2AX5A

Solution structure of urm1 from saccharomyces cerevisiae
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
99
structure length
99
Chain Sequence
b'MVNVKVEFLGGLDAIFGKQRVHKIKMDKEDPVTVGDLIDHIVSTMINNPNDVSIFIEDDSIRPGIITLINDTDWELEGEKDYILEDGDIISFTSTLHGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical 11.0 kDa protein in FAA3-MAS3 intergenic region
publication title Solution structure of Urm1 and its implications for the origin of protein modifiers.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Signaling protein
total genus 15
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2005-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09138 Urm1 Urm1 (Ubiquitin related modifier)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2ax5A00
1V97A 3P63A 3AE1B 1JRPA 1OFFA 3CIRB 1I7HA 3AEAB 4HROA 1XLPA 1RWSA 2L52A 3PO0A 3AE4B 4C7ZA 4ZOHC 3B2GA 4N6EB 2KAJA 1FXAA 3VRAB 1OQQA 1N5XA 2JX5A 5MPOA 2BS2B 1XLQA 1FMAD 4JX1C 1ROEA 5C3JB 3LXFA 3DWMA 3NVWA 4C80A 5AUIA 3NRZA 3W5VB 1OQRA 2CJOA 1N5WA 2MJDA 1DGJA 1JW9D 2LEKA 2K5PA 3B9JA 1NYRA 2BS4B 1KF6B 4HRSA 5EE3A 1L6UA 2H89B 3AB5A 4C7YA 3B2FA 3P4PB 1SF0A 1TKGA 2DWQA 3HVZA 2N0SB 3AECB 1AYFA 3KWLA 1RYJA 1R7SA 2MJEA 2MJ3A 2WDRB 1FO4A 1TJEA 1ZUD2 1XO3A 1N61A 2HTME 3AE6B 3ZYYX 2E3TA 2AX5A 1QOAA 1JROA 2PVGC 3RPFC 1L5PA 1E0ZA 2Y5CA 1FIQA 3L4PA 3VR8B 1PDXA 3CWIA 5H8YE 1SB3C 3AE5B 1EWYC 1QLBB 4YSXB 4YXDB 2PKOA 3AMZA 1N62A 1QOBA 3AE9B 1RFKA 4YT0B 1GPXA 1DOIA 1PFDA 1T3QA 3AN1A 1E10A 2K9XA 1JWBD 3VRBB 4USAA 5G5GA 3NVZA 4YTMB 1FFUA 1WRIA 3NVYA 1VJKA 1WGKA 4JWSC 3AEBB 2K22A 2CJNA 1IUEA 1FRDA 2ACZB 5EE9A 1TKYA 4YTNB 2WLBA 1NYQA 3HRDD 3FC4A 1RM6C 2MH7A 2PVOD 1SIJA 1WWTA 3AE3B 4FXCA 5GXGB 4A9AA 1F0ZA 3P4RB 2B76B 4KX6B 2WDVB 4JWUC 1VDVA 1ZOYB 3AE8B 4N59A 2FBWB 3EUB2 1JALA 1NENB 1WXQA 1GAQB 3BIID 1ZP0B 4N58A 4WQMA 3AEEB 1AWDA 1FRRA 2L83A 2W55A 3FAHA 3NS1A 2EKIA 1JWAD 2WU2B 1QOGA 1VLBA 2G1EA 4WWMA 3SFEB 4ZHPA 2PIAA 1L0VB 3AEDB 1NVID 3HUIA 5H92C 1CZPA 1N63A 1ZXIA 1DOYA 3SR6A 4ZHOA 5EE1A 1L6VA 1KRHA 1FFVA 4US9A 4P6VF 2CU3A 1JQ4A 3AEFB 1XLOA 3W9CB 1DOXA 1TYGB 4IDIA 3AM9A 3P4SB 1YQ3B 1WYGA 2QIEB 1E7PB 2WDQB 1KFYB 2DBYA 2Q5WD 3NVVA 3P1MA 2M19A 2OHFA 1FM0D 3AV8A 1QT9A 1J7CA 2WQYB 1QF6A 1N60A 1XLNA 3AE2B 4ITKA 2KMMA 2M56B 2WU5B 3VR9B 4US8A 2H88B 3AE7B 5C2TB 3AEGB 3ETRA 2BS3B 2W3RA 2W54A 1E9MA 5AUKA 1J7BA 3W5UB 3DWGC 1V8CA 1B9RA 1CJEA 4LTUA 4YSZB 4YTPB 3AH7A 4YSYB 2W3SA 1PUTA 1QOFA 2QJLA 5G5HA 1A70A 1YJJA 1FXIA 1YJIA 5EE0A 3ABVB 3LB8C 3SFDB 1UWMA 2BT6A 1NEKB 2JQRB 3WCQA 1TKEA 1YQ4B 1J7AA 2WP9B 1E6EB 3P4QB 2WS3B 1NI3A
chains in the Genus database with same CATH superfamily
5BYRA 3AE1B 3AEAB 2KQSA 2VZKB 3PHWB 3T3NA 3P2BA 1EM7A 3PRZA 4JX1C 1BXTA 2CHZA 4S17A 1S1QB 2I2YA 2KANA 1UUPA 3Q14C 3P4PB 2EKEC 4BOSC 3RZWC 3RULA 1C78A 3ZDTA 1EO6A 4X57B 4LNIA 1IPGA 2K8CA 2YEPF 4ANVA 4A20A 2MLBA 4XX5A 2HTME 5FR3A 1WE7A 3BYTB 1LFDA 3V6EB 1EWYC 4YXDB 3DHGC 4P1BC 1T3QA 1I35A 1BMLC 1C1YB 4OVVA 1WGDA 2KDIA 3I9V1 1F2RC 2AQ1B 1WX9A 4KSKC 4MACA 2IO3B 4N59A 4HCPB 3AXCA 2BWES 2LFIA 4RM8A 1P3QU 2AQ2B 4IG7B 4DHJB 2LVOA 2GMIC 3VTWA 1XCTL 4C4VB 3BVGA 4LJPB 1YX6B 2OHFA 2RMMA 3H8HA 3D32A 3OG5A 2BS3B 3JSVA 2J0MA 1E9MA 3W5UB 1V8CA 1M94A 1FCCC 1R4NB 3APFA 1YJIA 4WJQA 1YNTE 4LK0M 4WJPA 2K1FA 4RF0A 3UI3A 3ECIA 2KNBA 3PO0A 4WJOA 2ZPNA 3R7QA 3PSEB 4KSLC 3ZNGC 2G4SA 2XNAC 3B2FA 4A3OA 4BKSD 1JMLA 2K39A 4GSWA 1WI0A 3ZXRA 5FKAC 3ZYYX 5IAAC 1TBEA 2HE7A 3TJPA 1N62A 3AE9B 1FNWA 3GP7A 2KZRA 2IBIB 2WYQA 2KVZA 3PT2B 4MH0E 2NCNA 1FRDA 2N7JA 2MQJA 4M0WB 3ZTCA 3AE3B 4A9AA 1SIJA 2NBVB 1WGHA 2WDVB 1VDVA 1ZOYB 5AZFA 2K6QA 4B9KA 2JZ3B 4PT5A 3V60A 4KZ0A 1KM7A 4TV3A 1QOGA 2XK5A 4WWMA 5DPRA 2O6VB 1DOYA 2KFJA 1KRHA 3DQVA 4PK1A 4XDDA 2BF8B 4EFOA 3BK2A 3Q8FA 3Q8AA 2M17A 3VFKA 1HXYD 3ZNID 3NVVA 2LGDA 2DZKA 3LJ3A 2W9NA 1TIFA 2WGSA 1WM3A 3DWGC 1QILA 3AH7A 4I6NB 1YJJA 3ZRCA 3U4EG 1D5MC 1GC6A 5HI1A 1NI3A 2ON8A 3OWEB 3V3XA 4FJZA 5JHAA 3QC8B 1WYWB 1TZ1A 1P7FA 1GNUA 2L05A 1M4VA 4GU2A 1OEYA 4JE3B 1T6BX 3ZKJC 4BFRA 2PE6B 3K9OB 4W9EA 1YN5A 3AB5A 2BVCA 2K6DB 2WXIA 2KYWA 2A5UA 2EELA 2KLGA 2N1WA 2E3TA 3TCAA 3VR8B 2Z0DB 3B08A 1EF1A 1HTQA 4LCDE 2D3CA 2GOWA 1ZXHA 5JHBA 4XWTA 1WRIA 2ZPYA 1WF9A 4KDLB 2QCZA 2KTRA 2BWFA 2WXMA 4MT5A 2LMCA 3SU8X 4GDKA 2RSUA 4C4VA 2N9XA 1GAQB 5EDSA 2LZ6A 3NS1A 1V1PB 1T0QC 3PVLA 1L0VB 1CZPA 1N63A 2PE9A 2WXKA 2V9HA 4IDIA 2AEHA 3ZVVA 1WGYA 3GE8C 1VZ6A 1WYGA 2DENB 2WXFA 3B0AA 2KTFA 5DPSA 1QF6A 1N60A 3MC0B 2RDBC 5AUKA 2D10A 1CJEA 1C3TA 3V61A 1MHXA 4YSYB 4RGMA 2QJLA 3PLVA 1JWMD 1FNVA 2Z8LA 1JWUD 3Q8CA 1V5TA 3IT4B 4AOFA 2WS3B 1C76A 5BYQA 1I7HA 4FJYA 3UQBA 2QMTA 4EZKA 2KAJA 4ZRJA 2DZMA 5HHDG 4KIKB 3ZGZA 1XLQA 1WXSA 4MGKE 2J4XA 2LVQA 3C19A 1RLFA 4HXDA 4J3OD 4A3PA 1HZ5A 1L6UA 1SF0A 4HDOA 3U8ZA 1R7SA 4L2YA 4B95A 1UZXB 3OAWA 2IY0B 3I5JC 2BYTA 2IGHA 1PFDA 3AN1A 2JZPA 3DVGX 4II2B 2O6VA 2LJ5A 4C00A 1D6EC 2V4IB 1XQQA 3NG0A 1PGXA 4JWSC 1RFAA 3U7ZA 4L1BA 1NYQA 3HRDD 3X0WA 1PGAA 5L83A 3O13A 4QAYA 1OEYJ 2ICIA 2LRWA 2L3ZA 3PREA 1ZP0B 3TEWA 2L83A 4A90A 2ZCCA 1EU4A 5D3IB 4MH8A 4RCOA 5H92C 2LI5A 2JZZA 3E9SA 5EE1A 3RNGC 1F9JA 2LWPA 2FAZA 3QJZA 5BMIA 2QIEB 4B0EA 2KN5A 4MGZE 2DBYA 3FKYA 2V3PA 3Q3JA 1IGCA 3ZNHB 2L0TA 4US8A 3RD2A 5C2TB 1WJ6A 2BQQA 4MELA 2HDEA 2C60A 1SE4A 5JZEB 2NVUI 1YMHE 2PPHA 3DCGA 4NAWB 2I1KA 3MC9A 2WP9B 4ANXA 2V0GA 2OOBB 4FADA 1KLGD 2FE8A 4IC7B 1L2NA 1P7EA 4E71A 1FXTB 3MC8A 1C77A 4N6EB 4ZRPA 1WX8A 3PPAA 1KH0A 3DOWA 4DK5A 5E6OA 2KC2A 2EMTA 4RNAA 2WNMA 4DXGA 2N1VA 4ICUA 2PMVA 2FNJB 4FHKA 2YLMA 2KO3A 3RZFA 2IGDA 2KX0A 4E74A 2B3AA 3VTVA 3NHEB 1E0ZA 3L4PA 1ZGUB 1JWSD 1SIFA 1V1PA 2AL6A 3EA6A 4LDTD 4EKUA 2MBEA 5J18A 4GXBA 3EC8A 3NJTA 3FC4A 1R4MB 2BB5A 4JWUC 5E6JA 2KWUB 5IN7A 2N9LA 1TZOA 3L17A 2D2QA 3ZJUA 4C7ZA 4ZHPA 5CTRC 3AU4A 3SR6A 4EZLA 1UBIA 3T3OA 4P7IA 1JQ4A 3RUIB 2ZVOA 1ET6A 3L54A 1PGBA 3RNFC 4D2KA 2MSED 1A5RA 2JYTA 2MBOA 1F52A 2KMMA 3ENEA 2H88B 4NJCA 3BK1A 3ZUNA 2AWTA 2JF5A 4W9FA 2BW2A 1J7BA 2GLSA 2FCNA 2MA9B 3KYCD 3WANA 4YSZB 1GB1A 3L10B 1J7AA 3S2AA 5G55A 1V49A 3RMKC 1JRPA 4HROA 4MSQB 1XLPA 3VVWB 3ZQ4A 3Q8EA 4MM3B 3FILB 4MJSA 1FMAD 3TEZA 3NVWA 1MG4A 3NRZA 4HKQA 4BAXA 2R2OA 2I1JA 4HDQA 2REXA 4JLCA 4AUQC 2MJEA 2N9EB 2L32A 2WDRB 1ZUD2 2HJ8A 3VHTC 4IUMB 2PTLA 3UIPB 1FPYA 3CWIA 3IAS1 2V4LA 3CF6E 2WXQA 2LGXA 5AZGA 4DDGD 2FCQA 2KFKB 1D4BA 4ANWA 3ZRFA 3DBHI 1SGHA 4LNFA 5AEKB 3AULA 5I4DA 1CK1A 1P98A 1TKYA 4RGNA 4DBGA 3QCAA 2MH7A 1F0ZA 2LUMA 2J0JA 4I6LB 1QQRA 3BWUD 1WXQA 1NENB 2K3UA 1ET9A 3DBRI 4B6WA 1AWDA 2W55A 2WU2B 1P0RA 2WDTB 5LNK1 3N3KB 2ZEQA 4ZHOA 3HHMA 2IPKD 1L4DB 3MJWA 3P4SB 4LNNA 1KFYB 3M63B 4NAWA 2Q5WD 2FIDA 2MCNB 1UF0A 2J53A 4ASWC 3NZSA 5D94A 5DPWA 3ML9A 2LD9A 2NBWB 2J42A 5LLIA 1A70A 4DHZB 1UWMA 3URYA 4AS1A 1TKEA 3P4QB 4WAAA 1E6EB 2VZKD 2NPTB 2N9PC 3Q2AC 3PV1A 3CIRB 2M8SA 3AE4B 5CHVC 2DLBA 2PEAA 1KTKA 3KLSX 3M95A 1D5ZC 4FLHA 4NY0A 4G0NB 3N1YC 1C79A 3N1ZC 3NY5A 2LEKA 4HK2A 4XZ4A 1SXTA 2C5LC 2WXJA 3SHQA 2BBCA 1NBFC 5TSSA 3N30A 2NS5A 4AJWA 4K81A 3Q3NC 1QLBB 4W9HA 4XDCA 2MHJA 2PLPA 1FNUA 2KDBA 1V2YA 1IP9A 3V62A 4HLEA 2CJNA 2ACZB 4RH6A 3ZTDA 1OGWA 1WWTA 5GXGB 3DBLB 3RFZB 3SDLC 2IDYA 4YWGG 2RDGA 4FJVB 2JT4B 1E90A 1VZ7A 4DHJD 2R2QA 1UH6A 3BVZA 1Z5SB 3HM6X 1TYGB 3PS6A 4WWPA 1ISNA 2WXRA 1WMHB 3CMMB 4PS7A 1F1HA 5DCNA 2M19A 1XXGA 4ICVA 4RM9A 3W1YA 1KJTA 1HZ6A 3QX1A 4MM3A 5D3DA 2W54A 2ZVNA 3JYUA 3EFCA 2JSVX 4K7WA 2BB6A 1C9FA 2C7HA 2LXCA 2KLCA 4W9GA 2RD0A 3MHZA 3DVNU 3QK0A 1UD7A 5BO4B 4HJGE 3N9YC 1E8XA 2BKFA 2K5PA 3V6CB 1WH3A 2XEWA 1N6ZA 2LGYA 2JY6A 4AWJA 2INDC 2XBBC 4XE0A 1N61A 3O65B 3C8YA 2UU7A 3ZJVA 1SJED 2GBMA 4HJKA 3VRBB 1ZE3D 2JUOA 1GOZA 3ZO5B 4F1SA 3NVYA 2DZIA 2NMQA 1AW7A 3MP9A 3T9LA 3AE8B 4K7UA 1JALA 5G2NA 2O6VD 3PGEA 1V86A 4WQMA 2FCMA 2HJ1A 1WJUA 1E5WA 3IBEA 1FFVA 3VH4B 3UINB 4M8NA 2SEBD 3QQ8B 4EUTA 2MWSB 2D3GA 3W2DA 2NPTA 1V5OA 5LXIB 3APDA 3J9CA 1I4XA 4P16A 1B1ZA 2W3RA 3C0RB 3EGRA 3IHPC 2KDMA 1XEEA 3LB8C 1EF5A 1NEKB 2JQRB 3WIMA 3I3TB 1R4NI 1K53A 1V97A 1OFFA 4AQ7A 4N9F4 5C1ZA 1AARA 1YD8U 4ZOHC 3B2GA 5MPOA 2ZNVB 2DX5B 4EOYA 3HK0A 2R61A 1JW9D 1CMXB 1JRUA 1VR9A 1TKGA 2DWQA 2N0SB 2ZW1A 3EECA 1RYJA 1PQSA 4GB9A 1WZ0A 1I42A 1Y56A 2O2VB 3DDCB 3PHXB 3WAMA 2DAFA 5KHOA 2AX5A 1H4RA 3DBLI 2KQ4X 1MPEA 3AMZA 2LRUA 3WAOA 1RFKA 4ACFA 4MEMA 1GPXA 3Q3FA 4YTMB 1TGZB 2BPSA 3UGBB 2DYMA 2IGGA 1TT5B 4FXCA 3L16A 2XN9C 3M3JA 5HFYA 1WMHA 4P1CC 2Y5PA 4M0WA 2DZJA 1UGMA 4HVBA 3BIID 3BY4B 4M8MA 4TMAB 2HTHA 5E6PA 1BT0A 1QKZA 2M0AA 5CHFA 1WXVA 1HEZE 2A4ZA 3N32A 1K52A 2LASA 3ZDMC 3AM9A 4XYCA 4FHJA 2D07B 2INPE 3NOBA 4OZBA 4JPSA 3P1MA 4LJOB 4NPNA 4KZCA 1FM0D 3DPDA 1QT9A 2KVRA 3AE2B 3U52E 2Y3AA 4KKIA 2MP2B 4ZYSA 1PUTA 1WJ4A 4G50A 2ONQA 3WCQA 4TUUA 1PYWD 1MI0A 3BZDB 3CSFA 5HG2A 3P63A 1EUVB 4W9DA 3QIJA 1C4CA 1T0SC 1L4ZB 2L52A 1P1AA 4LNOA 2PW9A 2QHOA 4C56C 1FXAA 2L8JA 1XF5L 1UWXA 4GMVA 4RGOS 4KKJA 1MHHE 4IWQA 5C3JB 1C4AA 2RPQA 3GS2A 1KF6B 5CX3A 2H89B 4LDTB 3HVZA 1WRDB 3AECB 4IM3A 3K9PB 4MDKE 4A6QA 2MJ3A 2NTSA 1FO4A 3KVFB 1XO3A 1WJNA 4FA6A 1QOAA 2WX1A 1L5PA 2OEDA 4FULA 1Y8RC 3NUHB 4W9CA 4DXFA 2GBJA 4RGTA 1JWBD 2HD5B 5G5GA 1D3ZA 2RPVA 1STEA 3IXSA 3U2SC 2LHEA 3OJ3A 1WXMA 4A8XC 5AZHA 1WZ3A 2FBWB 1WGGA 4A55A 4II3B 2KDEB 3MFGA 1MFWA 5J2RA 4W9JA 3SFEB 3QARA 3W1SA 3Q3OC 3AEDB 3KUZA 4GGQA 4BBNC 4OHJA 2DNFA 1DOXA 1S3SG 5CHWA 5D7GA 3MHSD 3RT3B 3B1LX 3TUOA 2ASQA 3UF8A 2J7QB 3QHTA 3PLUA 2L1AA 2WXLA 1BUIC 3QAQA 3ZLZA 2WU5B 2L00B 2IO1B 2V3SA 3ETRA 2KWCA 4GN1A 2UWQA 1V81A 2DAJA 1B9RA 4F7ZA 4YTPB 1UNSA 4KGSA 3SFDB 1NDDA 1TY0A 4CQNA 3PRPB 4MGYE 1UBQA 3GB1A 5TR5A 2O2VA 3Q3MC 2JX5A 1N5XA 4EZJA 3IVFA 2OJRA 2L7RA 3DVGY 2YEPB 4EEWA 3EFUA 4M01A 1LXDA 3VQIA 4BOZB 2CJOA 3WA0A 1N5WA 4KIKA 4WH4A 1J8CA 4W9LA 4FN2A 5EE3A 1TY2A 1AYFA 2KN4A 4NAMA 4I6PA 4IM2A 3AE6B 4W9KA 1IGDA 1SB3C 3AE5B 4YSXB 1MJDA 2E6XA 2K9XA 3L08A 2KDFB 2DYOA 2LXAA 4JQWC 1VCBA 3QA8A 1FFUA 2BYEA 2N4FA 4YL8A 2NBUA 3WALA 1H8CA 1IUEA 5IKCM 2LJIA 2V3NA 3KQ4A 2Z59B 3UIOB 4GOCA 3VUWA 3P42A 1YOVB 2INNE 4IWOA 3HIZA 1VLBA 3RCZA 2PIAA 2BYVE 3N20C 2IO2B 1SE9A 1GUAB 5KHQA 1OTRB 4TQ0A 3A4RA 1SBBB 4WWNA 4Q2JA 5JXVA 4DQOC 4OVZA 1U4AA 2KJRA 2MP2A 3JW0X 1YQ3B 1YN4A 2WDQB 1Z2MA 2WHIA 4CO7A 3WAPA 4AJYB 1HA5A 5J17A 1J7CA 2WQYB 1FD6A 1G6JA 4LNKA 4IOIE 5HKHA 3H9DA 4B0MA 5D2MB 2ZZPB 1LM8B 5IA7A 1YQ4B 3A9JB 2G4DB 1X1MA 3IAM1 4BVUC 2AYOB 2VH2A 5BYSA 1EU3A 4OW0A 2VH1A 2C7MB 3CSTA 3UQAA 1KOTA 1ROEA 4C80A 5AUIA 1OQRA 1DGJA 5C23A 1YQBA 1CQVA 2MBBB 1TS5A 3R2IA 3TEXA 3TL5A 3VDZA 1FIQA 3RI7C 2CHWA 1PDXA 3NS8A 1YX5B 3LYYA 1TS3A 3APCA 3QWZB 2RGFA 2JWUA 1SE2A 2KTRB 1XCQL 2M4NA 2WXNA 3KWVA 2EMSA 3VUYA 3RYTA 4ANUA 1VJKA 4NZLB 2JU6X 4GDKB 1LGRA 2K22A 2KHWB 5EE9A 4HWIB 2WLBA 1ZDVA 2PVOD 1WE6A 2KJ6A 3MTNB 4DWFA 4DXAB 2N7DA 2FUG1 2WXOA 2VRRB 3ZXVA 1R4MI 3GOEA 4DDID 2EKIA 3PZ7A 4JIOU 4E3CA 4ZRQA 2NR2A 2RDHA 4US9A 1F77A 4UDUC 5GMVA 4P6VF 2WXHA 2IZVB 2WXGA 2GRIA 1QZEA 2KMAA 1SEBD 1LQBA 4NNJB 1GJZA 1YJ1A 2QEJC 2GBKA 4HCNB 2RR9A 4HPPA 4OZCA 2LGIA 2FUHB 5G5HA 3GZNB 2BT6A 4WQOB 4K1RB 3NZ3A 1WXAA 4DHZE 1D5XC 1OQQA 3RNCC 2BS2B 2FIFA 3KH0A 5E6NA 3LXFA 3ZNZB 3FILA 4NJ7A 1Q1OA 4ZYNA 4WJNA 3A1QB 4O1NA 4TSSA 2V1YA 1I4GA 1C4PA 3L0WB 5FK9C 2IO0B 1OQYA 1TJEA 3M62B 2KACA 1JROA 1ACCA 2PVGC 2JRHA 1QOBA 1DOIA 3U7DA 3HVDA 2LUEA 4IWPA 4BKGA 2CU1A 3RNAC 4CYEA 3MJ5A 4USAA 1L0XB 2CS4A 2K8HA 2Y5BB 2ZJDA 2KFKA 4YTNB 4KV2A 3VTUA 2JPHA 3A33B 3SEBA 2MW5A 2KK8A 3KW5B 4IKGA 2C7NB 5DPTA 1K50A 1E10A 2JXTA 3FAHA 2G1EA 4NQKE 2D5GA 1NVID 3H7PB 2W82A 1ZXIA 1T0RC 3AU5A 1LO5D 4JGHB 3AEFB 1XLOA 4WWOA 4WIPA 3IFWB 3H1UA 3X23A 3BYYB 1HQRD 4NQLB 3R7RA 1WFYA 3RNBC 3HM3A 2BKRB 1TS4A 4NJ6A 2BTEA 3A9JA 3AV8A 4K3CA 1XLNA 4IM0A 3N1XC 3RNEC 4HKZE 2M56B 1WGRA 3AEGB 5T8IA 3TBLD 4ZRIA 4LTUA 2KX3A 2TSSA 4XGAB 1V6EA 2KXJA 1ZKHA 3ABVB 1I4PA 4URKA 3TSSA 2INCC 3EHVA 2DHZA 1UELA 3ZW3A 4AP4C 4BKSA 4KGRA 2FCSA 3VRAB 1GC7A 2UYZB 3ALBA 1XD3B 2NTTA 1VRAB 2WX0A 2BYFA 3ML8A 1K51A 1WM2A 5JH5C 1RAXA 1J19A 3RPFC 4G11A 2J52A 1WY8A 1T0YA 3Q6BA 4BBNF 4YT0B 2KWVB 4PS3A 2N7EA 3R2TA 2KWDA 5D6JB 3NVZA 4K7SA 4RF1A 1TTNA 3DHIC 1WX7A 2JRIB 3BINA 4ZDVA 3BVMA 4M02A 1RM6C 2AQ3B 2QDFA 4KX6B 3R3MA 2WWZA 2KKCA 3EUB2 3VUXA 1E8ZA 2GBNA 4PS8A 3AEEB 4G3XB 1JWAD 3LDZE 2ZCBA 3A9KB 2CU3A 3W9CB 2JWZA 3T8MA 2BGFA 2KJHB 3GZNI 2MRPA 3DBSA 3KYDD 4HPLB 1EWCA 2DYBA 3E56A 3AI5A 4XC2A 3PRMB 3AE7B 4HPMB 4RFBA 1SJHD 4KDIC 2KMCA 2W3SA 5EE0A 2MBQA 2X38A 4TKNA 2KT7A 4OZAA 3OLMD 3DVNV 1YN3A 3A1QA 4KGTA 1E8WA 3VXWA 2X8XX 4MJSB 1RWSA 4M00A 2KD0A 1WR6E 2KQ7A 4IW0A 4GDLB 2M0XA 3NZUA 4ARCA 1IBXB 2N9KA 2YVCA 4GIVA 2G45B 1ENFA 2D3AA 2MJDA 1Q0WB 5LXHA 3SD5A 1T5XD 4PYZA 4HRSA 4C7YA 1I4QA 1I4HA 2K0PA 1KLVA 2MEKA 3DHHC 1E7UA 2MX2A 2M1MA 1GG3A 3L13A 1V1OA 4OVUA 5H8YE 4FBJB 3R8BA 1ZPSA 3DBHB 3GE3C 2QSDA 4RMAA 1TS2A 1WR1A 3H7PA 3R66C 1JCKB 3ZIMA 1HE8A 3TEYA 1WSPA 3ZJTA 3DBRB 3P4RB 2G9HD 2Z0EB 2KOXA 1UGJA 4PYUA 2JVCA 1E7VA 2GB1A 3ONSA 1I4RA 3HUIA 4L23A 2LGSA 2C9WB 2OJWA 1GB4A 4R3DA 3A4SC 5FR6A 4WURA 1AN8A 2D11A 2K25A 2WXPA 2PJHA 4XWWA 5BMHA 1MVKA 2GBRA 3I57A 1L7YA 1VD2A 3PTFC 4GLSC 5IO9A 4ITKA 3RN9C 3VR9B 1Q5WB 1V9JA 4ZRKA 2JYEA 2I38A 3Q8BA 1MG8A 5IOIA 4K3BA 4JL9A 2LHDA 5L95C 4ARIA 4BZAA 3KUCB 2L0FA 1XT9B 2QC8A 4HEA1 3JSVB 2ZW0A 3JVZX 3DWMA 3V05A 3W5VB 1ESFA 3OJ4B 4H2AA 4MSMB 3B9JA 1NYRA 2BS4B 2D3BA 5BMGA 3TIXA 1K8RB 1SE3A 4S0RA 2LVPA 3KWLA 1P9DU 3TMPB 1KLUD 2KC1A 1V80A 3H7SA 1RRBA 4W9IA 2Y5CA 3IG3A 2GI9A 2PKOA 4TQ1A 3PZ8A 1ZDXA 2J0KA 3U30A 1Q10A 2L76A 3A9KA 4WAFA 1WGKA 2CKHB 3AEBB 3PZDA 1FCLA 1VZ8A 4EE2A 5IP4D 3IT6B 1ZW7A 3W1SC 2B76B 3VAWA 2AL3A 1IYFA 2K8BA 4N58A 1FRRA 1NI2A 2MBHA 4LLGM 2IJ0A 1SSNA 3Q69A 4J6IA 1L6VA 1YIWA 2CHXA 2QILA 4KVGB 2IY1B 2CR5A 4MGIE 2G3QB 1HTOA 3VH3B 1E7PB 2ZNVC 2XK5B 1F2RI 3H6NA 1J0GA 4CHKA 1L0YB 2SAKA 3KUDB 1WIAA 4GDLA 2JXXA 1IBXA 2IYDB 1QOFA 1FXIA 3I63C 4BKTA 1E8YA 4F8CB 1FEHA 4REZA 1DYQA
chains in the Genus database with same CATH topology
5BYRA 1V97A 3AE1B 1OFFA 3AEAB 4AQ7A 1P7EA 2VZKB 3T3NA 1C77A 4ZOHC 3B2GA 1EM7A 4N6EB 4ZRPA 1D5XC 1OQQA 5MPOA 2BS2B 4JX1C 1BXTA 3LXFA 2I2YA 1KH0A 2R61A 3FILA 1JW9D 1UUPA 4RNAA 1VR9A 3P4PB 2WNMA 4O1NA 1TKGA 2DWQA 4TSSA 2N0SB 1I4GA 1C4PA 2ZW1A 4DXGA 1C78A 1RYJA 2PMVA 5FK9C 2YEPF 1TJEA 1Y56A 2IGDA 2HTME 2KACA 2AX5A 5FR3A 1JROA 1ACCA 2PVGC 3BYTB 1E0ZA 3L4PA 2KQ4X 1EWYC 1MPEA 4YXDB 3AMZA 1QOBA 1RFKA 1GPXA 1DOIA 1T3QA 3HVDA 1JWSD 1BMLC 1V1PA 3EA6A 3MJ5A 4USAA 1L0XB 4YTMB 3I9V1 2DYMA 2IGGA 1F2RC 2AQ1B 4YTNB 3FC4A 4FXCA 3SEBA 2BB5A 4MACA 2XN9C 5HFYA 4JWUC 4N59A 5E6JA 2Y5PA 4M0WA 2N9LA 1TZOA 4IKGA 2LFIA 3BIID 1K50A 4TMAB 3ZJUA 4C7ZA 1E10A 2JXTA 3FAHA 4ZHPA 2G1EA 2AQ2B 2D5GA 1NVID 2W82A 1ZXIA 3SR6A 3T3OA 1LO5D 1QKZA 2M0AA 1HEZE 1JQ4A 3AEFB 1XLOA 1K52A 4WIPA 3AM9A 1ET6A 3BYYB 1HQRD 1PGBA 1XCTL 3BVGA 2INPE 4OZBA 4JPSA 3P1MA 4D2KA 2OHFA 1TS4A 2JYTA 2BTEA 1FM0D 3AV8A 1QT9A 1XLNA 3AE2B 2KMMA 4HKZE 2M56B 2Y3AA 3U52E 2RMMA 3H8HA 2H88B 4NJCA 3AEGB 5T8IA 2BS3B 3BK1A 1E9MA 2BW2A 1J7BA 4KKIA 3W5UB 1V8CA 4ZYSA 4LTUA 4YSZB 2TSSA 1FCCC 1PUTA 1YJIA 3ABVB 1I4PA 1YNTE 4LK0M 1GB1A 2ONQA 3TSSA 3WCQA 1J7AA 1PYWD 1MI0A 3BZDB 4RF0A 3UI3A 5HG2A 3P63A 1JRPA 4HROA 1C4CA 1L4ZB 1XLPA 2L52A 3PO0A 3ZQ4A 2PW9A 3Q8EA 4KGRA 4C56C 4MM3B 3VRAB 1FXAA 1XF5L 3FILB 1UWXA 4RGOS 1FMAD 4KKJA 1MHHE 5C3JB 3TEZA 3NVWA 1C4AA 3NRZA 4HKQA 3GS2A 2NTTA 2XNAC 1KF6B 1VRAB 2H89B 3B2FA 3HVZA 3AECB 1JMLA 4A6QA 2MJEA 1K51A 2L32A 2MJ3A 2NTSA 2WDRB 5FKAC 1ZUD2 1FO4A 1XO3A 3ZYYX 1QOAA 2PTLA 3RPFC 1L5PA 2J52A 2OEDA 3CWIA 1N62A 3NUHB 3AE9B 4YT0B 1FNWA 3IAS1 4DXFA 3GP7A 2WXQA 3R2TA 4RGTA 1JWBD 1D4BA 2KWDA 5G5GA 3NVZA 2RPVA 1STEA 4RF1A 1FRDA 2N7JA 3IXSA 3BVMA 1CK1A 1TKYA 2LHEA 3U2SC 5I4DA 4RGNA 1RM6C 2MH7A 3AE3B 1SIJA 2LUMA 4A9AA 1F0ZA 2AQ3B 4KX6B 4A8XC 2WDVB 1VDVA 1ZOYB 2FBWB 3EUB2 4PT5A 1QQRA 3BWUD 4A55A 1WXQA 1NENB 2K3UA 1ET9A 3MFGA 3AEEB 1AWDA 2W55A 3SFEB 1JWAD 2WU2B 1QOGA 3W1SA 4WWMA 3AEDB 5LNK1 1DOYA 4ZHOA 1KRHA 2IPKD 1L4DB 4OHJA 2CU3A 4XDDA 3W9CB 1DOXA 5D7GA 3BK2A 3Q8FA 3Q8AA 3P4SB 3TUOA 1KFYB 1HXYD 2Q5WD 3NVVA 2L1AA 2WXLA 1BUIC 2J53A 1EWCA 3E56A 2WU5B 3AE7B 3ETRA 4RFBA 1SJHD 3DWGC 1B9RA 1QILA 2J42A 3AH7A 4YTPB 2W3SA 1A70A 1UNSA 1YJJA 4KGSA 5EE0A 2X38A 3SFDB 1UWMA 3U4EG 3URYA 4AS1A 1TY0A 4CQNA 1D5MC 1TKEA 5HI1A 3P4QB 1E6EB 2VZKD 4OZAA 1NI3A 1YN3A 2ON8A 3OWEB 4KGTA 3V3XA 3CIRB 1RWSA 3GB1A 3AE4B 1P7FA 2DLBA 1M4VA 2JX5A 1N5XA 4GDLB 4ARCA 1IBXB 4JE3B 1T6BX 2YEPB 1KTKA 2N9KA 3KLSX 3VQIA 1D5ZC 2CJOA 1ENFA 1N5WA 2MJDA 1YN5A 1C79A 4WH4A 2LEKA 1SXTA 1T5XD 4HRSA 5EE3A 4C7YA 1I4QA 1I4HA 2WXJA 1TY2A 3AB5A 2K0PA 2BBCA 2MEKA 2WXIA 1AYFA 5TSSA 2KN4A 4NAMA 2EELA 3AE6B 1IGDA 2E3TA 1V1OA 3VR8B 5H8YE 1SB3C 3AE5B 3R8BA 1QLBB 4YSXB 1ZPSA 4XDCA 2E6XA 2PLPA 1FNUA 2K9XA 2DYOA 1ZXHA 2QSDA 4XWTA 1TS2A 1FFUA 1WRIA 1JCKB 2CJNA 1IUEA 2ACZB 2WXMA 4RH6A 2LJIA 4MT5A 2V3NA 3TEYA 1WSPA 2LMCA 3ZJTA 1WWTA 3KQ4A 5GXGB 3RFZB 3P4RB 2G9HD 1UGJA 2IDYA 4YWGG 2RDGA 1GAQB 3P42A 3NS1A 1V1PB 2GB1A 2INNE 1I4RA 1VLBA 1VZ7A 2PIAA 1L0VB 3HUIA 1CZPA 1N63A 3BVZA 2WXKA 4L23A 4TQ0A 5JXVA 1SBBB 1GB4A 1TYGB 4IDIA 4Q2JA 4DQOC 4OVZA 4R3DA 1VZ6A 1YQ3B 1YN4A 1WYGA 2WDQB 2WXRA 4WURA 1AN8A 4XWWA 2WXPA 5BMHA 1MVKA 2WXFA 3I57A 2M19A 1HA5A 1XXGA 1J7CA 2WQYB 4GLSC 1N60A 1QF6A 4ITKA 1FD6A 3MC0B 3VR9B 4IOIE 1HZ6A 5D3DA 2W54A 5AUKA 1CJEA 2JYEA 4B0MA 2JSVX 1MHXA 2BB6A 1C9FA 4YSYB 2I38A 2QJLA 3Q8BA 1JWMD 4RGMA 1FNVA 2Z8LA 1YQ4B 1JWUD 3Q8CA 3IT4B 2WS3B 2LHDA 1C76A 5BYQA 4ARIA 1I7HA 3MHZA 3IAM1 2QMTA 4HEA1 2KAJA 5BYSA 1EU3A 4OW0A 5HHDG 3ZGZA 1XLQA 2ZW0A 1ROEA 3DWMA 4C80A 3V05A 5AUIA 4HJGE 3W5VB 1OQRA 3N9YC 1ESFA 2J4XA 1DGJA 4H2AA 2K5PA 3B9JA 4J3OD 1NYRA 2BS4B 5BMGA 1HZ5A 1L6UA 1SF0A 1CQVA 1SE3A 3KWLA 1TS5A 3R2IA 3TEXA 1R7SA 4XE0A 1KLUD 4L2YA 1N61A 3C8YA 2Y5CA 1FIQA 2BYTA 1PDXA 3LYYA 2GI9A 1TS3A 2PKOA 3ZJVA 4TQ1A 1SJED 2IGHA 1PFDA 3PZ8A 3AN1A 1ZDXA 2JWUA 2JZPA 1SE2A 1Q10A 1XCQL 2WXNA 3KWVA 3VRBB 1ZE3D 1GOZA 1D6EC 4WAFA 2V4IB 3NVYA 1VJKA 4NZLB 1PGXA 1WGKA 2JU6X 4GDKB 4JWSC 2NMQA 2K22A 3AEBB 1AW7A 5EE9A 3U7ZA 1FCLA 1VZ8A 1NYQA 2WLBA 3HRDD 4L1BA 1PGAA 1ZDVA 2PVOD 3IT6B 4EE2A 3MP9A 3O13A 2B76B 3AE8B 2ICIA 2FUG1 2WXOA 1JALA 1ZP0B 4N58A 4WQMA 3TEWA 2L83A 1FRRA 4A90A 1EU4A 2EKIA 3PZ7A 4LLGM 5D3IB 4MH8A 4RCOA 4ZRQA 2IJ0A 5H92C 1SSNA 2RDHA 3E9SA 3Q69A 5EE1A 1L6VA 4US9A 1FFVA 1F77A 2QILA 4UDUC 4P6VF 2WXHA 2WXGA 2GRIA 2SEBD 5BMIA 2QIEB 1E7PB 4B0EA 2DBYA 1SEBD 3W2DA 2V3PA 1IGCA 1F2RI 2QEJC 3J9CA 4US8A 1L0YB 2SAKA 1I4XA 4OZCA 4P16A 1B1ZA 2W3RA 2LGIA 3EGRA 5C2TB 2KDMA 2HDEA 1SE4A 1IBXA 1QOFA 5G5HA 1XEEA 1FXIA 3LB8C 1YMHE 2BT6A 1NEKB 4NAWB 2JQRB 1FEHA 4REZA 2WP9B 2V0GA 1DYQA 3NZ3A 1KLGD 1K53A 2FE8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1V97 A;  3P63 A;  3AE1 B;  1JRP A;  1OFF A;  3CIR B;  1I7H A;  3AEA B;  4HRO A;  1XLP A;  1RWS A;  2L52 A;  3PO0 A;  3AE4 B;  4C7Z A;  4ZOH C;  3B2G A;  4N6E B;  2KAJ A;  1FXA A;  3VRA B;  1OQQ A;  1N5X A;  2JX5 A;  5MPO A;  2BS2 B;  1XLQ A;  1FMA D;  4JX1 C;  1ROE A;  5C3J B;  3LXF A;  3DWM A;  3NVW A;  4C80 A;  5AUI A;  3NRZ A;  3W5V B;  1OQR A;  2CJO A;  1N5W A;  2MJD A;  1DGJ A;  1JW9 D;  2LEK A;  2K5P A;  3B9J A;  1NYR A;  2BS4 B;  1KF6 B;  4HRS A;  5EE3 A;  1L6U A;  2H89 B;  3AB5 A;  4C7Y A;  3B2F A;  3P4P B;  1SF0 A;  1TKG A;  2DWQ A;  3HVZ A;  2N0S B;  3AEC B;  1AYF A;  3KWL A;  1RYJ A;  1R7S A;  2MJE A;  2MJ3 A;  2WDR B;  1FO4 A;  1TJE A;  1ZUD 2;  1XO3 A;  1N61 A;  2HTM E;  3AE6 B;  3ZYY X;  2E3T A;  2AX5 A;  1QOA A;  1JRO A;  2PVG C;  3RPF C;  1L5P A;  1E0Z A;  2Y5C A;  1FIQ A;  3L4P A;  3VR8 B;  1PDX A;  3CWI A;  5H8Y E;  1SB3 C;  3AE5 B;  1EWY C;  1QLB B;  4YSX B;  4YXD B;  2PKO A;  3AMZ A;  1N62 A;  1QOB A;  3AE9 B;  1RFK A;  4YT0 B;  1GPX A;  1DOI A;  1PFD A;  1T3Q A;  3AN1 A;  1E10 A;  2K9X A;  1JWB D;  3VRB B;  4USA A;  5G5G A;  3NVZ A;  4YTM B;  1FFU A;  1WRI A;  3NVY A;  1VJK A;  1WGK A;  4JWS C;  3AEB B;  2K22 A;  2CJN A;  1IUE A;  1FRD A;  2ACZ B;  5EE9 A;  1TKY A;  4YTN B;  2WLB A;  1NYQ A;  3HRD D;  3FC4 A;  1RM6 C;  2MH7 A;  2PVO D;  1SIJ A;  1WWT A;  3AE3 B;  4FXC A;  5GXG B;  4A9A A;  1F0Z A;  3P4R B;  2B76 B;  4KX6 B;  2WDV B;  4JWU C;  1VDV A;  1ZOY B;  3AE8 B;  4N59 A;  2FBW B;  3EUB 2;  1JAL A;  1NEN B;  1WXQ A;  1GAQ B;  3BII D;  1ZP0 B;  4N58 A;  4WQM A;  3AEE B;  1AWD A;  1FRR A;  2L83 A;  2W55 A;  3FAH A;  3NS1 A;  2EKI A;  1JWA D;  2WU2 B;  1QOG A;  1VLB A;  2G1E A;  4WWM A;  3SFE B;  4ZHP A;  2PIA A;  1L0V B;  3AED B;  1NVI D;  3HUI A;  5H92 C;  1CZP A;  1N63 A;  1ZXI A;  1DOY A;  3SR6 A;  4ZHO A;  5EE1 A;  1L6V A;  1KRH A;  1FFV A;  4US9 A;  4P6V F;  2CU3 A;  1JQ4 A;  3AEF B;  1XLO A;  3W9C B;  1DOX A;  1TYG B;  4IDI A;  3AM9 A;  3P4S B;  1YQ3 B;  1WYG A;  2QIE B;  1E7P B;  2WDQ B;  1KFY B;  2DBY A;  2Q5W D;  3NVV A;  3P1M A;  2M19 A;  2OHF A;  1FM0 D;  3AV8 A;  1QT9 A;  1J7C A;  2WQY B;  1QF6 A;  1N60 A;  1XLN A;  3AE2 B;  4ITK A;  2KMM A;  2M56 B;  2WU5 B;  3VR9 B;  4US8 A;  2H88 B;  3AE7 B;  5C2T B;  3AEG B;  3ETR A;  2BS3 B;  2W3R A;  2W54 A;  1E9M A;  5AUK A;  1J7B A;  3W5U B;  3DWG C;  1V8C A;  1B9R A;  1CJE A;  4LTU A;  4YSZ B;  4YTP B;  3AH7 A;  4YSY B;  2W3S A;  1PUT A;  1QOF A;  2QJL A;  5G5H A;  1A70 A;  1YJJ A;  1FXI A;  1YJI A;  5EE0 A;  3ABV B;  3LB8 C;  3SFD B;  1UWM A;  2BT6 A;  1NEK B;  2JQR B;  3WCQ A;  1TKE A;  1YQ4 B;  1J7A A;  2WP9 B;  1E6E B;  3P4Q B;  2WS3 B;  1NI3 A; 
#chains in the Genus database with same CATH topology
 5BYR A;  3AE1 B;  3AEA B;  2KQS A;  2VZK B;  3PHW B;  3T3N A;  3P2B A;  1EM7 A;  3PRZ A;  4JX1 C;  1BXT A;  2CHZ A;  4S17 A;  1S1Q B;  2I2Y A;  2KAN A;  1UUP A;  3Q14 C;  3P4P B;  2EKE C;  4BOS C;  3RZW C;  3RUL A;  1C78 A;  3ZDT A;  1EO6 A;  4X57 B;  4LNI A;  1IPG A;  2K8C A;  2YEP F;  4ANV A;  4A20 A;  2MLB A;  4XX5 A;  2HTM E;  5FR3 A;  1WE7 A;  3BYT B;  1LFD A;  3V6E B;  1EWY C;  4YXD B;  3DHG C;  4P1B C;  1T3Q A;  1I35 A;  1BML C;  1C1Y B;  4OVV A;  1WGD A;  2KDI A;  3I9V 1;  1F2R C;  2AQ1 B;  1WX9 A;  4KSK C;  4MAC A;  2IO3 B;  4N59 A;  4HCP B;  3AXC A;  2BWE S;  2LFI A;  4RM8 A;  1P3Q U;  2AQ2 B;  4IG7 B;  4DHJ B;  2LVO A;  2GMI C;  3VTW A;  1XCT L;  4C4V B;  3BVG A;  4LJP B;  1YX6 B;  2OHF A;  2RMM A;  3H8H A;  3D32 A;  3OG5 A;  2BS3 B;  3JSV A;  2J0M A;  1E9M A;  3W5U B;  1V8C A;  1M94 A;  1FCC C;  1R4N B;  3APF A;  1YJI A;  4WJQ A;  1YNT E;  4LK0 M;  4WJP A;  2K1F A;  4RF0 A;  3UI3 A;  3ECI A;  2KNB A;  3PO0 A;  4WJO A;  2ZPN A;  3R7Q A;  3PSE B;  4KSL C;  3ZNG C;  2G4S A;  2XNA C;  3B2F A;  4A3O A;  4BKS D;  1JML A;  2K39 A;  4GSW A;  1WI0 A;  3ZXR A;  5FKA C;  3ZYY X;  5IAA C;  1TBE A;  2HE7 A;  3TJP A;  1N62 A;  3AE9 B;  1FNW A;  3GP7 A;  2KZR A;  2IBI B;  2WYQ A;  2KVZ A;  3PT2 B;  4MH0 E;  2NCN A;  1FRD A;  2N7J A;  2MQJ A;  4M0W B;  3ZTC A;  3AE3 B;  4A9A A;  1SIJ A;  2NBV B;  1WGH A;  2WDV B;  1VDV A;  1ZOY B;  5AZF A;  2K6Q A;  4B9K A;  2JZ3 B;  4PT5 A;  3V60 A;  4KZ0 A;  1KM7 A;  4TV3 A;  1QOG A;  2XK5 A;  4WWM A;  5DPR A;  2O6V B;  1DOY A;  2KFJ A;  1KRH A;  3DQV A;  4PK1 A;  4XDD A;  2BF8 B;  4EFO A;  3BK2 A;  3Q8F A;  3Q8A A;  2M17 A;  3VFK A;  1HXY D;  3ZNI D;  3NVV A;  2LGD A;  2DZK A;  3LJ3 A;  2W9N A;  1TIF A;  2WGS A;  1WM3 A;  3DWG C;  1QIL A;  3AH7 A;  4I6N B;  1YJJ A;  3ZRC A;  3U4E G;  1D5M C;  1GC6 A;  5HI1 A;  1NI3 A;  2ON8 A;  3OWE B;  3V3X A;  4FJZ A;  5JHA A;  3QC8 B;  1WYW B;  1TZ1 A;  1P7F A;  1GNU A;  2L05 A;  1M4V A;  4GU2 A;  1OEY A;  4JE3 B;  1T6B X;  3ZKJ C;  4BFR A;  2PE6 B;  3K9O B;  4W9E A;  1YN5 A;  3AB5 A;  2BVC A;  2K6D B;  2WXI A;  2KYW A;  2A5U A;  2EEL A;  2KLG A;  2N1W A;  2E3T A;  3TCA A;  3VR8 B;  2Z0D B;  3B08 A;  1EF1 A;  1HTQ A;  4LCD E;  2D3C A;  2GOW A;  1ZXH A;  5JHB A;  4XWT A;  1WRI A;  2ZPY A;  1WF9 A;  4KDL B;  2QCZ A;  2KTR A;  2BWF A;  2WXM A;  4MT5 A;  2LMC A;  3SU8 X;  4GDK A;  2RSU A;  4C4V A;  2N9X A;  1GAQ B;  5EDS A;  2LZ6 A;  3NS1 A;  1V1P B;  1T0Q C;  3PVL A;  1L0V B;  1CZP A;  1N63 A;  2PE9 A;  2WXK A;  2V9H A;  4IDI A;  2AEH A;  3ZVV A;  1WGY A;  3GE8 C;  1VZ6 A;  1WYG A;  2DEN B;  2WXF A;  3B0A A;  2KTF A;  5DPS A;  1QF6 A;  1N60 A;  3MC0 B;  2RDB C;  5AUK A;  2D10 A;  1CJE A;  1C3T A;  3V61 A;  1MHX A;  4YSY B;  4RGM A;  2QJL A;  3PLV A;  1JWM D;  1FNV A;  2Z8L A;  1JWU D;  3Q8C A;  1V5T A;  3IT4 B;  4AOF A;  2WS3 B;  1C76 A;  5BYQ A;  1I7H A;  4FJY A;  3UQB A;  2QMT A;  4EZK A;  2KAJ A;  4ZRJ A;  2DZM A;  5HHD G;  4KIK B;  3ZGZ A;  1XLQ A;  1WXS A;  4MGK E;  2J4X A;  2LVQ A;  3C19 A;  1RLF A;  4HXD A;  4J3O D;  4A3P A;  1HZ5 A;  1L6U A;  1SF0 A;  4HDO A;  3U8Z A;  1R7S A;  4L2Y A;  4B95 A;  1UZX B;  3OAW A;  2IY0 B;  3I5J C;  2BYT A;  2IGH A;  1PFD A;  3AN1 A;  2JZP A;  3DVG X;  4II2 B;  2O6V A;  2LJ5 A;  4C00 A;  1D6E C;  2V4I B;  1XQQ A;  3NG0 A;  1PGX A;  4JWS C;  1RFA A;  3U7Z A;  4L1B A;  1NYQ A;  3HRD D;  3X0W A;  1PGA A;  5L83 A;  3O13 A;  4QAY A;  1OEY J;  2ICI A;  2LRW A;  2L3Z A;  3PRE A;  1ZP0 B;  3TEW A;  2L83 A;  4A90 A;  2ZCC A;  1EU4 A;  5D3I B;  4MH8 A;  4RCO A;  5H92 C;  2LI5 A;  2JZZ A;  3E9S A;  5EE1 A;  3RNG C;  1F9J A;  2LWP A;  2FAZ A;  3QJZ A;  5BMI A;  2QIE B;  4B0E A;  2KN5 A;  4MGZ E;  2DBY A;  3FKY A;  2V3P A;  3Q3J A;  1IGC A;  3ZNH B;  2L0T A;  4US8 A;  3RD2 A;  5C2T B;  1WJ6 A;  2BQQ A;  4MEL A;  2HDE A;  2C60 A;  1SE4 A;  5JZE B;  2NVU I;  1YMH E;  2PPH A;  3DCG A;  4NAW B;  2I1K A;  3MC9 A;  2WP9 B;  4ANX A;  2V0G A;  2OOB B;  4FAD A;  1KLG D;  2FE8 A;  4IC7 B;  1L2N A;  1P7E A;  4E71 A;  1FXT B;  3MC8 A;  1C77 A;  4N6E B;  4ZRP A;  1WX8 A;  3PPA A;  1KH0 A;  3DOW A;  4DK5 A;  5E6O A;  2KC2 A;  2EMT A;  4RNA A;  2WNM A;  4DXG A;  2N1V A;  4ICU A;  2PMV A;  2FNJ B;  4FHK A;  2YLM A;  2KO3 A;  3RZF A;  2IGD A;  2KX0 A;  4E74 A;  2B3A A;  3VTV A;  3NHE B;  1E0Z A;  3L4P A;  1ZGU B;  1JWS D;  1SIF A;  1V1P A;  2AL6 A;  3EA6 A;  4LDT D;  4EKU A;  2MBE A;  5J18 A;  4GXB A;  3EC8 A;  3NJT A;  3FC4 A;  1R4M B;  2BB5 A;  4JWU C;  5E6J A;  2KWU B;  5IN7 A;  2N9L A;  1TZO A;  3L17 A;  2D2Q A;  3ZJU A;  4C7Z A;  4ZHP A;  5CTR C;  3AU4 A;  3SR6 A;  4EZL A;  1UBI A;  3T3O A;  4P7I A;  1JQ4 A;  3RUI B;  2ZVO A;  1ET6 A;  3L54 A;  1PGB A;  3RNF C;  4D2K A;  2MSE D;  1A5R A;  2JYT A;  2MBO A;  1F52 A;  2KMM A;  3ENE A;  2H88 B;  4NJC A;  3BK1 A;  3ZUN A;  2AWT A;  2JF5 A;  4W9F A;  2BW2 A;  1J7B A;  2GLS A;  2FCN A;  2MA9 B;  3KYC D;  3WAN A;  4YSZ B;  1GB1 A;  3L10 B;  1J7A A;  3S2A A;  5G55 A;  1V49 A;  3RMK C;  1JRP A;  4HRO A;  4MSQ B;  1XLP A;  3VVW B;  3ZQ4 A;  3Q8E A;  4MM3 B;  3FIL B;  4MJS A;  1FMA D;  3TEZ A;  3NVW A;  1MG4 A;  3NRZ A;  4HKQ A;  4BAX A;  2R2O A;  2I1J A;  4HDQ A;  2REX A;  4JLC A;  4AUQ C;  2MJE A;  2N9E B;  2L32 A;  2WDR B;  1ZUD 2;  2HJ8 A;  3VHT C;  4IUM B;  2PTL A;  3UIP B;  1FPY A;  3CWI A;  3IAS 1;  2V4L A;  3CF6 E;  2WXQ A;  2LGX A;  5AZG A;  4DDG D;  2FCQ A;  2KFK B;  1D4B A;  4ANW A;  3ZRF A;  3DBH I;  1SGH A;  4LNF A;  5AEK B;  3AUL A;  5I4D A;  1CK1 A;  1P98 A;  1TKY A;  4RGN A;  4DBG A;  3QCA A;  2MH7 A;  1F0Z A;  2LUM A;  2J0J A;  4I6L B;  1QQR A;  3BWU D;  1WXQ A;  1NEN B;  2K3U A;  1ET9 A;  3DBR I;  4B6W A;  1AWD A;  2W55 A;  2WU2 B;  1P0R A;  2WDT B;  5LNK 1;  3N3K B;  2ZEQ A;  4ZHO A;  3HHM A;  2IPK D;  1L4D B;  3MJW A;  3P4S B;  4LNN A;  1KFY B;  3M63 B;  4NAW A;  2Q5W D;  2FID A;  2MCN B;  1UF0 A;  2J53 A;  4ASW C;  3NZS A;  5D94 A;  5DPW A;  3ML9 A;  2LD9 A;  2NBW B;  2J42 A;  5LLI A;  1A70 A;  4DHZ B;  1UWM A;  3URY A;  4AS1 A;  1TKE A;  3P4Q B;  4WAA A;  1E6E B;  2VZK D;  2NPT B;  2N9P C;  3Q2A C;  3PV1 A;  3CIR B;  2M8S A;  3AE4 B;  5CHV C;  2DLB A;  2PEA A;  1KTK A;  3KLS X;  3M95 A;  1D5Z C;  4FLH A;  4NY0 A;  4G0N B;  3N1Y C;  1C79 A;  3N1Z C;  3NY5 A;  2LEK A;  4HK2 A;  4XZ4 A;  1SXT A;  2C5L C;  2WXJ A;  3SHQ A;  2BBC A;  1NBF C;  5TSS A;  3N30 A;  2NS5 A;  4AJW A;  4K81 A;  3Q3N C;  1QLB B;  4W9H A;  4XDC A;  2MHJ A;  2PLP A;  1FNU A;  2KDB A;  1V2Y A;  1IP9 A;  3V62 A;  4HLE A;  2CJN A;  2ACZ B;  4RH6 A;  3ZTD A;  1OGW A;  1WWT A;  5GXG B;  3DBL B;  3RFZ B;  3SDL C;  2IDY A;  4YWG G;  2RDG A;  4FJV B;  2JT4 B;  1E90 A;  1VZ7 A;  4DHJ D;  2R2Q A;  1UH6 A;  3BVZ A;  1Z5S B;  3HM6 X;  1TYG B;  3PS6 A;  4WWP A;  1ISN A;  2WXR A;  1WMH B;  3CMM B;  4PS7 A;  1F1H A;  5DCN A;  2M19 A;  1XXG A;  4ICV A;  4RM9 A;  3W1Y A;  1KJT A;  1HZ6 A;  3QX1 A;  4MM3 A;  5D3D A;  2W54 A;  2ZVN A;  3JYU A;  3EFC A;  2JSV X;  4K7W A;  2BB6 A;  1C9F A;  2C7H A;  2LXC A;  2KLC A;  4W9G A;  2RD0 A;  3MHZ A;  3DVN U;  3QK0 A;  1UD7 A;  5BO4 B;  4HJG E;  3N9Y C;  1E8X A;  2BKF A;  2K5P A;  3V6C B;  1WH3 A;  2XEW A;  1N6Z A;  2LGY A;  2JY6 A;  4AWJ A;  2IND C;  2XBB C;  4XE0 A;  1N61 A;  3O65 B;  3C8Y A;  2UU7 A;  3ZJV A;  1SJE D;  2GBM A;  4HJK A;  3VRB B;  1ZE3 D;  2JUO A;  1GOZ A;  3ZO5 B;  4F1S A;  3NVY A;  2DZI A;  2NMQ A;  1AW7 A;  3MP9 A;  3T9L A;  3AE8 B;  4K7U A;  1JAL A;  5G2N A;  2O6V D;  3PGE A;  1V86 A;  4WQM A;  2FCM A;  2HJ1 A;  1WJU A;  1E5W A;  3IBE A;  1FFV A;  3VH4 B;  3UIN B;  4M8N A;  2SEB D;  3QQ8 B;  4EUT A;  2MWS B;  2D3G A;  3W2D A;  2NPT A;  1V5O A;  5LXI B;  3APD A;  3J9C A;  1I4X A;  4P16 A;  1B1Z A;  2W3R A;  3C0R B;  3EGR A;  3IHP C;  2KDM A;  1XEE A;  3LB8 C;  1EF5 A;  1NEK B;  2JQR B;  3WIM A;  3I3T B;  1R4N I;  1K53 A;  1V97 A;  1OFF A;  4AQ7 A;  4N9F 4;  5C1Z A;  1AAR A;  1YD8 U;  4ZOH C;  3B2G A;  5MPO A;  2ZNV B;  2DX5 B;  4EOY A;  3HK0 A;  2R61 A;  1JW9 D;  1CMX B;  1JRU A;  1VR9 A;  1TKG A;  2DWQ A;  2N0S B;  2ZW1 A;  3EEC A;  1RYJ A;  1PQS A;  4GB9 A;  1WZ0 A;  1I42 A;  1Y56 A;  2O2V B;  3DDC B;  3PHX B;  3WAM A;  2DAF A;  5KHO A;  2AX5 A;  1H4R A;  3DBL I;  2KQ4 X;  1MPE A;  3AMZ A;  2LRU A;  3WAO A;  1RFK A;  4ACF A;  4MEM A;  1GPX A;  3Q3F A;  4YTM B;  1TGZ B;  2BPS A;  3UGB B;  2DYM A;  2IGG A;  1TT5 B;  4FXC A;  3L16 A;  2XN9 C;  3M3J A;  5HFY A;  1WMH A;  4P1C C;  2Y5P A;  4M0W A;  2DZJ A;  1UGM A;  4HVB A;  3BII D;  3BY4 B;  4M8M A;  4TMA B;  2HTH A;  5E6P A;  1BT0 A;  1QKZ A;  2M0A A;  5CHF A;  1WXV A;  1HEZ E;  2A4Z A;  3N32 A;  1K52 A;  2LAS A;  3ZDM C;  3AM9 A;  4XYC A;  4FHJ A;  2D07 B;  2INP E;  3NOB A;  4OZB A;  4JPS A;  3P1M A;  4LJO B;  4NPN A;  4KZC A;  1FM0 D;  3DPD A;  1QT9 A;  2KVR A;  3AE2 B;  3U52 E;  2Y3A A;  4KKI A;  2MP2 B;  4ZYS A;  1PUT A;  1WJ4 A;  4G50 A;  2ONQ A;  3WCQ A;  4TUU A;  1PYW D;  1MI0 A;  3BZD B;  3CSF A;  5HG2 A;  3P63 A;  1EUV B;  4W9D A;  3QIJ A;  1C4C A;  1T0S C;  1L4Z B;  2L52 A;  1P1A A;  4LNO A;  2PW9 A;  2QHO A;  4C56 C;  1FXA A;  2L8J A;  1XF5 L;  1UWX A;  4GMV A;  4RGO S;  4KKJ A;  1MHH E;  4IWQ A;  5C3J B;  1C4A A;  2RPQ A;  3GS2 A;  1KF6 B;  5CX3 A;  2H89 B;  4LDT B;  3HVZ A;  1WRD B;  3AEC B;  4IM3 A;  3K9P B;  4MDK E;  4A6Q A;  2MJ3 A;  2NTS A;  1FO4 A;  3KVF B;  1XO3 A;  1WJN A;  4FA6 A;  1QOA A;  2WX1 A;  1L5P A;  2OED A;  4FUL A;  1Y8R C;  3NUH B;  4W9C A;  4DXF A;  2GBJ A;  4RGT A;  1JWB D;  2HD5 B;  5G5G A;  1D3Z A;  2RPV A;  1STE A;  3IXS A;  3U2S C;  2LHE A;  3OJ3 A;  1WXM A;  4A8X C;  5AZH A;  1WZ3 A;  2FBW B;  1WGG A;  4A55 A;  4II3 B;  2KDE B;  3MFG A;  1MFW A;  5J2R A;  4W9J A;  3SFE B;  3QAR A;  3W1S A;  3Q3O C;  3AED B;  3KUZ A;  4GGQ A;  4BBN C;  4OHJ A;  2DNF A;  1DOX A;  1S3S G;  5CHW A;  5D7G A;  3MHS D;  3RT3 B;  3B1L X;  3TUO A;  2ASQ A;  3UF8 A;  2J7Q B;  3QHT A;  3PLU A;  2L1A A;  2WXL A;  1BUI C;  3QAQ A;  3ZLZ A;  2WU5 B;  2L00 B;  2IO1 B;  2V3S A;  3ETR A;  2KWC A;  4GN1 A;  2UWQ A;  1V81 A;  2DAJ A;  1B9R A;  4F7Z A;  4YTP B;  1UNS A;  4KGS A;  3SFD B;  1NDD A;  1TY0 A;  4CQN A;  3PRP B;  4MGY E;  1UBQ A;  3GB1 A;  5TR5 A;  2O2V A;  3Q3M C;  2JX5 A;  1N5X A;  4EZJ A;  3IVF A;  2OJR A;  2L7R A;  3DVG Y;  2YEP B;  4EEW A;  3EFU A;  4M01 A;  1LXD A;  3VQI A;  4BOZ B;  2CJO A;  3WA0 A;  1N5W A;  4KIK A;  4WH4 A;  1J8C A;  4W9L A;  4FN2 A;  5EE3 A;  1TY2 A;  1AYF A;  2KN4 A;  4NAM A;  4I6P A;  4IM2 A;  3AE6 B;  4W9K A;  1IGD A;  1SB3 C;  3AE5 B;  4YSX B;  1MJD A;  2E6X A;  2K9X A;  3L08 A;  2KDF B;  2DYO A;  2LXA A;  4JQW C;  1VCB A;  3QA8 A;  1FFU A;  2BYE A;  2N4F A;  4YL8 A;  2NBU A;  3WAL A;  1H8C A;  1IUE A;  5IKC M;  2LJI A;  2V3N A;  3KQ4 A;  2Z59 B;  3UIO B;  4GOC A;  3VUW A;  3P42 A;  1YOV B;  2INN E;  4IWO A;  3HIZ A;  1VLB A;  3RCZ A;  2PIA A;  2BYV E;  3N20 C;  2IO2 B;  1SE9 A;  1GUA B;  5KHQ A;  1OTR B;  4TQ0 A;  3A4R A;  1SBB B;  4WWN A;  4Q2J A;  5JXV A;  4DQO C;  4OVZ A;  1U4A A;  2KJR A;  2MP2 A;  3JW0 X;  1YQ3 B;  1YN4 A;  2WDQ B;  1Z2M A;  2WHI A;  4CO7 A;  3WAP A;  4AJY B;  1HA5 A;  5J17 A;  1J7C A;  2WQY B;  1FD6 A;  1G6J A;  4LNK A;  4IOI E;  5HKH A;  3H9D A;  4B0M A;  5D2M B;  2ZZP B;  1LM8 B;  5IA7 A;  1YQ4 B;  3A9J B;  2G4D B;  1X1M A;  3IAM 1;  4BVU C;  2AYO B;  2VH2 A;  5BYS A;  1EU3 A;  4OW0 A;  2VH1 A;  2C7M B;  3CST A;  3UQA A;  1KOT A;  1ROE A;  4C80 A;  5AUI A;  1OQR A;  1DGJ A;  5C23 A;  1YQB A;  1CQV A;  2MBB B;  1TS5 A;  3R2I A;  3TEX A;  3TL5 A;  3VDZ A;  1FIQ A;  3RI7 C;  2CHW A;  1PDX A;  3NS8 A;  1YX5 B;  3LYY A;  1TS3 A;  3APC A;  3QWZ B;  2RGF A;  2JWU A;  1SE2 A;  2KTR B;  1XCQ L;  2M4N A;  2WXN A;  3KWV A;  2EMS A;  3VUY A;  3RYT A;  4ANU A;  1VJK A;  4NZL B;  2JU6 X;  4GDK B;  1LGR A;  2K22 A;  2KHW B;  5EE9 A;  4HWI B;  2WLB A;  1ZDV A;  2PVO D;  1WE6 A;  2KJ6 A;  3MTN B;  4DWF A;  4DXA B;  2N7D A;  2FUG 1;  2WXO A;  2VRR B;  3ZXV A;  1R4M I;  3GOE A;  4DDI D;  2EKI A;  3PZ7 A;  4JIO U;  4E3C A;  4ZRQ A;  2NR2 A;  2RDH A;  4US9 A;  1F77 A;  4UDU C;  5GMV A;  4P6V F;  2WXH A;  2IZV B;  2WXG A;  2GRI A;  1QZE A;  2KMA A;  1SEB D;  1LQB A;  4NNJ B;  1GJZ A;  1YJ1 A;  2QEJ C;  2GBK A;  4HCN B;  2RR9 A;  4HPP A;  4OZC A;  2LGI A;  2FUH B;  5G5H A;  3GZN B;  2BT6 A;  4WQO B;  4K1R B;  3NZ3 A;  1WXA A;  4DHZ E;  1D5X C;  1OQQ A;  3RNC C;  2BS2 B;  2FIF A;  3KH0 A;  5E6N A;  3LXF A;  3ZNZ B;  3FIL A;  4NJ7 A;  1Q1O A;  4ZYN A;  4WJN A;  3A1Q B;  4O1N A;  4TSS A;  2V1Y A;  1I4G A;  1C4P A;  3L0W B;  5FK9 C;  2IO0 B;  1OQY A;  1TJE A;  3M62 B;  2KAC A;  1JRO A;  1ACC A;  2PVG C;  2JRH A;  1QOB A;  1DOI A;  3U7D A;  3HVD A;  2LUE A;  4IWP A;  4BKG A;  2CU1 A;  3RNA C;  4CYE A;  3MJ5 A;  4USA A;  1L0X B;  2CS4 A;  2K8H A;  2Y5B B;  2ZJD A;  2KFK A;  4YTN B;  4KV2 A;  3VTU A;  2JPH A;  3A33 B;  3SEB A;  2MW5 A;  2KK8 A;  3KW5 B;  4IKG A;  2C7N B;  5DPT A;  1K50 A;  1E10 A;  2JXT A;  3FAH A;  2G1E A;  4NQK E;  2D5G A;  1NVI D;  3H7P B;  2W82 A;  1ZXI A;  1T0R C;  3AU5 A;  1LO5 D;  4JGH B;  3AEF B;  1XLO A;  4WWO A;  4WIP A;  3IFW B;  3H1U A;  3X23 A;  3BYY B;  1HQR D;  4NQL B;  3R7R A;  1WFY A;  3RNB C;  3HM3 A;  2BKR B;  1TS4 A;  4NJ6 A;  2BTE A;  3A9J A;  3AV8 A;  4K3C A;  1XLN A;  4IM0 A;  3N1X C;  3RNE C;  4HKZ E;  2M56 B;  1WGR A;  3AEG B;  5T8I A;  3TBL D;  4ZRI A;  4LTU A;  2KX3 A;  2TSS A;  4XGA B;  1V6E A;  2KXJ A;  1ZKH A;  3ABV B;  1I4P A;  4URK A;  3TSS A;  2INC C;  3EHV A;  2DHZ A;  1UEL A;  3ZW3 A;  4AP4 C;  4BKS A;  4KGR A;  2FCS A;  3VRA B;  1GC7 A;  2UYZ B;  3ALB A;  1XD3 B;  2NTT A;  1VRA B;  2WX0 A;  2BYF A;  3ML8 A;  1K51 A;  1WM2 A;  5JH5 C;  1RAX A;  1J19 A;  3RPF C;  4G11 A;  2J52 A;  1WY8 A;  1T0Y A;  3Q6B A;  4BBN F;  4YT0 B;  2KWV B;  4PS3 A;  2N7E A;  3R2T A;  2KWD A;  5D6J B;  3NVZ A;  4K7S A;  4RF1 A;  1TTN A;  3DHI C;  1WX7 A;  2JRI B;  3BIN A;  4ZDV A;  3BVM A;  4M02 A;  1RM6 C;  2AQ3 B;  2QDF A;  4KX6 B;  3R3M A;  2WWZ A;  2KKC A;  3EUB 2;  3VUX A;  1E8Z A;  2GBN A;  4PS8 A;  3AEE B;  4G3X B;  1JWA D;  3LDZ E;  2ZCB A;  3A9K B;  2CU3 A;  3W9C B;  2JWZ A;  3T8M A;  2BGF A;  2KJH B;  3GZN I;  2MRP A;  3DBS A;  3KYD D;  4HPL B;  1EWC A;  2DYB A;  3E56 A;  3AI5 A;  4XC2 A;  3PRM B;  3AE7 B;  4HPM B;  4RFB A;  1SJH D;  4KDI C;  2KMC A;  2W3S A;  5EE0 A;  2MBQ A;  2X38 A;  4TKN A;  2KT7 A;  4OZA A;  3OLM D;  3DVN V;  1YN3 A;  3A1Q A;  4KGT A;  1E8W A;  3VXW A;  2X8X X;  4MJS B;  1RWS A;  4M00 A;  2KD0 A;  1WR6 E;  2KQ7 A;  4IW0 A;  4GDL B;  2M0X A;  3NZU A;  4ARC A;  1IBX B;  2N9K A;  2YVC A;  4GIV A;  2G45 B;  1ENF A;  2D3A A;  2MJD A;  1Q0W B;  5LXH A;  3SD5 A;  1T5X D;  4PYZ A;  4HRS A;  4C7Y A;  1I4Q A;  1I4H A;  2K0P A;  1KLV A;  2MEK A;  3DHH C;  1E7U A;  2MX2 A;  2M1M A;  1GG3 A;  3L13 A;  1V1O A;  4OVU A;  5H8Y E;  4FBJ B;  3R8B A;  1ZPS A;  3DBH B;  3GE3 C;  2QSD A;  4RMA A;  1TS2 A;  1WR1 A;  3H7P A;  3R66 C;  1JCK B;  3ZIM A;  1HE8 A;  3TEY A;  1WSP A;  3ZJT A;  3DBR B;  3P4R B;  2G9H D;  2Z0E B;  2KOX A;  1UGJ A;  4PYU A;  2JVC A;  1E7V A;  2GB1 A;  3ONS A;  1I4R A;  3HUI A;  4L23 A;  2LGS A;  2C9W B;  2OJW A;  1GB4 A;  4R3D A;  3A4S C;  5FR6 A;  4WUR A;  1AN8 A;  2D11 A;  2K25 A;  2WXP A;  2PJH A;  4XWW A;  5BMH A;  1MVK A;  2GBR A;  3I57 A;  1L7Y A;  1VD2 A;  3PTF C;  4GLS C;  5IO9 A;  4ITK A;  3RN9 C;  3VR9 B;  1Q5W B;  1V9J A;  4ZRK A;  2JYE A;  2I38 A;  3Q8B A;  1MG8 A;  5IOI A;  4K3B A;  4JL9 A;  2LHD A;  5L95 C;  4ARI A;  4BZA A;  3KUC B;  2L0F A;  1XT9 B;  2QC8 A;  4HEA 1;  3JSV B;  2ZW0 A;  3JVZ X;  3DWM A;  3V05 A;  3W5V B;  1ESF A;  3OJ4 B;  4H2A A;  4MSM B;  3B9J A;  1NYR A;  2BS4 B;  2D3B A;  5BMG A;  3TIX A;  1K8R B;  1SE3 A;  4S0R A;  2LVP A;  3KWL A;  1P9D U;  3TMP B;  1KLU D;  2KC1 A;  1V80 A;  3H7S A;  1RRB A;  4W9I A;  2Y5C A;  3IG3 A;  2GI9 A;  2PKO A;  4TQ1 A;  3PZ8 A;  1ZDX A;  2J0K A;  3U30 A;  1Q10 A;  2L76 A;  3A9K A;  4WAF A;  1WGK A;  2CKH B;  3AEB B;  3PZD A;  1FCL A;  1VZ8 A;  4EE2 A;  5IP4 D;  3IT6 B;  1ZW7 A;  3W1S C;  2B76 B;  3VAW A;  2AL3 A;  1IYF A;  2K8B A;  4N58 A;  1FRR A;  1NI2 A;  2MBH A;  4LLG M;  2IJ0 A;  1SSN A;  3Q69 A;  4J6I A;  1L6V A;  1YIW A;  2CHX A;  2QIL A;  4KVG B;  2IY1 B;  2CR5 A;  4MGI E;  2G3Q B;  1HTO A;  3VH3 B;  1E7P B;  2ZNV C;  2XK5 B;  1F2R I;  3H6N A;  1J0G A;  4CHK A;  1L0Y B;  2SAK A;  3KUD B;  1WIA A;  4GDL A;  2JXX A;  1IBX A;  2IYD B;  1QOF A;  1FXI A;  3I63 C;  4BKT A;  1E8Y A;  4F8C B;  1FEH A;  4REZ A;  1DYQ A; 
#chains in the Genus database with same CATH homology
 5BYR A;  1V97 A;  3AE1 B;  1OFF A;  3AEA B;  4AQ7 A;  1P7E A;  2VZK B;  3T3N A;  1C77 A;  4ZOH C;  3B2G A;  1EM7 A;  4N6E B;  4ZRP A;  1D5X C;  1OQQ A;  5MPO A;  2BS2 B;  4JX1 C;  1BXT A;  3LXF A;  2I2Y A;  1KH0 A;  2R61 A;  3FIL A;  1JW9 D;  1UUP A;  4RNA A;  1VR9 A;  3P4P B;  2WNM A;  4O1N A;  1TKG A;  2DWQ A;  4TSS A;  2N0S B;  1I4G A;  1C4P A;  2ZW1 A;  4DXG A;  1C78 A;  1RYJ A;  2PMV A;  5FK9 C;  2YEP F;  1TJE A;  1Y56 A;  2IGD A;  2HTM E;  2KAC A;  2AX5 A;  5FR3 A;  1JRO A;  1ACC A;  2PVG C;  3BYT B;  1E0Z A;  3L4P A;  2KQ4 X;  1EWY C;  1MPE A;  4YXD B;  3AMZ A;  1QOB A;  1RFK A;  1GPX A;  1DOI A;  1T3Q A;  3HVD A;  1JWS D;  1BML C;  1V1P A;  3EA6 A;  3MJ5 A;  4USA A;  1L0X B;  4YTM B;  3I9V 1;  2DYM A;  2IGG A;  1F2R C;  2AQ1 B;  4YTN B;  3FC4 A;  4FXC A;  3SEB A;  2BB5 A;  4MAC A;  2XN9 C;  5HFY A;  4JWU C;  4N59 A;  5E6J A;  2Y5P A;  4M0W A;  2N9L A;  1TZO A;  4IKG A;  2LFI A;  3BII D;  1K50 A;  4TMA B;  3ZJU A;  4C7Z A;  1E10 A;  2JXT A;  3FAH A;  4ZHP A;  2G1E A;  2AQ2 B;  2D5G A;  1NVI D;  2W82 A;  1ZXI A;  3SR6 A;  3T3O A;  1LO5 D;  1QKZ A;  2M0A A;  1HEZ E;  1JQ4 A;  3AEF B;  1XLO A;  1K52 A;  4WIP A;  3AM9 A;  1ET6 A;  3BYY B;  1HQR D;  1PGB A;  1XCT L;  3BVG A;  2INP E;  4OZB A;  4JPS A;  3P1M A;  4D2K A;  2OHF A;  1TS4 A;  2JYT A;  2BTE A;  1FM0 D;  3AV8 A;  1QT9 A;  1XLN A;  3AE2 B;  2KMM A;  4HKZ E;  2M56 B;  2Y3A A;  3U52 E;  2RMM A;  3H8H A;  2H88 B;  4NJC A;  3AEG B;  5T8I A;  2BS3 B;  3BK1 A;  1E9M A;  2BW2 A;  1J7B A;  4KKI A;  3W5U B;  1V8C A;  4ZYS A;  4LTU A;  4YSZ B;  2TSS A;  1FCC C;  1PUT A;  1YJI A;  3ABV B;  1I4P A;  1YNT E;  4LK0 M;  1GB1 A;  2ONQ A;  3TSS A;  3WCQ A;  1J7A A;  1PYW D;  1MI0 A;  3BZD B;  4RF0 A;  3UI3 A;  5HG2 A;  3P63 A;  1JRP A;  4HRO A;  1C4C A;  1L4Z B;  1XLP A;  2L52 A;  3PO0 A;  3ZQ4 A;  2PW9 A;  3Q8E A;  4KGR A;  4C56 C;  4MM3 B;  3VRA B;  1FXA A;  1XF5 L;  3FIL B;  1UWX A;  4RGO S;  1FMA D;  4KKJ A;  1MHH E;  5C3J B;  3TEZ A;  3NVW A;  1C4A A;  3NRZ A;  4HKQ A;  3GS2 A;  2NTT A;  2XNA C;  1KF6 B;  1VRA B;  2H89 B;  3B2F A;  3HVZ A;  3AEC B;  1JML A;  4A6Q A;  2MJE A;  1K51 A;  2L32 A;  2MJ3 A;  2NTS A;  2WDR B;  5FKA C;  1ZUD 2;  1FO4 A;  1XO3 A;  3ZYY X;  1QOA A;  2PTL A;  3RPF C;  1L5P A;  2J52 A;  2OED A;  3CWI A;  1N62 A;  3NUH B;  3AE9 B;  4YT0 B;  1FNW A;  3IAS 1;  4DXF A;  3GP7 A;  2WXQ A;  3R2T A;  4RGT A;  1JWB D;  1D4B A;  2KWD A;  5G5G A;  3NVZ A;  2RPV A;  1STE A;  4RF1 A;  1FRD A;  2N7J A;  3IXS A;  3BVM A;  1CK1 A;  1TKY A;  2LHE A;  3U2S C;  5I4D A;  4RGN A;  1RM6 C;  2MH7 A;  3AE3 B;  1SIJ A;  2LUM A;  4A9A A;  1F0Z A;  2AQ3 B;  4KX6 B;  4A8X C;  2WDV B;  1VDV A;  1ZOY B;  2FBW B;  3EUB 2;  4PT5 A;  1QQR A;  3BWU D;  4A55 A;  1WXQ A;  1NEN B;  2K3U A;  1ET9 A;  3MFG A;  3AEE B;  1AWD A;  2W55 A;  3SFE B;  1JWA D;  2WU2 B;  1QOG A;  3W1S A;  4WWM A;  3AED B;  5LNK 1;  1DOY A;  4ZHO A;  1KRH A;  2IPK D;  1L4D B;  4OHJ A;  2CU3 A;  4XDD A;  3W9C B;  1DOX A;  5D7G A;  3BK2 A;  3Q8F A;  3Q8A A;  3P4S B;  3TUO A;  1KFY B;  1HXY D;  2Q5W D;  3NVV A;  2L1A A;  2WXL A;  1BUI C;  2J53 A;  1EWC A;  3E56 A;  2WU5 B;  3AE7 B;  3ETR A;  4RFB A;  1SJH D;  3DWG C;  1B9R A;  1QIL A;  2J42 A;  3AH7 A;  4YTP B;  2W3S A;  1A70 A;  1UNS A;  1YJJ A;  4KGS A;  5EE0 A;  2X38 A;  3SFD B;  1UWM A;  3U4E G;  3URY A;  4AS1 A;  1TY0 A;  4CQN A;  1D5M C;  1TKE A;  5HI1 A;  3P4Q B;  1E6E B;  2VZK D;  4OZA A;  1NI3 A;  1YN3 A;  2ON8 A;  3OWE B;  4KGT A;  3V3X A;  3CIR B;  1RWS A;  3GB1 A;  3AE4 B;  1P7F A;  2DLB A;  1M4V A;  2JX5 A;  1N5X A;  4GDL B;  4ARC A;  1IBX B;  4JE3 B;  1T6B X;  2YEP B;  1KTK A;  2N9K A;  3KLS X;  3VQI A;  1D5Z C;  2CJO A;  1ENF A;  1N5W A;  2MJD A;  1YN5 A;  1C79 A;  4WH4 A;  2LEK A;  1SXT A;  1T5X D;  4HRS A;  5EE3 A;  4C7Y A;  1I4Q A;  1I4H A;  2WXJ A;  1TY2 A;  3AB5 A;  2K0P A;  2BBC A;  2MEK A;  2WXI A;  1AYF A;  5TSS A;  2KN4 A;  4NAM A;  2EEL A;  3AE6 B;  1IGD A;  2E3T A;  1V1O A;  3VR8 B;  5H8Y E;  1SB3 C;  3AE5 B;  3R8B A;  1QLB B;  4YSX B;  1ZPS A;  4XDC A;  2E6X A;  2PLP A;  1FNU A;  2K9X A;  2DYO A;  1ZXH A;  2QSD A;  4XWT A;  1TS2 A;  1FFU A;  1WRI A;  1JCK B;  2CJN A;  1IUE A;  2ACZ B;  2WXM A;  4RH6 A;  2LJI A;  4MT5 A;  2V3N A;  3TEY A;  1WSP A;  2LMC A;  3ZJT A;  1WWT A;  3KQ4 A;  5GXG B;  3RFZ B;  3P4R B;  2G9H D;  1UGJ A;  2IDY A;  4YWG G;  2RDG A;  1GAQ B;  3P42 A;  3NS1 A;  1V1P B;  2GB1 A;  2INN E;  1I4R A;  1VLB A;  1VZ7 A;  2PIA A;  1L0V B;  3HUI A;  1CZP A;  1N63 A;  3BVZ A;  2WXK A;  4L23 A;  4TQ0 A;  5JXV A;  1SBB B;  1GB4 A;  1TYG B;  4IDI A;  4Q2J A;  4DQO C;  4OVZ A;  4R3D A;  1VZ6 A;  1YQ3 B;  1YN4 A;  1WYG A;  2WDQ B;  2WXR A;  4WUR A;  1AN8 A;  4XWW A;  2WXP A;  5BMH A;  1MVK A;  2WXF A;  3I57 A;  2M19 A;  1HA5 A;  1XXG A;  1J7C A;  2WQY B;  4GLS C;  1N60 A;  1QF6 A;  4ITK A;  1FD6 A;  3MC0 B;  3VR9 B;  4IOI E;  1HZ6 A;  5D3D A;  2W54 A;  5AUK A;  1CJE A;  2JYE A;  4B0M A;  2JSV X;  1MHX A;  2BB6 A;  1C9F A;  4YSY B;  2I38 A;  2QJL A;  3Q8B A;  1JWM D;  4RGM A;  1FNV A;  2Z8L A;  1YQ4 B;  1JWU D;  3Q8C A;  3IT4 B;  2WS3 B;  2LHD A;  1C76 A;  5BYQ A;  4ARI A;  1I7H A;  3MHZ A;  3IAM 1;  2QMT A;  4HEA 1;  2KAJ A;  5BYS A;  1EU3 A;  4OW0 A;  5HHD G;  3ZGZ A;  1XLQ A;  2ZW0 A;  1ROE A;  3DWM A;  4C80 A;  3V05 A;  5AUI A;  4HJG E;  3W5V B;  1OQR A;  3N9Y C;  1ESF A;  2J4X A;  1DGJ A;  4H2A A;  2K5P A;  3B9J A;  4J3O D;  1NYR A;  2BS4 B;  5BMG A;  1HZ5 A;  1L6U A;  1SF0 A;  1CQV A;  1SE3 A;  3KWL A;  1TS5 A;  3R2I A;  3TEX A;  1R7S A;  4XE0 A;  1KLU D;  4L2Y A;  1N61 A;  3C8Y A;  2Y5C A;  1FIQ A;  2BYT A;  1PDX A;  3LYY A;  2GI9 A;  1TS3 A;  2PKO A;  3ZJV A;  4TQ1 A;  1SJE D;  2IGH A;  1PFD A;  3PZ8 A;  3AN1 A;  1ZDX A;  2JWU A;  2JZP A;  1SE2 A;  1Q10 A;  1XCQ L;  2WXN A;  3KWV A;  3VRB B;  1ZE3 D;  1GOZ A;  1D6E C;  4WAF A;  2V4I B;  3NVY A;  1VJK A;  4NZL B;  1PGX A;  1WGK A;  2JU6 X;  4GDK B;  4JWS C;  2NMQ A;  2K22 A;  3AEB B;  1AW7 A;  5EE9 A;  3U7Z A;  1FCL A;  1VZ8 A;  1NYQ A;  2WLB A;  3HRD D;  4L1B A;  1PGA A;  1ZDV A;  2PVO D;  3IT6 B;  4EE2 A;  3MP9 A;  3O13 A;  2B76 B;  3AE8 B;  2ICI A;  2FUG 1;  2WXO A;  1JAL A;  1ZP0 B;  4N58 A;  4WQM A;  3TEW A;  2L83 A;  1FRR A;  4A90 A;  1EU4 A;  2EKI A;  3PZ7 A;  4LLG M;  5D3I B;  4MH8 A;  4RCO A;  4ZRQ A;  2IJ0 A;  5H92 C;  1SSN A;  2RDH A;  3E9S A;  3Q69 A;  5EE1 A;  1L6V A;  4US9 A;  1FFV A;  1F77 A;  2QIL A;  4UDU C;  4P6V F;  2WXH A;  2WXG A;  2GRI A;  2SEB D;  5BMI A;  2QIE B;  1E7P B;  4B0E A;  2DBY A;  1SEB D;  3W2D A;  2V3P A;  1IGC A;  1F2R I;  2QEJ C;  3J9C A;  4US8 A;  1L0Y B;  2SAK A;  1I4X A;  4OZC A;  4P16 A;  1B1Z A;  2W3R A;  2LGI A;  3EGR A;  5C2T B;  2KDM A;  2HDE A;  1SE4 A;  1IBX A;  1QOF A;  5G5H A;  1XEE A;  1FXI A;  3LB8 C;  1YMH E;  2BT6 A;  1NEK B;  4NAW B;  2JQR B;  1FEH A;  4REZ A;  2WP9 B;  2V0G A;  1DYQ A;  3NZ3 A;  1KLG D;  1K53 A;  2FE8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...