  3NYL A;  2OU6 A;  3LEV A;  4N6C A;  3GOD A;  3C8G A;  5TJ5 E;  3LLK A;  1T01 A;  1V54 C;  4O6N A;  2J46 A;  4YL1 A;  5KYU A;  4CS7 A;  1IZM A;  3L0I A;  3KH2 A;  1T6Q A;  2A6H F;  1YYX A;  3RVY A;  3ATP A;  2KJG A;  3HNL A;  4MTO A;  3B9Q A;  4CDV A;  2CDQ A;  3ITF A; 
#chains in the Genus database with same CATH homology
 4XPW A;  1A7D A;  2AWC A;  2MHR A;  3WHN A;  1I4Y A;  3AGT A;  4XPY A;  4XQ1 A;  2AWY A;  3WAQ A;  1HMD A;  1I4Z A;  4XPX A;  2HMQ A;  3AGU A;  1A7E A;  1HMO A;  2AVK A;  2HMZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...