2AX5A

Solution structure of urm1 from saccharomyces cerevisiae
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
99
structure length
99
Chain Sequence
MVNVKVEFLGGLDAIFGKQRVHKIKMDKEDPVTVGDLIDHIVSTMINNPNDVSIFIEDDSIRPGIITLINDTDWELEGEKDYILEDGDIISFTSTLHGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of Urm1 and its implications for the origin of protein modifiers.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Signaling protein
molecule keywords Hypothetical 11.0 kDa protein in FAA3-MAS3 intergenic region
total genus 15
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2005-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09138 Urm1 Urm1 (Ubiquitin related modifier)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2ax5A00
1XLOA 5H92C 4N58A 1CZPA 3VRAB 4JWSC 2G1EA 4ZHOA 1ROEA 3AEFB 3L4PA 3NS1A 4USAA 4KX6B 3EUB2 1PFDA 3ZYYX 2EKIA 1JWBD 4WQMA 1AYFA 2OHFA 1N61A 1E7PB 1VDVA 4WWMA 4YTPB 1N63A 1UWMA 2BT6A 2Q5WD 3AE5B 3AE7B 3AEDB 1J7AA 1WRIA 4YSYB 5MPOA 2MH7A 4N6EB 2JQRB 1AWDA 1FIQA 2MJDA 1FMAD 2DWQA 3AE4B 1FXAA 1R7SA 1DGJA 1EWYC 1KF6B 1RFKA 3DWGC 4C7ZA 3NVZA 3ETRA 1E6EB 4C80A 3HVZA 5EE9A 4ZHPA 1TKGA 1FM0D 1TKYA 2L52A 1NEKB 1GPXA 5G5HA 2WU2B 3LB8C 1TJEA 3AB5A 1E0ZA 3CWIA 1J7CA 2FBWB 3P1MA 4ZOHC 3W9CB 1FO4A 1WYGA 2KMMA 2WP9B 1JQ4A 3HUIA 3AE2B 2PKOA 2W3SA 3NRZA 1N5XA 1QOFA 2M19A 1SB3C 2ACZB 1QOGA 2M56B 3SFEB 3B2FA 1N62A 1N5WA 1V97A 3WCQA 1ZXIA 5EE1A 1NI3A 1QT9A 4YXDB 1JROA 3P4PB 1V8CA 5H8YE 1I7HA 2CU3A 1CJEA 1NYRA 3AV8A 2JX5A 3NVWA 4N59A 5C3JB 5EE0A 3PO0A 4JX1C 3SR6A 2AX5A 1DOIA 3ABVB 1FFUA 3P4QB 2L83A 5AUKA 3W5VB 3W5UB 1ZOYB 3AEGB 1QLBB 3HRDD 3AMZA 4JWUC 2KAJA 1RWSA 1YJJA 3P4RB 1QF6A 2WS3B 1XLQA 2BS3B 3P4SB 1FXIA 3AE3B 1ZUD2 2B76B 1FFVA 4IDIA 1QOAA 5GXGB 2MJEA 2H88B 1PDXA 4A9AA 1QOBA 5EE3A 3B9JA 1J7BA 1N60A 1XLNA 2W54A 3AN1A 3FAHA 1SF0A 4US9A 1IUEA 2BS4B 3RPFC 3B2GA 3SFDB 1TKEA 1L5PA 2BS2B 2E3TA 2K5PA 4YTNB 1JRPA 4YTMB 2WU5B 1JW9D 2LEKA 3VRBB 1T3QA 2CJOA 1L0VB 2Y5CA 1JALA 4YSZB 1KFYB 2WDRB 5C2TB 3NVYA 5AUIA 1XLPA 1JWAD 2H89B 2WDQB 1OFFA 3FC4A 3LXFA 1XO3A 1DOYA 3AE8B 1E9MA 1NENB 2QIEB 4YSXB 3AE1B 1DOXA 1YJIA 1WXQA 2W3RA 1ZP0B 1L6VA 2DBYA 3AEEB 1WWTA 3AE9B 3VR8B 1YQ3B 2WDVB 1B9RA 1RYJA 3AEBB 2PIAA 1SIJA 2CJNA 3AE6B 2WLBA 2PVOD 3AECB 1FRDA 1TYGB 4HRSA 4US8A 1RM6C 4HROA 2W55A 1A70A 2K9XA 1OQQA 3P63A 1L6UA 1VJKA 3AH7A 1GAQB 1OQRA 3DWMA 1VLBA 2K22A 2N0SB 4P6VF 3VR9B 3BIID 1F0ZA 4C7YA 3AEAB 4ITKA 3AM9A 3CIRB 3KWLA 1WGKA 3NVVA 5G5GA 4YT0B 2PVGC 4FXCA 4LTUA 1NYQA 1PUTA 2WQYB 1YQ4B 1E10A 1KRHA 1FRRA 1NVID 2MJ3A 2QJLA 2HTME
chains in the Genus database with same CATH superfamily
2YVCA 4LCDE 4BZAA 3AEFB 4KX6B 3EUB2 4IKGA 2DYMA 2EKIA 2RDGA 4Q2JA 2Q5WD 2C60A 1A5RA 3TEZA 4KKIA 2D3BA 2MJDA 1FIQA 2D10A 1ENFA 4GXBA 3ETRA 3ZTDA 2PJHA 3NOBA 4A90A 2LWPA 4KKJA 1ZDVA 4HK2A 2KJ6A 4RFBA 2NBVB 1SXTA 1UBQA 5EE1A 2J42A 3KW5B 3NS8A 2MA9B 2D11A 4JX1C 4LLGM 4GSWA 2I2YA 3Q3MC 1XLQA 1HQRD 1FXIA 1K52A 3ZLZA 1ZUD2 3DVNU 4IWOA 4P1CC 4RGOS 2WNMA 2LD9A 2C7NB 2NPTB 2IBIB 2QHOA 3ENEA 1ET6A 4YL8A 2E3TA 4FHJA 3VRBB 1JW9D 1FCCC 2KVZA 3ZW3A 1JALA 2I1JA 3LJ3A 3PSEB 2FCQA 4HLEA 3DBLI 2O6VA 4G3XB 1Q5WB 5AZHA 4REZA 1PGBA 1F77A 1RYJA 3EGRA 2Y5PA 3AECB 1VR9A 2J53A 4RMAA 4WWNA 2KDFB 2ZPNA 1T0QC 1Y8RC 2DZKA 1JWSD 4DXGA 3PPAA 3PV1A 3P4SB 3SD5A 2DZJA 5H92C 4CYEA 1STEA 3ONSA 4RM8A 2DZMA 3MHSD 5J18A 2PE6B 2G4SA 1EO6A 4AWJA 3MTNB 1UELA 1GUAB 3BVGA 1YN4A 1WJ4A 2PEAA 3TEYA 2BWFA 2INDC 4KSLC 3AULA 2AL6A 3W1YA 4MEMA 3X0WA 1JROA 3ZUNA 4M0WA 5H8YE 3QK0A 3NVWA 1Q10A 3SR6A 4WIPA 3HHMA 1QLBB 3A33B 2MRPA 3P4RB 3V05A 4KSKC 3KYDD 3RNGC 4WWPA 4MH0E 5BYQA 1PDXA 3N9YC 3FAHA 1SF0A 3OWEB 2L7RA 1S1QB 2GRIA 1FNWA 3ML8A 3PLVA 1I4PA 1YD8U 4ANWA 5AUIA 2WYQA 4K3BA 2WX1A 2WXNA 2JZPA 1EF5A 1C79A 3GZNI 1HE8A 2GBKA 2ON8A 2C9WB 4W9LA 3PHWB 2WXMA 1WXQA 1R4NI 3AU4A 1WWTA 1HXYD 3IT6B 2KANA 2D3CA 2UU7A 1E7VA 5JH5C 2BW2A 2PVOD 2V0GA 4HPLB 1TGZB 4OVVA 2BWES 4TSSA 2SEBD 4BKTA 4IC7B 1GAQB 3DWMA 2K22A 2JWUA 3RMKC 5JHBA 1XF5L 1SIFA 4RF1A 1JCKB 4S17A 4F7ZA 3ZJUA 4KGRA 3CMMB 2K0PA 1UGJA 4ICUA 3RD2A 4YWGG 4ACFA 4WJNA 3H6NA 4FN2A 2GBRA 1FMAD 1YJ1A 1MVKA 1KF6B 3DWGC 2RMMA 4AP4C 3V6EB 2ZEQA 1FM0D 1JWMD 3GE3C 3LB8C 3CWIA 4RGTA 3L10B 1WGYA 5IP4D 2WP9B 3A4RA 1L0YB 5FR3A 3ECIA 1QOFA 4A20A 2JZ3B 1V97A 2V9HA 4XX5A 3R3MA 3KQ4A 1NI3A 1V49A 4MM3B 3A9KB 1FEHA 2KC2A 1WZ0A 1V1PA 2KXJA 3WA0A 2BS3B 2KLGA 2AEHA 3VQIA 3DHHC 1KOTA 2BVCA 4LJPB 5FKAC 2WXQA 5DPWA 4F1SA 1Z2MA 4II3B 5C23A 4ZRKA 1TKEA 2ZW0A 4RF0A 1IP9A 2QSDA 2RD0A 3HM6X 4ANUA 3BZDB 4IM0A 1OFFA 2BGFA 3ZGZA 4JL9A 4O1NA 2FE8A 4NJCA 1TY0A 4K7UA 4E3CA 1C1YB 2L1AA 1SIJA 2CJNA 3M95A 3UI3A 2JVCA 1FRDA 1TYGB 4NJ7A 2FCNA 4C4VB 1HZ5A 1TS4A 2PE9A 4IWPA 2K8CA 3RT3B 3JYUA 3NVVA 2LVQA 1BXTA 1KRHA 3SDLC 2KDIA 2MBOA 2HDEA 4JQWC 1D5ZC 5G55A 2BKRB 1PFDA 2DYOA 4BAXA 3VHTC 4M01A 1JWBD 4I6NB 1AYFA 3H7SA 1SEBD 2MH7A 3IXSA 4N6EB 1SBBB 4MGZE 4R3DA 2FCSA 1WXSA 4I6LB 1M4VA 3AB5A 2GOWA 2RR9A 3K9OB 1E0ZA 2D5GA 2FBWB 2Z59B 1QZEA 5HI1A 2KWVB 2GI9A 4LNKA 1N5XA 5CX3A 4B95A 2M56B 2V3SA 3WCQA 3EECA 4MGKE 1V8CA 2VZKD 2DHZA 4TMAB 2JUOA 1V2YA 4KGSA 2G4DB 2R2OA 1WJ6A 2OJWA 3NY5A 1P7EA 1UZXB 4IDIA 4DHJB 1WFYA 2QCZA 2MQJA 3VXWA 1XQQA 4US9A 3RPFC 1L5PA 2NTTA 3LDZE 2RDHA 3WAOA 1V80A 2Y5BB 2NS5A 1IGCA 3IAM1 4J6IA 4EFOA 5AZFA 1UH6A 1ZKHA 3AE8B 4W9IA 1YNTE 3T9LA 3V60A 4EZLA 1UD7A 2KFKB 2KQ4X 2KX0A 3H7PB 1TS5A 3AE6B 3OJ4B 4HRSA 3M63B 1WYWB 1YX6B 1PGXA 2K1FA 1ZPSA 4PT5A 2N1VA 5KHOA 3RUIB 2KMCA 3TUOA 1V9JA 4LTUA 2KK8A 4TKNA 2HJ1A 4F8CB 4KVGB 3A1QB 3NS1A 3M3JA 2PLPA 2KHWB 3ZDTA 1N63A 1CK1A 2LI5A 3A1QA 3RN9C 1QILA 4MSMB 3T3NA 3KUZA 1K50A 2DX5B 4PYZA 2WXIA 4A3OA 2NPTA 3CF6E 2JSVX 2PKOA 2L76A 3N1XC 4TQ0A 1L2NA 3B2FA 4W9DA 2LJ5A 3I3TB 2ZNVC 4K7WA 4LNOA 1WX7A 4HPMB 3TMPB 2BPSA 1ISNA 1OQYA 5AUKA 2WXGA 2FAZA 2KAJA 2G9HD 3I63C 3KUDB 3R2IA 2EMTA 3TBLD 3H7PA 2N9LA 3CSTA 3NZUA 1MG8A 1TT5B 3GB1A 2GMIC 4TV3A 1I4GA 4WQOB 1WM3A 3AU5A 1HEZE 2KJHB 3QHTA 4M00A 1LGRA 3BYYB 3MJWA 1MPEA 1TS2A 3AE1B 4J3OD 2W3RA 2QEJC 3VUXA 2XEWA 3VR8B 3OG5A 1F2RC 2WXKA 3Q8AA 4LNIA 2HTHA 1GB4A 2LGIA 5IAAC 4KV2A 4XDDA 3Q8CA 4GDLB 3AEAB 4ITKA 3HM3A 2KN5A 2BYTA 2UYZB 3RFZB 1C4AA 1E10A 4HJGE 4WAFA 4BFRA 1RRBA 4HEA1 3KYCD 1KLVA 4N58A 4NAWB 4JWSC 4ANXA 2A4ZA 1WE7A 4ZRPA 2MWSB 3AXCA 2XBBC 5D2MB 1RFKA 1DGJA 3L54A 4C7ZA 3R7RA 2BBCA 1K53A 4B6WA 1NEKB 3I5JC 1E7UA 2DAJA 2ZVOA 1FO4A 3L0WB 5DPRA 3R2TA 2ACZB 2Z0EB 2G45B 1N62A 4DHZB 2KTFA 4IM3A 2KDBA 1TZ1A 3IBEA 2AX5A 1LM8B 5G2NA 2NTSA 3ZJTA 2JPHA 3I57A 1Q1OA 4JPSA 4RGNA 5LXHA 1YN3A 2JXTA 2KT7A 2N7DA 2C7MB 1FXTB 1J19A 2CU1A 2H88B 2V3NA 2ONQA 4BBNC 3ZO5B 2REXA 1D3ZA 1ESFA 3PRMB 2JYEA 4GLSC 4NNJB 2RPQA 2LRWA 2J52A 1WXVA 3ZXVA 2W82A 4NAWA 1P1AA 1Z5SB 4K81A 3ALBA 4G11A 1ZP0B 3HK0A 2D3AA 3SU8X 4AJWA 4OZCA 3NZSA 3WALA 4JLCA 3V62A 2L00B 4EZKA 4C56C 2K8HA 2LGXA 2JU6X 2GBJA 1PUTA 2CR5A 4HWIB 2ZW1A 4W9CA 4ZHOA 1LXDA 3L4PA 3P42A 3NJTA 1BMLC 4XC2A 4NJ6A 4YSYB 3VVWB 1AWDA 1TKYA 1DYQA 4FLHA 3E56A 5IA7A 4OZAA 3RZFA 3LYYA 4KZ0A 3JSVB 1N5WA 1WMHA 4UDUC 3DBRI 1E8YA 2JX5A 3JSVA 3U4EG 3KUCB 1ZW7A 1XXGA 1T6BX 2BQQA 1YJJA 2RSUA 1F1HA 1GOZA 2A5UA 1AW7A 5L83A 1E90A 2D2QA 3PZ7A 3SEBA 3M62B 1J7BA 4PS3A 1B1ZA 3BY4B 1C3TA 1WSPA 2KOXA 2KQSA 1WE6A 4XDCA 4B9KA 2JF5A 2BTEA 2HD5B 1ZDXA 5C2TB 4DDGD 3NVYA 2L05A 5CHWA 1R4NB 3L17A 3V3XA 2LGSA 1C9FA 3L13A 1DOXA 1T0YA 2DLBA 3DVGX 1C77A 3AE9B 4ZYSA 1UBIA 2FIFA 4PS7A 5CHVC 1BT0A 4K7SA 3NUHB 2KMAA 2GB1A 3VR9B 1WXAA 5FR6A 1TTNA 2D07B 1KH0A 4I6PA 4LNNA 4E71A 1ET9A 2JZZA 1E8XA 2LHDA 1UWMA 1I4XA 1WRIA 3APFA 4W9GA 5BYRA 4P7IA 2JQRB 3AI5A 2Y3AA 4IWQA 3AE4B 3NVZA 3C8YA 1E6EB 3U7ZA 2NVUI 1YIWA 2FUHB 3B0AA 5IKCM 3P2BA 4MH8A 4WURA 1J7CA 4S0RA 5CTRC 3BINA 4P1BC 4W9HA 2KQ7A 3DHIC 4IW0A 3SFEB 2MBQA 3TSSA 4ZDVA 3ZVVA 1VZ7A 3VUWA 5LNK1 1OEYA 1E8WA 2AWTA 2IO0B 4JWUC 3APCA 3X23A 2V4LA 2BB5A 3QIJA 2MBBB 1NI2A 2AL3A 1FFVA 4ICVA 2LFIA 5EE3A 2K25A 2ZCBA 5KHQA 3U7DA 1V86A 3SFDB 3JVZX 3ZQ4A 3Q2AC 1T3QA 4YSZB 4W9EA 1JWAD 3B1LX 3OLMD 1LO5D 3LXFA 4PYUA 1DOYA 4GU2A 3IT4B 2GBMA 1LQBA 1ZE3D 4KIKA 2J0MA 2VZKB 2HJ8A 2WDVB 2IO2B 4MSQB 2NBUA 4BOSC 4ZRIA 3S2AA 2IY0B 3K9PB 1XCTL 2JYTA 1UUPA 3DBRB 1R4MB 3AM9A 1WGKA 4NZLB 3C0RB 1YQ4B 3DPDA 3UGBB 1P7FA 2MJ3A 1XLOA 3ZNHB 4WWOA 1TY2A 2GBNA 2XK5B 1T0SC 3Q3OC 4RNAA 1SGHA 1L7YA 1N61A 1ZXHA 2Z0DB 3RNCC 3O65B 4FBJB 1WH3A 2N9PC 1R7SA 1D5XC 2WX0A 2TSSA 4C80A 4KDIC 1GPXA 4CHKA 5G5HA 2BB6A 4LJOB 2KWUB 5E6JA 1F2RI 1FD6A 4TQ1A 4HPPA 2KTRB 2ZPYA 4FJZA 2AQ2B 2FCMA 1K8RB 2IPKD 4DQOC 3EHVA 1NYRA 1D5MC 1MG4A 2IGDA 1FFUA 2VH1A 3R7QA 4IG7B 2IO3B 1UGMA 2X8XX 2O2VB 4W9FA 2LGDA 2W54A 3AN1A 2O2VA 2JWZA 1FCLA 2NR2A 2N4FA 4CO7A 2O6VB 3N1ZC 2WDRB 4HJKA 4WJQA 4M0WB 1SSNA 4D2KA 1XO3A 2LUMA 2KLCA 1E9MA 2XK5A 1YJIA 2WXFA 1E8ZA 1L6VA 4AJYB 3H8HA 3VUYA 4HKQA 2WXJA 2PIAA 5D7GA 2D3GA 5HG2A 4ASWC 4WJOA 4HDQA 2W55A 2KWDA 2V1YA 4TUUA 5D3DA 3N30A 1MHHE 1NYQA 2RDBC 1J8CA 2K8BA 1NVID 2M0AA 1IBXB 2HE7A 3Q8EA 1P0RA 3ZJVA 3PRPB 3Q6BA 2RGFA 2IY1B 3WAMA 2K3UA 3C19A 3CSFA 4EEWA 3A4SC 4GN1A 4XE0A 3SHQA 2Z8LA 2V3PA 2VH2A 1P3QU 4RH6A 3MHZA 2WU2B 3W9CB 2FUG1 4GDLA 2KMMA 3HUIA 2W3SA 3IVFA 4ZRQA 2LVOA 4FHKA 4BKSA 3HIZA 4IUMB 2MW5A 3UQAA 3GS2A 1P98A 5EE0A 2WDTB 4A6QA 1WM2A 2L83A 3HRDD 3N32A 2N9KA 1QQRA 2L0TA 3AE3B 1V5TA 3OAWA 1HTQA 1QOAA 2JY6A 3DBHB 3BK1A 1OTRB 1IUEA 3B2GA 2KWCA 4A8XC 3PREA 3RYTA 3BVZA 4BKSD 1RAXA 2H89B 3BWUD 3NG0A 1WGRA 2L0FA 4WAAA 4N9F4 1V1OA 5D94A 3N1YC 1I35A 3AEEB 4M8MA 5J2RA 3FILA 2M4NA 3IG3A 4H2AA 3QCAA 2K6DB 3WANA 4MGIE 2IO1B 2ZVNA 1VD2A 2N7JA 2DZIA 2K9XA 1AN8A 1NDDA 1SE2A 2YEPB 4II2B 4P6VF 1WF9A 2KD0A 3KWLA 4HDOA 3PLUA 3KLSX 1OGWA 1WMHB 3P1MA 5BYSA 3R8BA 1B9RA 1CZPA 2VRRB 1GB1A 1T5XD 1ROEA 4USAA 2EMSA 1X1MA 4GOCA 4EKUA 3IAS1 3W1SC 1E7PB 1YN5A 1VDVA 4ZYNA 2MP2A 1EWYC 2FNJB 2INPE 3D32A 1KLGD 5EE9A 2LHEA 5E6OA 4EUTA 4FA6A 1WY8A 1VRAB 4OVZA 1TIFA 1N6ZA 3ZDMC 1WXMA 3DHGC 4ZOHC 1M94A 3AE2B 4HCPB 4M02A 4G0NB 1ZGUB 4CQNA 1ZXIA 1I4HA 3ZNZB 4YXDB 1UWXA 3P4PB 3A9KA 2KJRA 1GJZA 4WH4A 3QARA 1EWCA 3ZXRA 1DOIA 1I4RA 3VH4B 3AEGB 3URYA 3H9DA 1TS3A 1PQSA 2O6VD 4E74A 3W2DA 4NQLB 4LNFA 1FPYA 4JGHB 3RZWC 1YX5B 4XGAB 5HHDG 3FKYA 5AEKB 1U4AA 2BS2B 4YTNB 1JRPA 5E6NA 1MHXA 2YEPF 1V5OA 3A9JA 1XLPA 2WDQB 5DCNA 1XD3B 2ICIA 3GE8C 3KVFB 1T0RC 4HKZE 2LUEA 1XEEA 4MJSA 2KVRA 4RGMA 2DBYA 4RCOA 2PTLA 4NY0A 3Q8BA 2AYOB 2WWZA 3IFWB 4ARIA 2ZNVB 3QX1A 3BVMA 2J4XA 1RM6C 1CMXB 1HZ6A 2LJIA 5G5GA 3RULA 2PVGC 4B0MA 3Q3JA 4X57B 5TSSA 1WX9A 2IGHA 5DPSA 5BMGA 2WXHA 4MELA 3OJ3A 3MC0B 5IO9A 3U8ZA 3WIMA 2GLSA 3ML9A 3ZKJC 2KFKA 1V1PB 4C00A 3UQBA 3EFCA 3HVZA 3DDCB 4AS1A 2BYVE 2DYBA 2DNFA 3MJ5A 2OEDA 4EZJA 2OJRA 1SB3C 5HKHA 3RNFC 1VZ6A 1QT9A 5J17A 3A9JB 3J9CA 1I4QA 3DOWA 5LXIB 1S3SG 1C78A 4DXAB 2EKEC 3W5VB 3ZTCA 1C76A 1UNSA 3AMZA 4MJSB 1CQVA 1QF6A 3QC8B 4EOYA 3APDA 1D6EC 3DBLB 2B76B 2MCNB 2B3AA 2CKHB 1TBEA 3Q3NC 3TIXA 3PTFC 4KDLB 3JW0X 1QOBA 2INCC 3B9JA 2J0JA 3RNEC 4YTMB 2LXCA 2N7EA 2WXPA 2LEKA 1L0VB 3HVDA 5T8IA 4ARCA 2DENB 3KWVA 2QC8A 2FIDA 2KDMA 3N20C 4KGTA 2LXAA 5AZGA 2M17A 4FJVB 4DHZE 1HTOA 4DBGA 3ZNGC 2MX2A 4NQKE 4EE2A 2I38A 5BMHA 1SE4A 4KZCA 3W1SA 2BYFA 3DQVA 1OQRA 1F0ZA 1RLFA 2IYDB 2N0SB 4LDTD 4C7YA 2XNAC 1VZ8A 1H4RA 2WQYB 1FRRA 2ZJDA 4US8A 2C7HA 2G1EA 3U2SC 3EFUA 1EUVB 2OHFA 2ZZPB 1TZOA 1WI0A 3U52E 5MPOA 1KJTA 2DWQA 4XYCA 5GMVA 4BVUC 2M1MA 4MGYE 2EELA 2L52A 3MFGA 1TJEA 1FNUA 2LRUA 1FNVA 4JE3B 4W9JA 3U30A 4AUQC 2UWQA 1QOGA 4FADA 4ZRJA 1CJEA 3AV8A 1KLUD 4DDID 4N59A 5C3JB 1EM7A 3W5UB 3PGEA 2WS3B 1WJUA 3N3KB 2WGSA 2WXLA 4GMVA 2QDFA 1V81A 3UIPB 4DK5A 3DVNV 1QKZA 1WR1A 1GC6A 4ANVA 2LMCA 1XLNA 4OVUA 4AOFA 1Y56A 1XT9B 1IBXA 3B08A 1OEYJ 3FILB 4OW0A 1NENB 2QIEB 4YSXB 3Q8FA 2KC1A 2RPVA 1H8CA 4QAYA 1AARA 3MC8A 1WGDA 3AEBB 3PHXB 4B0EA 3RNBC 2N9EB 4DWFA 2K6QA 4K1RB 1R4MI 2BYEA 1A70A 1KM7A 1OQQA 1ACCA 1VJKA 1WZ3A 2NBWB 3BIID 1VCBA 2G3QB 4GIVA 1PGAA 2KX3A 4GGQA 2IJ0A 2C5LC 1BUIC 4GDKA 1EU4A 2KYWA 1YOVB 4NAMA 5TR5A 4A55A 4WWMA 3AE5B 2SAKA 1I42A 1J7AA 2K39A 2XN9C 1IYFA 1P9DU 1FXAA 2CHXA 3Q3FA 3NHEB 2MHJA 3PZDA 1TKGA 4ZHPA 2V4IB 1SJED 2ASQA 1JQ4A 1WYGA 1L4ZB 2QMTA 2L8JA 2M19A 3UINB 1J0GA 1LFDA 4PS8A 2CU3A 2WXRA 3PVLA 2INNE 1Q0WB 1ZOYB 5C1ZA 2OOBB 1RWSA 1K51A 4JIOU 3EA6A 2KNBA 5LLIA 5CHFA 4XWWA 3DCGA 5GXGB 1C4CA 1WJNA 1D4BA 2BS4B 1YMHE 4BBNF 2K5PA 3Q14C 2CJOA 2Y5CA 4M8NA 2IDYA 4FJYA 4WJPA 2N9XA 3VFKA 3L08A 2MBHA 3QJZA 1SE3A 4GDKB 2AQ1B 4L2YA 2R61A 2MBEA 3PS6A 5IOIA 1HA5A 2J7QB 1WX8A 2PPHA 2LZ6A 3UF8A 2M8SA 3T3OA 2IZVB 4LK0M 4BOZB 2WLBA 3PZ8A 1PYWD 4L23A 3TJPA 2LVPA 2MSED 2L3ZA 5FK9C 3P63A 1VLBA 4NPNA 4W9KA 1GC7A 4FXCA 3DBHI 2YLMA 3NZ3A 3VTUA 3UIOB 3BK2A 3ZYYX 4A3PA 1GG3A 1C4PA 4MM3A 5BMIA 3AE7B 3T8MA 3R66C 1YQBA 1IGDA 2WXOA 2X38A 5BO4B 3Q69A 3QQ8B 1JMLA 3BYTB 1E5WA 3NRZA 2AQ3B 2LGYA 4LDTB 1L0XB 3PT2B 2WHIA 3P4QB 1SE9A 3GOEA 4IOIE 3MP9A 2KO3A 1RFAA 5HFYA 5EDSA 1NBFC 2MP2B 3O13A 5JXVA 4URKA 3VAWA 1EF1A 1MJDA 2ZCCA 2MJEA 2KKCA 4A9AA 3ZIMA 1UF0A 1N60A 4C4VA 3L16A 5JHAA 2QILA 4OZBA 2I1KA 3GZNB 3TL5A 1KFYB 4MDKE 3GP7A 1XCQL 5L95C 2KDEB 2E6XA 4IM2A 4FULA 1KTKA 2MLBA 2KN4A 2CS4A 1SJHD 3QA8A 4RM9A 3ZRFA 3DBSA 4OHJA 4DXFA 1L6UA 3AH7A 2DAFA 2L32A 2JRHA 3CIRB 5I4DA 3E9SA 3VTVA 3TCAA 2BKFA 3IHPC 4K3CA 2CHWA 2QJLA 2KZRA 3QAQA 2JXXA 3VRAB 2CHZA 3VTWA 4WQMA 4MT5A 1GNUA 2N1WA 3EC8A 4YTPB 2BT6A 3AEDB 1G6JA 2BF8B 2JT4B 3DVGY 1IPGA 1WGHA 3MC9A 4HVBA 4XZ4A 1V6EA 5E6PA 1WIAA 3V6CB 1WR6E 1MI0A 2R2QA 2W9NA 1I7HA 4L1BA 3PO0A 3VH3B 3ABVB 2PMVA 4PK1A 3I9V1 2NMQA 4BKGA 4HXDA 2KACA 2NCNA 1JWUD 2IGGA 1F52A 2PW9A 1EU3A 1L4DB 1JRUA 1MFWA 2KTRA 2WU5B 3H1UA 3RI7C 1WGGA 3FC4A 4AQ7A 2M0XA 5D6JB 3QWZB 3ZNID 1F9JA 4P16A 5JZEB 3RCZA 3ZRCA 5DPTA 3V61A 2JRIB 1YQ3B 3PRZA 2MEKA 3TEXA 4KIKB 4GB9A 3TEWA 4HCNB 4MACA 3KH0A 4HROA 4XWTA 2LASA 2J0KA 1WRDB 2KFJA 4G50A 5IN7A 4YT0B 5D3IB 3RNAC 3WAPA 3VDZA 4DHJD 2HTME
chains in the Genus database with same CATH topology
1XLOA 2G1EA 1TY2A 3U2SC 3AEFB 3NS1A 4KX6B 3EUB2 4IKGA 2PLPA 2DYMA 2EKIA 2RDGA 4RNAA 2OHFA 1N61A 1ZXHA 1TZOA 4Q2JA 1N63A 2Q5WD 3U52E 1CK1A 5MPOA 3TEZA 4KKIA 1QILA 2MJDA 1FIQA 2DWQA 3T3NA 1R7SA 1K50A 1D5XC 1ENFA 2TSSA 3ETRA 4C80A 2EELA 4A90A 1GPXA 2L52A 3MFGA 2BB6A 4KKJA 5G5HA 1ZDVA 1TJEA 2WXIA 5E6JA 1F2RI 1FD6A 1FNUA 4TQ1A 2JSVX 2PKOA 1FNVA 4JE3B 4RFBA 1SXTA 4TQ0A 1QOGA 2AQ2B 3B2FA 2IPKD 5EE1A 2J42A 4DQOC 1CJEA 1NYRA 3AV8A 1KLUD 4N59A 5C3JB 1EM7A 4JX1C 1D5MC 2IGDA 1FFUA 5AUKA 2WXGA 4LLGM 3W5UB 2I2YA 2KAJA 2G9HD 2WS3B 1XLQA 1HQRD 1FXIA 1K52A 2WXLA 1ZUD2 3R2IA 2N9LA 4RGOS 1QKZA 2WNMA 2LMCA 2W54A 1XLNA 3AN1A 3GB1A 1ET6A 2E3TA 1FCLA 3VRBB 1JW9D 1FCCC 1I4GA 1JALA 2WDRB 1Y56A 1SSNA 4D2KA 1HEZE 1XO3A 1IBXA 2LUMA 3BYYB 3FILB 4OW0A 1MPEA 1E9MA 1NENB 2QIEB 4YSXB 1TS2A 3AE1B 1YJIA 4J3OD 3Q8FA 2WXFA 2W3RA 4REZA 1L6VA 1PGBA 2RPVA 3H8HA 2QEJC 3VR8B 1F77A 1RYJA 1F2RC 4HKQA 2WXJA 3AEBB 2WXKA 4B0EA 2PIAA 3EGRA 3Q8AA 2Y5PA 3AECB 5D7GA 1GB4A 2LGIA 1VR9A 5HG2A 2J53A 2W55A 2KWDA 1A70A 1OQQA 1ACCA 1VJKA 4XDDA 3Q8CA 3BIID 4GDLB 3AEAB 4ITKA 5D3DA 2BYTA 1JWSD 3RFZB 1C4AA 1MHHE 1PGAA 1NYQA 4DXGA 1E10A 4HJGE 4WAFA 1NVID 3P4SB 2IJ0A 2M0AA 1IBXB 4HEA1 5H92C 3Q8EA 4N58A 4NAWB 3ZJVA 1STEA 4JWSC 1BUIC 1EU4A 4ZRPA 2K3UA 4NAMA 4A55A 4WWMA 3AE5B 2SAKA 1J7AA 4XE0A 2XN9C 2Z8LA 2V3PA 1FXAA 1RFKA 1DGJA 3BVGA 4C7ZA 4RH6A 1YN4A 3MHZA 2BBCA 1K53A 4ZHPA 1TKGA 1NEKB 2V4IB 2WU2B 3TEYA 1SJED 3W9CB 1JQ4A 2FUG1 1FO4A 1WYGA 2KMMA 1L4ZB 2QMTA 3HUIA 2W3SA 3R2TA 2M19A 2ACZB 4ZRQA 1N62A 3GS2A 1JROA 4M0WA 5H8YE 2CU3A 3NVWA 1Q10A 5EE0A 2WXRA 3SR6A 2AX5A 4WIPA 4A6QA 2L83A 2INNE 2NTSA 1ZOYB 3HRDD 1QLBB 3ZJTA 1RWSA 3P4RB 3V05A 1K51A 2N9KA 3EA6A 3I57A 4JPSA 4RGNA 1QQRA 3AE3B 1YN3A 2JXTA 1QOAA 1D4BA 4XWWA 5GXGB 1C4CA 5BYQA 2H88B 1PDXA 2V3NA 3BK1A 2ONQA 3N9YC 3FAHA 1SF0A 3OWEB 1IUEA 2BS4B 1YMHE 3B2GA 4A8XC 2K5PA 1ESFA 2CJOA 2GRIA 2Y5CA 1FNWA 3BVZA 2IDYA 1I4PA 5AUIA 2JYEA 2H89B 4GLSC 2WXNA 2JZPA 3BWUD 1C79A 2J52A 1V1OA 2W82A 1SE3A 2ON8A 4GDKB 2AQ1B 4L2YA 2R61A 2WXMA 1WXQA 1ZP0B 3AEEB 1WWTA 3FILA 1HA5A 1HXYD 3IT6B 4OZCA 4H2AA 3T3OA 4LK0M 2BW2A 2PVOD 2WLBA 2V0GA 3PZ8A 1PYWD 4L23A 2N7JA 4TSSA 2K9XA 1AN8A 2SEBD 1SE2A 2YEPB 3P63A 5FK9C 4C56C 1GAQB 3DWMA 4P6VF 1VLBA 2K22A 2JU6X 2JWUA 3KWLA 1XF5L 4FXCA 4RF1A 1PUTA 3KLSX 1JCKB 3P1MA 5BYSA 3R8BA 1B9RA 3NZ3A 3ZJUA 2ZW1A 1CZPA 4KGRA 1GB1A 1T5XD 3BK2A 4ZHOA 1ROEA 3L4PA 3P42A 4USAA 3ZYYX 2K0PA 1UGJA 1BMLC 3IAS1 4YWGG 1E7PB 1C4PA 1YN5A 1VDVA 5BMIA 3AE7B 4YSYB 1AWDA 1FMAD 1MVKA 1EWYC 1KF6B 2INPE 3DWGC 1IGDA 2RMMA 1KLGD 2WXOA 5EE9A 2LHEA 1TKYA 1FM0D 1JWMD 1VRAB 4OVZA 3LB8C 2X38A 1DYQA 3CWIA 4RGTA 3E56A 3Q69A 4ZOHC 2WP9B 4OZAA 1JMLA 3AE2B 3LYYA 3BYTB 1L0YB 3NRZA 5FR3A 1QOFA 1N5WA 1V97A 4CQNA 1ZXIA 1I4HA 1NI3A 2AQ3B 3KQ4A 4YXDB 1UWXA 3P4PB 4UDUC 1L0XB 2JX5A 4WH4A 3U4EG 1EWCA 1DOIA 4MM3B 1XXGA 1I4RA 3P4QB 3AEGB 3URYA 3MP9A 1FEHA 4IOIE 1T6BX 1V1PA 1YJJA 5HFYA 2BS3B 3VQIA 1TS3A 1GOZA 1AW7A 5FKAC 3O13A 5JXVA 3W2DA 2WXQA 3PZ7A 2MJEA 4A9AA 3SEBA 1J7BA 1N60A 5HHDG 1B1ZA 2QILA 4OZBA 1TKEA 1WSPA 2BS2B 4YTNB 2ZW0A 4RF0A 1JRPA 2QSDA 4XDCA 1MHXA 2YEPF 2BTEA 1KFYB 1ZDXA 5C2TB 3NVYA 3BZDB 1XLPA 2WDQB 1OFFA 3GP7A 2ICIA 3ZGZA 1XCQL 3V3XA 4HKZE 1C9FA 4O1NA 1XEEA 2FE8A 4NJCA 1DOXA 2DLBA 4RGMA 2E6XA 2DBYA 1TY0A 4RCOA 2PTLA 1C77A 3AE9B 3Q8BA 4ZYSA 1KTKA 2KN4A 2L1AA 1SIJA 1SJHD 2CJNA 3UI3A 4ARIA 1FRDA 1TYGB 3BVMA 2J4XA 1RM6C 3NUHB 4OHJA 4DXFA 2GB1A 1HZ5A 1TS4A 1L6UA 3AH7A 3VR9B 2L32A 3CIRB 3NVVA 3E9SA 1HZ6A 2LJIA 5I4DA 1KH0A 5G5GA 1BXTA 2PVGC 4B0MA 1ET9A 1KRHA 5TSSA 2IGHA 2QJLA 2HDEA 5BMGA 2WXHA 3VRAB 1D5ZC 3MC0B 2LHDA 1PFDA 2DYOA 1JWBD 4WQMA 1AYFA 4MT5A 4YTPB 1UWMA 2BT6A 1SEBD 3AEDB 1I4XA 1WRIA 5BYRA 2MH7A 1V1PB 2JQRB 3IXSA 4N6EB 2Y3AA 1SBBB 3AE4B 4R3DA 3NVZA 3C8YA 1E6EB 4AS1A 3HVZA 3U7ZA 1M4VA 3AB5A 1E0ZA 4MH8A 2D5GA 1J7CA 2FBWB 4WURA 5HI1A 3MJ5A 2OEDA 2GI9A 1N5XA 1SB3C 2M56B 3SFEB 3WCQA 3TSSA 1VZ6A 1MI0A 1QT9A 1VZ7A 1V8CA 3J9CA 5LNK1 1I7HA 4L1BA 1I4QA 2VZKD 4TMAB 3PO0A 1C78A 3ABVB 2PMVA 3W5VB 3I9V1 1C76A 1UNSA 2NMQA 4KGSA 3AMZA 4JWUC 1CQVA 1QF6A 2BB5A 1D6EC 2KACA 1P7EA 2B76B 1JWUD 1FFVA 2IGGA 4IDIA 2PW9A 1EU3A 1QOBA 2LFIA 5EE3A 1L4DB 3B9JA 4US9A 3RPFC 3SFDB 1L5PA 2NTTA 4YTMB 3ZQ4A 2RDHA 2WU5B 2WXPA 2LEKA 1T3QA 1L0VB 4YSZB 1IGCA 3IAM1 3HVDA 5T8IA 1JWAD 3FC4A 4ARCA 1LO5D 3LXFA 4AQ7A 3KWVA 1DOYA 3IT4B 3AE8B 4P16A 2KDMA 1YNTE 1ZE3D 4KGTA 2VZKB 1YQ3B 2WDVB 2MEKA 3TEXA 2KQ4X 1TS5A 4EE2A 3TEWA 3AE6B 2I38A 4HRSA 5BMHA 4US8A 1PGXA 1SE4A 4MACA 3W1SA 1ZPSA 4HROA 4PT5A 1XCTL 2JYTA 1OQRA 1UUPA 1F0ZA 2N0SB 4XWTA 4C7YA 3AM9A 1WGKA 2XNAC 4NZLB 1VZ8A 3TUOA 4YT0B 4LTUA 5D3IB 2WQYB 1YQ4B 1FRRA 1P7FA 2MJ3A 2HTME
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XLO A;  5H92 C;  4N58 A;  1CZP A;  3VRA B;  4JWS C;  2G1E A;  4ZHO A;  1ROE A;  3AEF B;  3L4P A;  3NS1 A;  4USA A;  4KX6 B;  3EUB 2;  1PFD A;  3ZYY X;  2EKI A;  1JWB D;  4WQM A;  1AYF A;  2OHF A;  1N61 A;  1E7P B;  1VDV A;  4WWM A;  4YTP B;  1N63 A;  1UWM A;  2BT6 A;  2Q5W D;  3AE5 B;  3AE7 B;  3AED B;  1J7A A;  1WRI A;  4YSY B;  5MPO A;  2MH7 A;  4N6E B;  2JQR B;  1AWD A;  1FIQ A;  2MJD A;  1FMA D;  2DWQ A;  3AE4 B;  1FXA A;  1R7S A;  1DGJ A;  1EWY C;  1KF6 B;  1RFK A;  3DWG C;  4C7Z A;  3NVZ A;  3ETR A;  1E6E B;  4C80 A;  3HVZ A;  5EE9 A;  4ZHP A;  1TKG A;  1FM0 D;  1TKY A;  2L52 A;  1NEK B;  1GPX A;  5G5H A;  2WU2 B;  3LB8 C;  1TJE A;  3AB5 A;  1E0Z A;  3CWI A;  1J7C A;  2FBW B;  3P1M A;  4ZOH C;  3W9C B;  1FO4 A;  1WYG A;  2KMM A;  2WP9 B;  1JQ4 A;  3HUI A;  3AE2 B;  2PKO A;  2W3S A;  3NRZ A;  1N5X A;  1QOF A;  2M19 A;  1SB3 C;  2ACZ B;  1QOG A;  2M56 B;  3SFE B;  3B2F A;  1N62 A;  1N5W A;  1V97 A;  3WCQ A;  1ZXI A;  5EE1 A;  1NI3 A;  1QT9 A;  4YXD B;  1JRO A;  3P4P B;  1V8C A;  5H8Y E;  1I7H A;  2CU3 A;  1CJE A;  1NYR A;  3AV8 A;  2JX5 A;  3NVW A;  4N59 A;  5C3J B;  5EE0 A;  3PO0 A;  4JX1 C;  3SR6 A;  2AX5 A;  1DOI A;  3ABV B;  1FFU A;  3P4Q B;  2L83 A;  5AUK A;  3W5V B;  3W5U B;  1ZOY B;  3AEG B;  1QLB B;  3HRD D;  3AMZ A;  4JWU C;  2KAJ A;  1RWS A;  1YJJ A;  3P4R B;  1QF6 A;  2WS3 B;  1XLQ A;  2BS3 B;  3P4S B;  1FXI A;  3AE3 B;  1ZUD 2;  2B76 B;  1FFV A;  4IDI A;  1QOA A;  5GXG B;  2MJE A;  2H88 B;  1PDX A;  4A9A A;  1QOB A;  5EE3 A;  3B9J A;  1J7B A;  1N60 A;  1XLN A;  2W54 A;  3AN1 A;  3FAH A;  1SF0 A;  4US9 A;  1IUE A;  2BS4 B;  3RPF C;  3B2G A;  3SFD B;  1TKE A;  1L5P A;  2BS2 B;  2E3T A;  2K5P A;  4YTN B;  1JRP A;  4YTM B;  2WU5 B;  1JW9 D;  2LEK A;  3VRB B;  1T3Q A;  2CJO A;  1L0V B;  2Y5C A;  1JAL A;  4YSZ B;  1KFY B;  2WDR B;  5C2T B;  3NVY A;  5AUI A;  1XLP A;  1JWA D;  2H89 B;  2WDQ B;  1OFF A;  3FC4 A;  3LXF A;  1XO3 A;  1DOY A;  3AE8 B;  1E9M A;  1NEN B;  2QIE B;  4YSX B;  3AE1 B;  1DOX A;  1YJI A;  1WXQ A;  2W3R A;  1ZP0 B;  1L6V A;  2DBY A;  3AEE B;  1WWT A;  3AE9 B;  3VR8 B;  1YQ3 B;  2WDV B;  1B9R A;  1RYJ A;  3AEB B;  2PIA A;  1SIJ A;  2CJN A;  3AE6 B;  2WLB A;  2PVO D;  3AEC B;  1FRD A;  1TYG B;  4HRS A;  4US8 A;  1RM6 C;  4HRO A;  2W55 A;  1A70 A;  2K9X A;  1OQQ A;  3P63 A;  1L6U A;  1VJK A;  3AH7 A;  1GAQ B;  1OQR A;  3DWM A;  1VLB A;  2K22 A;  2N0S B;  4P6V F;  3VR9 B;  3BII D;  1F0Z A;  4C7Y A;  3AEA B;  4ITK A;  3AM9 A;  3CIR B;  3KWL A;  1WGK A;  3NVV A;  5G5G A;  4YT0 B;  2PVG C;  4FXC A;  4LTU A;  1NYQ A;  1PUT A;  2WQY B;  1YQ4 B;  1E10 A;  1KRH A;  1FRR A;  1NVI D;  2MJ3 A;  2QJL A;  2HTM E; 
#chains in the Genus database with same CATH topology
 2YVC A;  4LCD E;  4BZA A;  3AEF B;  4KX6 B;  3EUB 2;  4IKG A;  2DYM A;  2EKI A;  2RDG A;  4Q2J A;  2Q5W D;  2C60 A;  1A5R A;  3TEZ A;  4KKI A;  2D3B A;  2MJD A;  1FIQ A;  2D10 A;  1ENF A;  4GXB A;  3ETR A;  3ZTD A;  2PJH A;  3NOB A;  4A90 A;  2LWP A;  4KKJ A;  1ZDV A;  4HK2 A;  2KJ6 A;  4RFB A;  2NBV B;  1SXT A;  1UBQ A;  5EE1 A;  2J42 A;  3KW5 B;  3NS8 A;  2MA9 B;  2D11 A;  4JX1 C;  4LLG M;  4GSW A;  2I2Y A;  3Q3M C;  1XLQ A;  1HQR D;  1FXI A;  1K52 A;  3ZLZ A;  1ZUD 2;  3DVN U;  4IWO A;  4P1C C;  4RGO S;  2WNM A;  2LD9 A;  2C7N B;  2NPT B;  2IBI B;  2QHO A;  3ENE A;  1ET6 A;  4YL8 A;  2E3T A;  4FHJ A;  3VRB B;  1JW9 D;  1FCC C;  2KVZ A;  3ZW3 A;  1JAL A;  2I1J A;  3LJ3 A;  3PSE B;  2FCQ A;  4HLE A;  3DBL I;  2O6V A;  4G3X B;  1Q5W B;  5AZH A;  4REZ A;  1PGB A;  1F77 A;  1RYJ A;  3EGR A;  2Y5P A;  3AEC B;  1VR9 A;  2J53 A;  4RMA A;  4WWN A;  2KDF B;  2ZPN A;  1T0Q C;  1Y8R C;  2DZK A;  1JWS D;  4DXG A;  3PPA A;  3PV1 A;  3P4S B;  3SD5 A;  2DZJ A;  5H92 C;  4CYE A;  1STE A;  3ONS A;  4RM8 A;  2DZM A;  3MHS D;  5J18 A;  2PE6 B;  2G4S A;  1EO6 A;  4AWJ A;  3MTN B;  1UEL A;  1GUA B;  3BVG A;  1YN4 A;  1WJ4 A;  2PEA A;  3TEY A;  2BWF A;  2IND C;  4KSL C;  3AUL A;  2AL6 A;  3W1Y A;  4MEM A;  3X0W A;  1JRO A;  3ZUN A;  4M0W A;  5H8Y E;  3QK0 A;  3NVW A;  1Q10 A;  3SR6 A;  4WIP A;  3HHM A;  1QLB B;  3A33 B;  2MRP A;  3P4R B;  3V05 A;  4KSK C;  3KYD D;  3RNG C;  4WWP A;  4MH0 E;  5BYQ A;  1PDX A;  3N9Y C;  3FAH A;  1SF0 A;  3OWE B;  2L7R A;  1S1Q B;  2GRI A;  1FNW A;  3ML8 A;  3PLV A;  1I4P A;  1YD8 U;  4ANW A;  5AUI A;  2WYQ A;  4K3B A;  2WX1 A;  2WXN A;  2JZP A;  1EF5 A;  1C79 A;  3GZN I;  1HE8 A;  2GBK A;  2ON8 A;  2C9W B;  4W9L A;  3PHW B;  2WXM A;  1WXQ A;  1R4N I;  3AU4 A;  1WWT A;  1HXY D;  3IT6 B;  2KAN A;  2D3C A;  2UU7 A;  1E7V A;  5JH5 C;  2BW2 A;  2PVO D;  2V0G A;  4HPL B;  1TGZ B;  4OVV A;  2BWE S;  4TSS A;  2SEB D;  4BKT A;  4IC7 B;  1GAQ B;  3DWM A;  2K22 A;  2JWU A;  3RMK C;  5JHB A;  1XF5 L;  1SIF A;  4RF1 A;  1JCK B;  4S17 A;  4F7Z A;  3ZJU A;  4KGR A;  3CMM B;  2K0P A;  1UGJ A;  4ICU A;  3RD2 A;  4YWG G;  4ACF A;  4WJN A;  3H6N A;  4FN2 A;  2GBR A;  1FMA D;  1YJ1 A;  1MVK A;  1KF6 B;  3DWG C;  2RMM A;  4AP4 C;  3V6E B;  2ZEQ A;  1FM0 D;  1JWM D;  3GE3 C;  3LB8 C;  3CWI A;  4RGT A;  3L10 B;  1WGY A;  5IP4 D;  2WP9 B;  3A4R A;  1L0Y B;  5FR3 A;  3ECI A;  1QOF A;  4A20 A;  2JZ3 B;  1V97 A;  2V9H A;  4XX5 A;  3R3M A;  3KQ4 A;  1NI3 A;  1V49 A;  4MM3 B;  3A9K B;  1FEH A;  2KC2 A;  1WZ0 A;  1V1P A;  2KXJ A;  3WA0 A;  2BS3 B;  2KLG A;  2AEH A;  3VQI A;  3DHH C;  1KOT A;  2BVC A;  4LJP B;  5FKA C;  2WXQ A;  5DPW A;  4F1S A;  1Z2M A;  4II3 B;  5C23 A;  4ZRK A;  1TKE A;  2ZW0 A;  4RF0 A;  1IP9 A;  2QSD A;  2RD0 A;  3HM6 X;  4ANU A;  3BZD B;  4IM0 A;  1OFF A;  2BGF A;  3ZGZ A;  4JL9 A;  4O1N A;  2FE8 A;  4NJC A;  1TY0 A;  4K7U A;  4E3C A;  1C1Y B;  2L1A A;  1SIJ A;  2CJN A;  3M95 A;  3UI3 A;  2JVC A;  1FRD A;  1TYG B;  4NJ7 A;  2FCN A;  4C4V B;  1HZ5 A;  1TS4 A;  2PE9 A;  4IWP A;  2K8C A;  3RT3 B;  3JYU A;  3NVV A;  2LVQ A;  1BXT A;  1KRH A;  3SDL C;  2KDI A;  2MBO A;  2HDE A;  4JQW C;  1D5Z C;  5G55 A;  2BKR B;  1PFD A;  2DYO A;  4BAX A;  3VHT C;  4M01 A;  1JWB D;  4I6N B;  1AYF A;  3H7S A;  1SEB D;  2MH7 A;  3IXS A;  4N6E B;  1SBB B;  4MGZ E;  4R3D A;  2FCS A;  1WXS A;  4I6L B;  1M4V A;  3AB5 A;  2GOW A;  2RR9 A;  3K9O B;  1E0Z A;  2D5G A;  2FBW B;  2Z59 B;  1QZE A;  5HI1 A;  2KWV B;  2GI9 A;  4LNK A;  1N5X A;  5CX3 A;  4B95 A;  2M56 B;  2V3S A;  3WCQ A;  3EEC A;  4MGK E;  1V8C A;  2VZK D;  2DHZ A;  4TMA B;  2JUO A;  1V2Y A;  4KGS A;  2G4D B;  2R2O A;  1WJ6 A;  2OJW A;  3NY5 A;  1P7E A;  1UZX B;  4IDI A;  4DHJ B;  1WFY A;  2QCZ A;  2MQJ A;  3VXW A;  1XQQ A;  4US9 A;  3RPF C;  1L5P A;  2NTT A;  3LDZ E;  2RDH A;  3WAO A;  1V80 A;  2Y5B B;  2NS5 A;  1IGC A;  3IAM 1;  4J6I A;  4EFO A;  5AZF A;  1UH6 A;  1ZKH A;  3AE8 B;  4W9I A;  1YNT E;  3T9L A;  3V60 A;  4EZL A;  1UD7 A;  2KFK B;  2KQ4 X;  2KX0 A;  3H7P B;  1TS5 A;  3AE6 B;  3OJ4 B;  4HRS A;  3M63 B;  1WYW B;  1YX6 B;  1PGX A;  2K1F A;  1ZPS A;  4PT5 A;  2N1V A;  5KHO A;  3RUI B;  2KMC A;  3TUO A;  1V9J A;  4LTU A;  2KK8 A;  4TKN A;  2HJ1 A;  4F8C B;  4KVG B;  3A1Q B;  3NS1 A;  3M3J A;  2PLP A;  2KHW B;  3ZDT A;  1N63 A;  1CK1 A;  2LI5 A;  3A1Q A;  3RN9 C;  1QIL A;  4MSM B;  3T3N A;  3KUZ A;  1K50 A;  2DX5 B;  4PYZ A;  2WXI A;  4A3O A;  2NPT A;  3CF6 E;  2JSV X;  2PKO A;  2L76 A;  3N1X C;  4TQ0 A;  1L2N A;  3B2F A;  4W9D A;  2LJ5 A;  3I3T B;  2ZNV C;  4K7W A;  4LNO A;  1WX7 A;  4HPM B;  3TMP B;  2BPS A;  1ISN A;  1OQY A;  5AUK A;  2WXG A;  2FAZ A;  2KAJ A;  2G9H D;  3I63 C;  3KUD B;  3R2I A;  2EMT A;  3TBL D;  3H7P A;  2N9L A;  3CST A;  3NZU A;  1MG8 A;  1TT5 B;  3GB1 A;  2GMI C;  4TV3 A;  1I4G A;  4WQO B;  1WM3 A;  3AU5 A;  1HEZ E;  2KJH B;  3QHT A;  4M00 A;  1LGR A;  3BYY B;  3MJW A;  1MPE A;  1TS2 A;  3AE1 B;  4J3O D;  2W3R A;  2QEJ C;  3VUX A;  2XEW A;  3VR8 B;  3OG5 A;  1F2R C;  2WXK A;  3Q8A A;  4LNI A;  2HTH A;  1GB4 A;  2LGI A;  5IAA C;  4KV2 A;  4XDD A;  3Q8C A;  4GDL B;  3AEA B;  4ITK A;  3HM3 A;  2KN5 A;  2BYT A;  2UYZ B;  3RFZ B;  1C4A A;  1E10 A;  4HJG E;  4WAF A;  4BFR A;  1RRB A;  4HEA 1;  3KYC D;  1KLV A;  4N58 A;  4NAW B;  4JWS C;  4ANX A;  2A4Z A;  1WE7 A;  4ZRP A;  2MWS B;  3AXC A;  2XBB C;  5D2M B;  1RFK A;  1DGJ A;  3L54 A;  4C7Z A;  3R7R A;  2BBC A;  1K53 A;  4B6W A;  1NEK B;  3I5J C;  1E7U A;  2DAJ A;  2ZVO A;  1FO4 A;  3L0W B;  5DPR A;  3R2T A;  2ACZ B;  2Z0E B;  2G45 B;  1N62 A;  4DHZ B;  2KTF A;  4IM3 A;  2KDB A;  1TZ1 A;  3IBE A;  2AX5 A;  1LM8 B;  5G2N A;  2NTS A;  3ZJT A;  2JPH A;  3I57 A;  1Q1O A;  4JPS A;  4RGN A;  5LXH A;  1YN3 A;  2JXT A;  2KT7 A;  2N7D A;  2C7M B;  1FXT B;  1J19 A;  2CU1 A;  2H88 B;  2V3N A;  2ONQ A;  4BBN C;  3ZO5 B;  2REX A;  1D3Z A;  1ESF A;  3PRM B;  2JYE A;  4GLS C;  4NNJ B;  2RPQ A;  2LRW A;  2J52 A;  1WXV A;  3ZXV A;  2W82 A;  4NAW A;  1P1A A;  1Z5S B;  4K81 A;  3ALB A;  4G11 A;  1ZP0 B;  3HK0 A;  2D3A A;  3SU8 X;  4AJW A;  4OZC A;  3NZS A;  3WAL A;  4JLC A;  3V62 A;  2L00 B;  4EZK A;  4C56 C;  2K8H A;  2LGX A;  2JU6 X;  2GBJ A;  1PUT A;  2CR5 A;  4HWI B;  2ZW1 A;  4W9C A;  4ZHO A;  1LXD A;  3L4P A;  3P42 A;  3NJT A;  1BML C;  4XC2 A;  4NJ6 A;  4YSY B;  3VVW B;  1AWD A;  1TKY A;  1DYQ A;  4FLH A;  3E56 A;  5IA7 A;  4OZA A;  3RZF A;  3LYY A;  4KZ0 A;  3JSV B;  1N5W A;  1WMH A;  4UDU C;  3DBR I;  1E8Y A;  2JX5 A;  3JSV A;  3U4E G;  3KUC B;  1ZW7 A;  1XXG A;  1T6B X;  2BQQ A;  1YJJ A;  2RSU A;  1F1H A;  1GOZ A;  2A5U A;  1AW7 A;  5L83 A;  1E90 A;  2D2Q A;  3PZ7 A;  3SEB A;  3M62 B;  1J7B A;  4PS3 A;  1B1Z A;  3BY4 B;  1C3T A;  1WSP A;  2KOX A;  2KQS A;  1WE6 A;  4XDC A;  4B9K A;  2JF5 A;  2BTE A;  2HD5 B;  1ZDX A;  5C2T B;  4DDG D;  3NVY A;  2L05 A;  5CHW A;  1R4N B;  3L17 A;  3V3X A;  2LGS A;  1C9F A;  3L13 A;  1DOX A;  1T0Y A;  2DLB A;  3DVG X;  1C77 A;  3AE9 B;  4ZYS A;  1UBI A;  2FIF A;  4PS7 A;  5CHV C;  1BT0 A;  4K7S A;  3NUH B;  2KMA A;  2GB1 A;  3VR9 B;  1WXA A;  5FR6 A;  1TTN A;  2D07 B;  1KH0 A;  4I6P A;  4LNN A;  4E71 A;  1ET9 A;  2JZZ A;  1E8X A;  2LHD A;  1UWM A;  1I4X A;  1WRI A;  3APF A;  4W9G A;  5BYR A;  4P7I A;  2JQR B;  3AI5 A;  2Y3A A;  4IWQ A;  3AE4 B;  3NVZ A;  3C8Y A;  1E6E B;  3U7Z A;  2NVU I;  1YIW A;  2FUH B;  3B0A A;  5IKC M;  3P2B A;  4MH8 A;  4WUR A;  1J7C A;  4S0R A;  5CTR C;  3BIN A;  4P1B C;  4W9H A;  2KQ7 A;  3DHI C;  4IW0 A;  3SFE B;  2MBQ A;  3TSS A;  4ZDV A;  3ZVV A;  1VZ7 A;  3VUW A;  5LNK 1;  1OEY A;  1E8W A;  2AWT A;  2IO0 B;  4JWU C;  3APC A;  3X23 A;  2V4L A;  2BB5 A;  3QIJ A;  2MBB B;  1NI2 A;  2AL3 A;  1FFV A;  4ICV A;  2LFI A;  5EE3 A;  2K25 A;  2ZCB A;  5KHQ A;  3U7D A;  1V86 A;  3SFD B;  3JVZ X;  3ZQ4 A;  3Q2A C;  1T3Q A;  4YSZ B;  4W9E A;  1JWA D;  3B1L X;  3OLM D;  1LO5 D;  3LXF A;  4PYU A;  1DOY A;  4GU2 A;  3IT4 B;  2GBM A;  1LQB A;  1ZE3 D;  4KIK A;  2J0M A;  2VZK B;  2HJ8 A;  2WDV B;  2IO2 B;  4MSQ B;  2NBU A;  4BOS C;  4ZRI A;  3S2A A;  2IY0 B;  3K9P B;  1XCT L;  2JYT A;  1UUP A;  3DBR B;  1R4M B;  3AM9 A;  1WGK A;  4NZL B;  3C0R B;  1YQ4 B;  3DPD A;  3UGB B;  1P7F A;  2MJ3 A;  1XLO A;  3ZNH B;  4WWO A;  1TY2 A;  2GBN A;  2XK5 B;  1T0S C;  3Q3O C;  4RNA A;  1SGH A;  1L7Y A;  1N61 A;  1ZXH A;  2Z0D B;  3RNC C;  3O65 B;  4FBJ B;  1WH3 A;  2N9P C;  1R7S A;  1D5X C;  2WX0 A;  2TSS A;  4C80 A;  4KDI C;  1GPX A;  4CHK A;  5G5H A;  2BB6 A;  4LJO B;  2KWU B;  5E6J A;  1F2R I;  1FD6 A;  4TQ1 A;  4HPP A;  2KTR B;  2ZPY A;  4FJZ A;  2AQ2 B;  2FCM A;  1K8R B;  2IPK D;  4DQO C;  3EHV A;  1NYR A;  1D5M C;  1MG4 A;  2IGD A;  1FFU A;  2VH1 A;  3R7Q A;  4IG7 B;  2IO3 B;  1UGM A;  2X8X X;  2O2V B;  4W9F A;  2LGD A;  2W54 A;  3AN1 A;  2O2V A;  2JWZ A;  1FCL A;  2NR2 A;  2N4F A;  4CO7 A;  2O6V B;  3N1Z C;  2WDR B;  4HJK A;  4WJQ A;  4M0W B;  1SSN A;  4D2K A;  1XO3 A;  2LUM A;  2KLC A;  1E9M A;  2XK5 A;  1YJI A;  2WXF A;  1E8Z A;  1L6V A;  4AJY B;  3H8H A;  3VUY A;  4HKQ A;  2WXJ A;  2PIA A;  5D7G A;  2D3G A;  5HG2 A;  4ASW C;  4WJO A;  4HDQ A;  2W55 A;  2KWD A;  2V1Y A;  4TUU A;  5D3D A;  3N30 A;  1MHH E;  1NYQ A;  2RDB C;  1J8C A;  2K8B A;  1NVI D;  2M0A A;  1IBX B;  2HE7 A;  3Q8E A;  1P0R A;  3ZJV A;  3PRP B;  3Q6B A;  2RGF A;  2IY1 B;  3WAM A;  2K3U A;  3C19 A;  3CSF A;  4EEW A;  3A4S C;  4GN1 A;  4XE0 A;  3SHQ A;  2Z8L A;  2V3P A;  2VH2 A;  1P3Q U;  4RH6 A;  3MHZ A;  2WU2 B;  3W9C B;  2FUG 1;  4GDL A;  2KMM A;  3HUI A;  2W3S A;  3IVF A;  4ZRQ A;  2LVO A;  4FHK A;  4BKS A;  3HIZ A;  4IUM B;  2MW5 A;  3UQA A;  3GS2 A;  1P98 A;  5EE0 A;  2WDT B;  4A6Q A;  1WM2 A;  2L83 A;  3HRD D;  3N32 A;  2N9K A;  1QQR A;  2L0T A;  3AE3 B;  1V5T A;  3OAW A;  1HTQ A;  1QOA A;  2JY6 A;  3DBH B;  3BK1 A;  1OTR B;  1IUE A;  3B2G A;  2KWC A;  4A8X C;  3PRE A;  3RYT A;  3BVZ A;  4BKS D;  1RAX A;  2H89 B;  3BWU D;  3NG0 A;  1WGR A;  2L0F A;  4WAA A;  4N9F 4;  1V1O A;  5D94 A;  3N1Y C;  1I35 A;  3AEE B;  4M8M A;  5J2R A;  3FIL A;  2M4N A;  3IG3 A;  4H2A A;  3QCA A;  2K6D B;  3WAN A;  4MGI E;  2IO1 B;  2ZVN A;  1VD2 A;  2N7J A;  2DZI A;  2K9X A;  1AN8 A;  1NDD A;  1SE2 A;  2YEP B;  4II2 B;  4P6V F;  1WF9 A;  2KD0 A;  3KWL A;  4HDO A;  3PLU A;  3KLS X;  1OGW A;  1WMH B;  3P1M A;  5BYS A;  3R8B A;  1B9R A;  1CZP A;  2VRR B;  1GB1 A;  1T5X D;  1ROE A;  4USA A;  2EMS A;  1X1M A;  4GOC A;  4EKU A;  3IAS 1;  3W1S C;  1E7P B;  1YN5 A;  1VDV A;  4ZYN A;  2MP2 A;  1EWY C;  2FNJ B;  2INP E;  3D32 A;  1KLG D;  5EE9 A;  2LHE A;  5E6O A;  4EUT A;  4FA6 A;  1WY8 A;  1VRA B;  4OVZ A;  1TIF A;  1N6Z A;  3ZDM C;  1WXM A;  3DHG C;  4ZOH C;  1M94 A;  3AE2 B;  4HCP B;  4M02 A;  4G0N B;  1ZGU B;  4CQN A;  1ZXI A;  1I4H A;  3ZNZ B;  4YXD B;  1UWX A;  3P4P B;  3A9K A;  2KJR A;  1GJZ A;  4WH4 A;  3QAR A;  1EWC A;  3ZXR A;  1DOI A;  1I4R A;  3VH4 B;  3AEG B;  3URY A;  3H9D A;  1TS3 A;  1PQS A;  2O6V D;  4E74 A;  3W2D A;  4NQL B;  4LNF A;  1FPY A;  4JGH B;  3RZW C;  1YX5 B;  4XGA B;  5HHD G;  3FKY A;  5AEK B;  1U4A A;  2BS2 B;  4YTN B;  1JRP A;  5E6N A;  1MHX A;  2YEP F;  1V5O A;  3A9J A;  1XLP A;  2WDQ B;  5DCN A;  1XD3 B;  2ICI A;  3GE8 C;  3KVF B;  1T0R C;  4HKZ E;  2LUE A;  1XEE A;  4MJS A;  2KVR A;  4RGM A;  2DBY A;  4RCO A;  2PTL A;  4NY0 A;  3Q8B A;  2AYO B;  2WWZ A;  3IFW B;  4ARI A;  2ZNV B;  3QX1 A;  3BVM A;  2J4X A;  1RM6 C;  1CMX B;  1HZ6 A;  2LJI A;  5G5G A;  3RUL A;  2PVG C;  4B0M A;  3Q3J A;  4X57 B;  5TSS A;  1WX9 A;  2IGH A;  5DPS A;  5BMG A;  2WXH A;  4MEL A;  3OJ3 A;  3MC0 B;  5IO9 A;  3U8Z A;  3WIM A;  2GLS A;  3ML9 A;  3ZKJ C;  2KFK A;  1V1P B;  4C00 A;  3UQB A;  3EFC A;  3HVZ A;  3DDC B;  4AS1 A;  2BYV E;  2DYB A;  2DNF A;  3MJ5 A;  2OED A;  4EZJ A;  2OJR A;  1SB3 C;  5HKH A;  3RNF C;  1VZ6 A;  1QT9 A;  5J17 A;  3A9J B;  3J9C A;  1I4Q A;  3DOW A;  5LXI B;  1S3S G;  1C78 A;  4DXA B;  2EKE C;  3W5V B;  3ZTC A;  1C76 A;  1UNS A;  3AMZ A;  4MJS B;  1CQV A;  1QF6 A;  3QC8 B;  4EOY A;  3APD A;  1D6E C;  3DBL B;  2B76 B;  2MCN B;  2B3A A;  2CKH B;  1TBE A;  3Q3N C;  3TIX A;  3PTF C;  4KDL B;  3JW0 X;  1QOB A;  2INC C;  3B9J A;  2J0J A;  3RNE C;  4YTM B;  2LXC A;  2N7E A;  2WXP A;  2LEK A;  1L0V B;  3HVD A;  5T8I A;  4ARC A;  2DEN B;  3KWV A;  2QC8 A;  2FID A;  2KDM A;  3N20 C;  4KGT A;  2LXA A;  5AZG A;  2M17 A;  4FJV B;  4DHZ E;  1HTO A;  4DBG A;  3ZNG C;  2MX2 A;  4NQK E;  4EE2 A;  2I38 A;  5BMH A;  1SE4 A;  4KZC A;  3W1S A;  2BYF A;  3DQV A;  1OQR A;  1F0Z A;  1RLF A;  2IYD B;  2N0S B;  4LDT D;  4C7Y A;  2XNA C;  1VZ8 A;  1H4R A;  2WQY B;  1FRR A;  2ZJD A;  4US8 A;  2C7H A;  2G1E A;  3U2S C;  3EFU A;  1EUV B;  2OHF A;  2ZZP B;  1TZO A;  1WI0 A;  3U52 E;  5MPO A;  1KJT A;  2DWQ A;  4XYC A;  5GMV A;  4BVU C;  2M1M A;  4MGY E;  2EEL A;  2L52 A;  3MFG A;  1TJE A;  1FNU A;  2LRU A;  1FNV A;  4JE3 B;  4W9J A;  3U30 A;  4AUQ C;  2UWQ A;  1QOG A;  4FAD A;  4ZRJ A;  1CJE A;  3AV8 A;  1KLU D;  4DDI D;  4N59 A;  5C3J B;  1EM7 A;  3W5U B;  3PGE A;  2WS3 B;  1WJU A;  3N3K B;  2WGS A;  2WXL A;  4GMV A;  2QDF A;  1V81 A;  3UIP B;  4DK5 A;  3DVN V;  1QKZ A;  1WR1 A;  1GC6 A;  4ANV A;  2LMC A;  1XLN A;  4OVU A;  4AOF A;  1Y56 A;  1XT9 B;  1IBX A;  3B08 A;  1OEY J;  3FIL B;  4OW0 A;  1NEN B;  2QIE B;  4YSX B;  3Q8F A;  2KC1 A;  2RPV A;  1H8C A;  4QAY A;  1AAR A;  3MC8 A;  1WGD A;  3AEB B;  3PHX B;  4B0E A;  3RNB C;  2N9E B;  4DWF A;  2K6Q A;  4K1R B;  1R4M I;  2BYE A;  1A70 A;  1KM7 A;  1OQQ A;  1ACC A;  1VJK A;  1WZ3 A;  2NBW B;  3BII D;  1VCB A;  2G3Q B;  4GIV A;  1PGA A;  2KX3 A;  4GGQ A;  2IJ0 A;  2C5L C;  1BUI C;  4GDK A;  1EU4 A;  2KYW A;  1YOV B;  4NAM A;  5TR5 A;  4A55 A;  4WWM A;  3AE5 B;  2SAK A;  1I42 A;  1J7A A;  2K39 A;  2XN9 C;  1IYF A;  1P9D U;  1FXA A;  2CHX A;  3Q3F A;  3NHE B;  2MHJ A;  3PZD A;  1TKG A;  4ZHP A;  2V4I B;  1SJE D;  2ASQ A;  1JQ4 A;  1WYG A;  1L4Z B;  2QMT A;  2L8J A;  2M19 A;  3UIN B;  1J0G A;  1LFD A;  4PS8 A;  2CU3 A;  2WXR A;  3PVL A;  2INN E;  1Q0W B;  1ZOY B;  5C1Z A;  2OOB B;  1RWS A;  1K51 A;  4JIO U;  3EA6 A;  2KNB A;  5LLI A;  5CHF A;  4XWW A;  3DCG A;  5GXG B;  1C4C A;  1WJN A;  1D4B A;  2BS4 B;  1YMH E;  4BBN F;  2K5P A;  3Q14 C;  2CJO A;  2Y5C A;  4M8N A;  2IDY A;  4FJY A;  4WJP A;  2N9X A;  3VFK A;  3L08 A;  2MBH A;  3QJZ A;  1SE3 A;  4GDK B;  2AQ1 B;  4L2Y A;  2R61 A;  2MBE A;  3PS6 A;  5IOI A;  1HA5 A;  2J7Q B;  1WX8 A;  2PPH A;  2LZ6 A;  3UF8 A;  2M8S A;  3T3O A;  2IZV B;  4LK0 M;  4BOZ B;  2WLB A;  3PZ8 A;  1PYW D;  4L23 A;  3TJP A;  2LVP A;  2MSE D;  2L3Z A;  5FK9 C;  3P63 A;  1VLB A;  4NPN A;  4W9K A;  1GC7 A;  4FXC A;  3DBH I;  2YLM A;  3NZ3 A;  3VTU A;  3UIO B;  3BK2 A;  3ZYY X;  4A3P A;  1GG3 A;  1C4P A;  4MM3 A;  5BMI A;  3AE7 B;  3T8M A;  3R66 C;  1YQB A;  1IGD A;  2WXO A;  2X38 A;  5BO4 B;  3Q69 A;  3QQ8 B;  1JML A;  3BYT B;  1E5W A;  3NRZ A;  2AQ3 B;  2LGY A;  4LDT B;  1L0X B;  3PT2 B;  2WHI A;  3P4Q B;  1SE9 A;  3GOE A;  4IOI E;  3MP9 A;  2KO3 A;  1RFA A;  5HFY A;  5EDS A;  1NBF C;  2MP2 B;  3O13 A;  5JXV A;  4URK A;  3VAW A;  1EF1 A;  1MJD A;  2ZCC A;  2MJE A;  2KKC A;  4A9A A;  3ZIM A;  1UF0 A;  1N60 A;  4C4V A;  3L16 A;  5JHA A;  2QIL A;  4OZB A;  2I1K A;  3GZN B;  3TL5 A;  1KFY B;  4MDK E;  3GP7 A;  1XCQ L;  5L95 C;  2KDE B;  2E6X A;  4IM2 A;  4FUL A;  1KTK A;  2MLB A;  2KN4 A;  2CS4 A;  1SJH D;  3QA8 A;  4RM9 A;  3ZRF A;  3DBS A;  4OHJ A;  4DXF A;  1L6U A;  3AH7 A;  2DAF A;  2L32 A;  2JRH A;  3CIR B;  5I4D A;  3E9S A;  3VTV A;  3TCA A;  2BKF A;  3IHP C;  4K3C A;  2CHW A;  2QJL A;  2KZR A;  3QAQ A;  2JXX A;  3VRA B;  2CHZ A;  3VTW A;  4WQM A;  4MT5 A;  1GNU A;  2N1W A;  3EC8 A;  4YTP B;  2BT6 A;  3AED B;  1G6J A;  2BF8 B;  2JT4 B;  3DVG Y;  1IPG A;  1WGH A;  3MC9 A;  4HVB A;  4XZ4 A;  1V6E A;  5E6P A;  1WIA A;  3V6C B;  1WR6 E;  1MI0 A;  2R2Q A;  2W9N A;  1I7H A;  4L1B A;  3PO0 A;  3VH3 B;  3ABV B;  2PMV A;  4PK1 A;  3I9V 1;  2NMQ A;  4BKG A;  4HXD A;  2KAC A;  2NCN A;  1JWU D;  2IGG A;  1F52 A;  2PW9 A;  1EU3 A;  1L4D B;  1JRU A;  1MFW A;  2KTR A;  2WU5 B;  3H1U A;  3RI7 C;  1WGG A;  3FC4 A;  4AQ7 A;  2M0X A;  5D6J B;  3QWZ B;  3ZNI D;  1F9J A;  4P16 A;  5JZE B;  3RCZ A;  3ZRC A;  5DPT A;  3V61 A;  2JRI B;  1YQ3 B;  3PRZ A;  2MEK A;  3TEX A;  4KIK B;  4GB9 A;  3TEW A;  4HCN B;  4MAC A;  3KH0 A;  4HRO A;  4XWT A;  2LAS A;  2J0K A;  1WRD B;  2KFJ A;  4G50 A;  5IN7 A;  4YT0 B;  5D3I B;  3RNA C;  3WAP A;  3VDZ A;  4DHJ D;  2HTM E; 
#chains in the Genus database with same CATH homology
 1XLO A;  2G1E A;  1TY2 A;  3U2S C;  3AEF B;  3NS1 A;  4KX6 B;  3EUB 2;  4IKG A;  2PLP A;  2DYM A;  2EKI A;  2RDG A;  4RNA A;  2OHF A;  1N61 A;  1ZXH A;  1TZO A;  4Q2J A;  1N63 A;  2Q5W D;  3U52 E;  1CK1 A;  5MPO A;  3TEZ A;  4KKI A;  1QIL A;  2MJD A;  1FIQ A;  2DWQ A;  3T3N A;  1R7S A;  1K50 A;  1D5X C;  1ENF A;  2TSS A;  3ETR A;  4C80 A;  2EEL A;  4A90 A;  1GPX A;  2L52 A;  3MFG A;  2BB6 A;  4KKJ A;  5G5H A;  1ZDV A;  1TJE A;  2WXI A;  5E6J A;  1F2R I;  1FD6 A;  1FNU A;  4TQ1 A;  2JSV X;  2PKO A;  1FNV A;  4JE3 B;  4RFB A;  1SXT A;  4TQ0 A;  1QOG A;  2AQ2 B;  3B2F A;  2IPK D;  5EE1 A;  2J42 A;  4DQO C;  1CJE A;  1NYR A;  3AV8 A;  1KLU D;  4N59 A;  5C3J B;  1EM7 A;  4JX1 C;  1D5M C;  2IGD A;  1FFU A;  5AUK A;  2WXG A;  4LLG M;  3W5U B;  2I2Y A;  2KAJ A;  2G9H D;  2WS3 B;  1XLQ A;  1HQR D;  1FXI A;  1K52 A;  2WXL A;  1ZUD 2;  3R2I A;  2N9L A;  4RGO S;  1QKZ A;  2WNM A;  2LMC A;  2W54 A;  1XLN A;  3AN1 A;  3GB1 A;  1ET6 A;  2E3T A;  1FCL A;  3VRB B;  1JW9 D;  1FCC C;  1I4G A;  1JAL A;  2WDR B;  1Y56 A;  1SSN A;  4D2K A;  1HEZ E;  1XO3 A;  1IBX A;  2LUM A;  3BYY B;  3FIL B;  4OW0 A;  1MPE A;  1E9M A;  1NEN B;  2QIE B;  4YSX B;  1TS2 A;  3AE1 B;  1YJI A;  4J3O D;  3Q8F A;  2WXF A;  2W3R A;  4REZ A;  1L6V A;  1PGB A;  2RPV A;  3H8H A;  2QEJ C;  3VR8 B;  1F77 A;  1RYJ A;  1F2R C;  4HKQ A;  2WXJ A;  3AEB B;  2WXK A;  4B0E A;  2PIA A;  3EGR A;  3Q8A A;  2Y5P A;  3AEC B;  5D7G A;  1GB4 A;  2LGI A;  1VR9 A;  5HG2 A;  2J53 A;  2W55 A;  2KWD A;  1A70 A;  1OQQ A;  1ACC A;  1VJK A;  4XDD A;  3Q8C A;  3BII D;  4GDL B;  3AEA B;  4ITK A;  5D3D A;  2BYT A;  1JWS D;  3RFZ B;  1C4A A;  1MHH E;  1PGA A;  1NYQ A;  4DXG A;  1E10 A;  4HJG E;  4WAF A;  1NVI D;  3P4S B;  2IJ0 A;  2M0A A;  1IBX B;  4HEA 1;  5H92 C;  3Q8E A;  4N58 A;  4NAW B;  3ZJV A;  1STE A;  4JWS C;  1BUI C;  1EU4 A;  4ZRP A;  2K3U A;  4NAM A;  4A55 A;  4WWM A;  3AE5 B;  2SAK A;  1J7A A;  4XE0 A;  2XN9 C;  2Z8L A;  2V3P A;  1FXA A;  1RFK A;  1DGJ A;  3BVG A;  4C7Z A;  4RH6 A;  1YN4 A;  3MHZ A;  2BBC A;  1K53 A;  4ZHP A;  1TKG A;  1NEK B;  2V4I B;  2WU2 B;  3TEY A;  1SJE D;  3W9C B;  1JQ4 A;  2FUG 1;  1FO4 A;  1WYG A;  2KMM A;  1L4Z B;  2QMT A;  3HUI A;  2W3S A;  3R2T A;  2M19 A;  2ACZ B;  4ZRQ A;  1N62 A;  3GS2 A;  1JRO A;  4M0W A;  5H8Y E;  2CU3 A;  3NVW A;  1Q10 A;  5EE0 A;  2WXR A;  3SR6 A;  2AX5 A;  4WIP A;  4A6Q A;  2L83 A;  2INN E;  2NTS A;  1ZOY B;  3HRD D;  1QLB B;  3ZJT A;  1RWS A;  3P4R B;  3V05 A;  1K51 A;  2N9K A;  3EA6 A;  3I57 A;  4JPS A;  4RGN A;  1QQR A;  3AE3 B;  1YN3 A;  2JXT A;  1QOA A;  1D4B A;  4XWW A;  5GXG B;  1C4C A;  5BYQ A;  2H88 B;  1PDX A;  2V3N A;  3BK1 A;  2ONQ A;  3N9Y C;  3FAH A;  1SF0 A;  3OWE B;  1IUE A;  2BS4 B;  1YMH E;  3B2G A;  4A8X C;  2K5P A;  1ESF A;  2CJO A;  2GRI A;  2Y5C A;  1FNW A;  3BVZ A;  2IDY A;  1I4P A;  5AUI A;  2JYE A;  2H89 B;  4GLS C;  2WXN A;  2JZP A;  3BWU D;  1C79 A;  2J52 A;  1V1O A;  2W82 A;  1SE3 A;  2ON8 A;  4GDK B;  2AQ1 B;  4L2Y A;  2R61 A;  2WXM A;  1WXQ A;  1ZP0 B;  3AEE B;  1WWT A;  3FIL A;  1HA5 A;  1HXY D;  3IT6 B;  4OZC A;  4H2A A;  3T3O A;  4LK0 M;  2BW2 A;  2PVO D;  2WLB A;  2V0G A;  3PZ8 A;  1PYW D;  4L23 A;  2N7J A;  4TSS A;  2K9X A;  1AN8 A;  2SEB D;  1SE2 A;  2YEP B;  3P63 A;  5FK9 C;  4C56 C;  1GAQ B;  3DWM A;  4P6V F;  1VLB A;  2K22 A;  2JU6 X;  2JWU A;  3KWL A;  1XF5 L;  4FXC A;  4RF1 A;  1PUT A;  3KLS X;  1JCK B;  3P1M A;  5BYS A;  3R8B A;  1B9R A;  3NZ3 A;  3ZJU A;  2ZW1 A;  1CZP A;  4KGR A;  1GB1 A;  1T5X D;  3BK2 A;  4ZHO A;  1ROE A;  3L4P A;  3P42 A;  4USA A;  3ZYY X;  2K0P A;  1UGJ A;  1BML C;  3IAS 1;  4YWG G;  1E7P B;  1C4P A;  1YN5 A;  1VDV A;  5BMI A;  3AE7 B;  4YSY B;  1AWD A;  1FMA D;  1MVK A;  1EWY C;  1KF6 B;  2INP E;  3DWG C;  1IGD A;  2RMM A;  1KLG D;  2WXO A;  5EE9 A;  2LHE A;  1TKY A;  1FM0 D;  1JWM D;  1VRA B;  4OVZ A;  3LB8 C;  2X38 A;  1DYQ A;  3CWI A;  4RGT A;  3E56 A;  3Q69 A;  4ZOH C;  2WP9 B;  4OZA A;  1JML A;  3AE2 B;  3LYY A;  3BYT B;  1L0Y B;  3NRZ A;  5FR3 A;  1QOF A;  1N5W A;  1V97 A;  4CQN A;  1ZXI A;  1I4H A;  1NI3 A;  2AQ3 B;  3KQ4 A;  4YXD B;  1UWX A;  3P4P B;  4UDU C;  1L0X B;  2JX5 A;  4WH4 A;  3U4E G;  1EWC A;  1DOI A;  4MM3 B;  1XXG A;  1I4R A;  3P4Q B;  3AEG B;  3URY A;  3MP9 A;  1FEH A;  4IOI E;  1T6B X;  1V1P A;  1YJJ A;  5HFY A;  2BS3 B;  3VQI A;  1TS3 A;  1GOZ A;  1AW7 A;  5FKA C;  3O13 A;  5JXV A;  3W2D A;  2WXQ A;  3PZ7 A;  2MJE A;  4A9A A;  3SEB A;  1J7B A;  1N60 A;  5HHD G;  1B1Z A;  2QIL A;  4OZB A;  1TKE A;  1WSP A;  2BS2 B;  4YTN B;  2ZW0 A;  4RF0 A;  1JRP A;  2QSD A;  4XDC A;  1MHX A;  2YEP F;  2BTE A;  1KFY B;  1ZDX A;  5C2T B;  3NVY A;  3BZD B;  1XLP A;  2WDQ B;  1OFF A;  3GP7 A;  2ICI A;  3ZGZ A;  1XCQ L;  3V3X A;  4HKZ E;  1C9F A;  4O1N A;  1XEE A;  2FE8 A;  4NJC A;  1DOX A;  2DLB A;  4RGM A;  2E6X A;  2DBY A;  1TY0 A;  4RCO A;  2PTL A;  1C77 A;  3AE9 B;  3Q8B A;  4ZYS A;  1KTK A;  2KN4 A;  2L1A A;  1SIJ A;  1SJH D;  2CJN A;  3UI3 A;  4ARI A;  1FRD A;  1TYG B;  3BVM A;  2J4X A;  1RM6 C;  3NUH B;  4OHJ A;  4DXF A;  2GB1 A;  1HZ5 A;  1TS4 A;  1L6U A;  3AH7 A;  3VR9 B;  2L32 A;  3CIR B;  3NVV A;  3E9S A;  1HZ6 A;  2LJI A;  5I4D A;  1KH0 A;  5G5G A;  1BXT A;  2PVG C;  4B0M A;  1ET9 A;  1KRH A;  5TSS A;  2IGH A;  2QJL A;  2HDE A;  5BMG A;  2WXH A;  3VRA B;  1D5Z C;  3MC0 B;  2LHD A;  1PFD A;  2DYO A;  1JWB D;  4WQM A;  1AYF A;  4MT5 A;  4YTP B;  1UWM A;  2BT6 A;  1SEB D;  3AED B;  1I4X A;  1WRI A;  5BYR A;  2MH7 A;  1V1P B;  2JQR B;  3IXS A;  4N6E B;  2Y3A A;  1SBB B;  3AE4 B;  4R3D A;  3NVZ A;  3C8Y A;  1E6E B;  4AS1 A;  3HVZ A;  3U7Z A;  1M4V A;  3AB5 A;  1E0Z A;  4MH8 A;  2D5G A;  1J7C A;  2FBW B;  4WUR A;  5HI1 A;  3MJ5 A;  2OED A;  2GI9 A;  1N5X A;  1SB3 C;  2M56 B;  3SFE B;  3WCQ A;  3TSS A;  1VZ6 A;  1MI0 A;  1QT9 A;  1VZ7 A;  1V8C A;  3J9C A;  5LNK 1;  1I7H A;  4L1B A;  1I4Q A;  2VZK D;  4TMA B;  3PO0 A;  1C78 A;  3ABV B;  2PMV A;  3W5V B;  3I9V 1;  1C76 A;  1UNS A;  2NMQ A;  4KGS A;  3AMZ A;  4JWU C;  1CQV A;  1QF6 A;  2BB5 A;  1D6E C;  2KAC A;  1P7E A;  2B76 B;  1JWU D;  1FFV A;  2IGG A;  4IDI A;  2PW9 A;  1EU3 A;  1QOB A;  2LFI A;  5EE3 A;  1L4D B;  3B9J A;  4US9 A;  3RPF C;  3SFD B;  1L5P A;  2NTT A;  4YTM B;  3ZQ4 A;  2RDH A;  2WU5 B;  2WXP A;  2LEK A;  1T3Q A;  1L0V B;  4YSZ B;  1IGC A;  3IAM 1;  3HVD A;  5T8I A;  1JWA D;  3FC4 A;  4ARC A;  1LO5 D;  3LXF A;  4AQ7 A;  3KWV A;  1DOY A;  3IT4 B;  3AE8 B;  4P16 A;  2KDM A;  1YNT E;  1ZE3 D;  4KGT A;  2VZK B;  1YQ3 B;  2WDV B;  2MEK A;  3TEX A;  2KQ4 X;  1TS5 A;  4EE2 A;  3TEW A;  3AE6 B;  2I38 A;  4HRS A;  5BMH A;  4US8 A;  1PGX A;  1SE4 A;  4MAC A;  3W1S A;  1ZPS A;  4HRO A;  4PT5 A;  1XCT L;  2JYT A;  1OQR A;  1UUP A;  1F0Z A;  2N0S B;  4XWT A;  4C7Y A;  3AM9 A;  1WGK A;  2XNA C;  4NZL B;  1VZ8 A;  3TUO A;  4YT0 B;  4LTU A;  5D3I B;  2WQY B;  1YQ4 B;  1FRR A;  1P7F A;  2MJ3 A;  2HTM E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...