2AXGA

The immunogenicity of a viral cytotoxic t cell epitope is controlled by its mhc-bound conformation
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
276
structure length
276
Chain Sequence
b'GSHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRTEPRAPWIEQEGPEYWDRNTQIFKTNTQTYRESLRNLRGYYNQSEAGSHIIQRMYGCDLGPDGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGLCVEWLRRYLENGKETLQRADPPKTHVTHHPVSDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, B*3501 heavy chain
publication title The immunogenicity of a viral cytotoxic T cell epitope is controlled by its MHC-bound conformation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system/gene regulation
total genus 77
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 2005-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2axgA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 2axgA01
2HFEB 5CWSA 5F8QC 5I8KL 3SJVE 4L8SA 1FVCB 3V6OE 4EN3B 5MI0B 1BGXL 1I3UA 4OZIE 4G7YH 1XH3B 3QJFB 2F54D 2HLAB 2MTPA 2EDRA 1P84J 1RURL 2CUHA 4NQED 1ULVA 1JGDA 4LLDA 1MREL 1YQVL 3R06B 5D7SL 4AT6B 2EICA 3CFBA 1N5AB 1AE6H 1XAUA 4YHML 1WT5C 4HUWB 2FR4B 2DWEA 3WO4C 3VXPA 3C6SB 2Q6WB 1MLBB 4Y16D 3T8XA 4JR9L 1EVTC 2YRPA 2K9UA 2VITA 3ROLB 4P59H 3S5LA 1MLCA 2ICWA 5I1GL 5DUML 1DQML 5IBLD 2EDXA 1Z9OA 5I1AA 2EDLA 5IFAL 5KOVC 4J23A 5DD3H 2Y9RT 3D0LB 4I1NB 3S88L 5F7HA 5GRUH 1BFVL 3ECBB 1AH1A 2HJFB 1ITBB 5CEXB 3ZHDA 4QRPA 3SDDB 1KG0B 1D5BB 3ULUL 1TTUA 1GGYA 2CK0H 1MNUL 1NBYB 3DVGB 4P5MA 1A4JB 3L9RB 3P9MB 1HQRA 5TE4H 1FYTA 2A83B 5F9DC 4BH7A 4N5UA 1IFHH 2QQNH 1EEUA 1IGMH 1FNSL 1XCQA 3MGOB 5DJ2A 5GSRB 3VRJB 5ICYB 1QYGH 4NRXB 4R7NB 3ARZA 1RY7B 2CJUH 5EU3B 4N9GB 1ZHLA 4ODXB 1HXYA 1S5HA 2EIZB 1NEUA 4PJFB 1UVQA 4RAVB 2P48B 4OIAA 5E24E 2BSSB 1FFPB 1OB1B 4ISVA 5IV2A 3WDJA 5LWYH 2DJSA 1U91A 1X6NA 4LIQE 3ULVF 1MHEA 3D69A 4WFEE 2BHUA 1OWWA 5IMMA 5JHLL 1CE1H 3RX5A 3O0RL 3GSNH 3KLAA 3VXRE 3UJIH 1E6JH 4UT9H 3SEPA 3C6LB 4PJ5A 3LAFA 2B1HL 5J4MA 1EHNA 4K94L 5T1MA 1XF5B 3VWKB 1FP5A 4K8RH 5IMOA 5A2IH 1CR9L 3WFBL 3O2WL 4LU5L 1EDQA 1CGWA 4N8CH 3GSUA 3CLFL 5SWZD 2EDHA 4U1MA 2WQRA 3QNYB 1NC2B 1QACA 3O9WA 4RMVA 1DVFC 2XXMB 5DMGC 3IDMA 4ZS6D 2F8OA 1QLEH 1NCDL 4NKDA 4PRPA 1YC7A 4F3FA 4I9WD 4W68A 4H1LH 4OJFL 5SX4I 5HYEA 3BRDA 2A2QT 3GHEH 3LS5H 5GGVH 3UJTL 1FIEA 3RI5F 2Z4QA 3EO0B 4AENA 5JXEC 1C7TA 4HKBB 1A6AA 3PV6B 1G0XA 5D1QC 4A6YH 1QR4A 5L2KB 4E41A 3CK0L 3PDOB 4OCYL 5DLMH 5JQ6H 4XTRD 3NACH 1F4AA 4W4OC 1D5ZA 4FFWC 2MHAB 4XB7A 3RX7A 5IEHA 4OSUH 5EZIH 4XI5D 3CVHA 5HDOA 5JMRA 3FCTB 4MB3A 2DD8L 1G6RH 1HH9A 4DKEL 3X14A 3KHOA 3ZYJA 4LNRB 5F21B 5CD3A 2Z92B 4FABL 2CMRL 3MGTB 2OQJB 4PUBH 3BMVA 4S10A 2V17L 4MSWA 4OZGA 4B5EA 1UJ3A 1EHLH 4M1GH 1G7IA 2AW2A 1DFBH 1RHHB 2XWBA 4FQ2H 5FUOL 1V7ML 2FGZA 5EBLA 3P77B 2BMKB 3D85D 1J9CT 4XRCA 5I74C 1RIHL 4DKDC 4N0FA 2IAMA 4MS8A 3PWNB 5GGRA 32C2A 3SO3C 1GGBH 2P8MB 1G9NH 1RSFA 3H42H 2XZQL 1CQKA 1G1YA 2NY5C 3D39E 3P0VL 1A7OL 2HN7A 4EUPG 4XNQA 1BVKA 4IRSA 3H7BA 3BZFA 4P9HC 4O00A 1ORSA 3MNVB 4UTAH 4K3DL 4W4NA 3LDBC 2X9YA 3QUZB 3ARED 1CWVA 4ELMF 3UJJH 1KCUH 2HT2C 3GI8L 3KYNB 1E27A 1NGQL 3WN5A 3FONB 4DTGH 4YR6A 2CSPA 5I1KL 4GAJL 4PREB 3HI5L 4B7LA 2D31B 2H3NA 4RMQA 1T5XB 5KSBB 2E27H 1AO7A 2BC4B 4WU7A 3AROA 2NX5B 1GHFH 3T0XA 5L9DL 4MVBC 4U1IB 1PSKH 3K46A 3LKPB 1U9KA 4GW5B 1LEGB 1DBAH 2PR4H 2YUVA 2Q8BH 4HIIA 4ZUTB 5GISH 1HEZA 2CO6B 3MREA 4KMLB 1GL4B 4L5FL 4CU8A 3IGAA 4WFGD 4U1GC 4RGNC 4XVJH 5C0DB 1CBVH 2GJZB 2LE9A 2FYYB 5EUKB 1GAFL 4JM4H 4CRPA 4Y2DC 1B90A 2GTWA 4F58L 4HPOL 1P9MC 2HH0L 5F1IB 4R3SA 4Y7MA 4MQ7A 5FCUH 3MMEB 3PWLB 4QXGH 3SGJC 5I1CL 5H35B 1T5WB 3QIBB 4LOUD 5GRWA 5HHOD 1IQWL 4HIEA 1BOYA 1RMFL 4HS8L 4JB9H 3DBXA 2E3VA 1H3WM 1W0VA 4C4KO 4JFXA 3W0WA 4OZHA 1HHHA 3H9SD 3UYPA 1Q38A 3CX2A 2E9IA 3E2HA 3L7EB 3STBA 5KSAB 4JZJC 1MRDH 3RVVC 4WHCA 3TN0C 1NFDB 2C3GA 3OKMA 5AYUL 4WU5A 2ESVD 5DSCA 4S1QH 3ILQD 1DN0B 3V0AC 3KPRD 4L3ED 3SDDC 3ZTNH 2PXYA 2R4RL 2WUBL 3DVNA 4KJYA 2MWCA 2NXZD 1YEKH 3L5WB 2ZG3A 1LP9E 5DS8B 4QLRA 3QXAB 3NH7H 4BYHA 4S2SB 2GUOB 4X9BA 1J5OH 3K8LA 2FO1A 5F3HB 1YEJL 1D5IH 1AKJD 3IVKB 2LQRA 5IVXA 2Q3ZA 1TQBC 4QCIB 5E2TL 3HC3L 1BFOA 4JKPH 4QHLA 4JDVB 3LMJH 4RMTA 3H0TB 4NQSB 5CEZD 5MP6L 2DKMA 4Z95H 4APQC 5T1LB 2DDQH 4U1JA 3QIWA 4R2GB 1ZLWH 4LHJB 3QXTA 2APXA 2DLHA 4MA7H 4FMFA 3I75B 3F12A 1BD2E 4LPVA 2ATKB 4WUUA 3TM6A 1I9IH 2O5YL 3LEXA 5FGRA 4OLWH 5DDHA 2F5AL 1ZLUK 3DNKA 1ZHBA 4TOYL 4G6FB 4XCEB 1GGTA 5D2NC 3M17B 5J11C 1Z9SA 5B38G 3QT2A 5C8JB 4TQEH 4ELME 1CL7H 4F7MB 5EZLA 5BMFL 4DKAA 4XMKH 3WFHA 2DYPB 2KPNA 2I07B 2PW2B 2P44B 2YA0A 3SBWC 5JHDE 3MJGX 3QHTC 1YN6B 1FVEA 4D9LL 4M43L 5F3BA 3QNZA 4LIQH 4OLZH 3QEHB 1TZGL 4PRNA 1MFDH 3TA3D 1KLGB 2BXZA 3LQAH 5HGGS 4TTGA 3WIIH 1ZT1B 4NQDD 5C6TH 4G8IA 3ZKND 3DO3A 2HT4C 1QQDA 1I8IA 4IHOA 3MRFB 2VXTH 5FYJL 4K8RC 2DMCA 5LGHL 5M7QA 2B1AH 3TJHD 4HJGB 3VXMD 2B20A 3OGCA 5D96C 5D7IB 4JKMA 1UJTA 1ONQA 4P2QE 5CEYB 3L3HB 5TPWH 2Y25A 4ODWB 4BSVA 3QDMB 5HDQH 3C87A 3U0TA 4OGYL 5I1IL 1YEEH 5F9AC 1KN2H 5ETUB 3FO1A 3RWFB 4GXVH 3Q5YA 4XNYH 4D3CH 1SYSB 1FDLH 3IETB 2FIKA 5HHMA 4XMPL 3O3UN 4HH8A 4Y8AA 1XGRA 3S5LG 4TVSa 3IDXH 4UU9A 4I3RH 1AHWB 1YMHA 5LCVH 2XPGB 3O3DA 4WNQA 1S3KL 2AGJH 3IDIA 4QHMA 1K4CA 4X6DA 3IU3B 4ZAKA 4KTEL 5DEFB 3ZE0E 5IGXH 1T4KA 1OSPL 3J8F7 1QFWM 2AEPH 3KPSB 5ADOH 3IAPA 4OLXH 3DUSA 4OIIH 5GRYA 3QUYC 2BX5A 4YXLH 4IBLT 3LKNA 3MZTA 1FL3A 4E0RB 5IB1B 2X41A 3CFKB 3RPIA 1U36A 3T0DA 3HNTH 4M61B 4QYOA 4TSAL 5DJYB 4JG1L 4G8GB 1RZIB 4R4FH 4YZFF 3RWEB 1DANU 4K07A 5DEGB 4LDOB 2UVEA 4UV7H 3HZVA 4EBQL 4X4XA 1PX4A 2B7DT 2DM7A 1CGTA 4R96B 1G9NC 4M1CC 3LQZA 1U8QA 2WBJB 3TBSB 3BGFC 3D25B 3DXAB 3FQXA 1KJVA 3QXUA 5C7XL 3OZ9H 3ARBC 4RBPK 4Y4FD 4HW6A 3RTQC 4Y19D 1ZV5A 2UZIH 1MCOH 3V95A 3LPGA 1A6TB 2BNRB 3QXDB 1JNJA 2VABA 4G9FE 4Y5YC 3C5ZB 1B0RA 2IG2H 3MBEB 3Q0HA 1MWAA 2OXGA 5DMIH 2IMMA 3EYOB 1D3CA 2G9HB 3FO2A 1YMMA 5IT2H 2Y7QA 1K5NA 2OJEB 1MIMH 2Q7YB 5ISZE 2CIKB 4MGXA 1F3JA 3LCYA 3S34L 3QCUL 1NGZA 1NANH 1SMAA 5GRJH 3QG6B 3O81A 4PRHA 3TYFB 2Z93B 3SKOB 3VG0L 4YDJA 3KYMA 4EDWH 1ED3B 4KKLC 5DD5H 4YUEL 5C09E 1TMCB 2GSIA 3MXVH 1XF2A 3OKDB 4M7ZB 4XX1G 4XT1C 3ETBF 1OGTB 2C3VA 1XF3A 3GB7B 2VLKD 4EIGB 4XPTL 3KJ4B 2LFGA 3UTSB 1KCKA 3U7YL 3EAKA 4CN4A 5DHYB 1JGLL 5EOCH 2PCPA 5ILTL 3MUGA 4X80H 4QXUL 5D7JD 2F15A 3KYOA 5EA0H 4DAGH 4YQXL 3AAZA 4M8QA 2PF6A 4P2RA 3LB6D 5JDSA 2QQKL 2FL5A 5BCAA 1QSFD 1FJ1A 2X70B 4JFPA 1JGEA 4WW1B 5FYKE 2XXCB 4YHKH 5C0CA 2EYTA 1C1EL 4P4KB 1P1ZB 3DRTA 3CLEH 4WDIB 3HMXL 2XN9E 4W81A 4XP6H 1CTOA 3VXUA 5B3NA 4GLRH 2X1WL 1DE4A 4U1LB 1R5WB 1CDUA 3KXFE 3VFGH 1CFNA 1UB6A 1BVLA 3ZT7A 2WUCL 3BHBA 1NAKH 5LGJB 2WMPA 5IHBA 2HWZH 1K8DB 4OBSA 3ZKSD 1ZT7A 1HWGB 2Y36L 1OP5H 2OR7A 4Z0BH 4ZS7H 4FQIH 5IB3B 1U6AL 4JO1H 1IGYB 4NNPL 4XP5H 3S3PA 1YECL 2MQ3A 4KK5C 4JRYA 3VRIA 5HI5C 4NKMB 3EDKA 3MODL 2XIDA 4WENB 3LHPH 3Q3GB 3RUGA 3UBXA 5I9QC 2E9JA 3F7PC 1IKNC 4IOIA 3C5JB 1IARB 3WV0A 5EWIH 5KVDL 1CLOL 1BAFL 4QTIH 4YZFE 5JA8B 3DETC 1U8KB 4NQUA 5EBWB 3E8UL 4XP4H 5I30L 3ZL4L 3MRQB 1F4YL 3WUZA 3SGDI 4C83B 4YDIL 5I75B 5D6CA 1UFUA 1VEMA 2P7TB 3OMZA 1GGIL 2HVJB 3KPMA 1CK0H 1TLKA 5K9KB 2C7UB 1YC8A 3HZMA 2W9EL 4XXDA 3EUUA 1EJ6A 1J8HB 5E8EA 4U4BA 2ZPKL 3V7AE 3OKEA 3DROA 3Q6GL 3U7WH 3F58H 3JV4B 5MEQA 2PTUA 1MAML 2GSGA 3SE3A 1YNLL 1WC7A 4RGMC 4DUVA 4BQ9A 5IQ9B 4WHTB 3RWJA 2EC9U 3C5SA 4MAYD 1CICB 2CDFB 3T4YB 4PJFF 3B9VA 3LQAC 1QRNE 3FTGA 1EO8L 1OSZB 3FB8A 4FZEH 3F7QA 3KPNB 2Q86B 5HI4D 3T09A 4FQHB 1SEBB 2J6EH 5IVZA 2QADC 1T1WB 3BI9X 1I4FB 1OGAA 2OI9C 5T3XL 4NO3B 4HPYL 1WTGT 4XCNB 1BZ9A 3SDAB 3DRQB 2LVCA 1A7PL 4XNUH 4X5XB 3S35L 2FEDD 3U82B 3EJYD 4YDLB 1JIBA 4WO4D 1BM3H 2XOTA 1MFEH 1V7NH 2DS4A 2DLGA 2C1OB 5C86A 1B4JL 1RJCA 4DWHA 4P3CL 4OBRA 3BPLC 4V3DB 2EDDA 5ESVB 3QNXA 25C8L 5D7KD 5T5FH 5D93B 4GAGH 4LPYA 1BQHB 3C60A 4MNGB 3FFCE 3RIAF 5DJ8B 1E4WL 2YN5A 5E8DL 4TSCL 5HGAA 4YHNA 2OS7A 1DQLH 1HYSD 2VQUA 3CH1A 5FOJA 3IS1X 4H25B 4UT7L 5DD0L 2F58H 4S0UC 1IZKA 4NKOA 1AGBA 4OGAC 3UEZA 4KKAD 1UQSB 3GIZL 2EDJA 2R1WB 3WO3B 3G5ZB 2EDOA 3QUXA 3IS0X 4Y5XA 1MRFH 4PJEB 1EZVX 1CGVA 5GS1C 4F57H 5C0FA 1UM6L 2FWOA 4DN4L 5J6HB 1OF2B 5GRXG 2P5WE 3QEQD 5C0BD 1F90L 1FNHA 3I9GL 1FV1B 3I3DA 3T4AA 3HTLX 2A1WH 3IDNB 1ZGLM 4FTVE 2AEQL 4ACPA 3FQTA 4NM4H 4MCYA 4FNLL 5H94B 2NW3A 2YPLB 2R0LL 1JHKL 4N90E 3LKQA 5DRZA 3WJJC 4YGVA 3EIFA 1TNNA 2NY0D 4U7KA 2O93L 3ULUF 3T2OA 1YY9D 3HPJB 1BJ1H 1W72H 5I16B 3QQNA 2GY7B 3VD5A 4ODHL 3V0WH 5CSZB 5FM5M 1R5IA 4JANA 5JDJA 1WFUA 1NDMA 3SDYH 5F7KC 5DJXA 1BLNB 5FO7B 2YUZA 1JYVA 1WZ1L 4UOW0 3QJHA 1YEFH 4YAQB 4PRID 5DRNB 1CFQB 2J8HA 1NSNL 5CWSB 1BFTA 5HYJA 4MXQA 4L8SB 1R0AH 4NC0B 4YDKH 2UUDH 1FYHB 1WV7T 1YJDL 4L4VE 4LKCA 1JZ7A 1BQUA 4HULB 1I8LA 1JNHA 4UOJA 4N1CA 1OAQL 1JGDB 4LLDB 2V2TA 1CGXA 4JGMA 4UV4L 3CFBB 2FHBA 4NJAH 4PJ8A 2DWEB 5KSBF 1QFHA 3VXPB 4MA8L 3VGFA 3T8XB 1J1PH 3JWNC 1T0MA 5DJDA 5BS0E 5IHZA 1CZ8L 3QQ3A 2VITB 2NY2B 4HWZA 4LEXL 4M7LT 3TV3L 3S5LB 3OB0K 1MLCB 3CVHL 2ICWB 3C2AH 5I1AB 5TH2B 3WD5L 1I7UA 3LOWA 4JLRA 1DR9A 1JWMA 4X7SL 4M7LH 1ZMYA 4QRPB 2OYPA 2W60B 5DJCA 5T1DL 1ZXQA 4XCFH 2CRYA 2KL6A 4XNMA 3LV3A 6CGTA 3OF6A 2VAJA 4P5MB 3I3EA 3MV7B 1HQRB 3RVUC 2YD2A 5ITBH 1FYTB 2VKWA 4L4JA 3SE9L 1KLFA 1KCRH 4M9OA 4Q0XL 3LN9A 2ATPA 2DJUA 1XCQB 5DJ2B 3BMWA 4XNZC 1P4BL 5FYKH 3BRGC 3QHFL 3HI6L 3CGTA 5I8CB 1T83A 3NCJH 1ZHLB 5FXCH 1KCSL 1HNGA 2RGSA 1HXYB 2IBZY 4S11A 1S5HB 2BJML 5IROC 2WY3A 1UVQB 4HCRA 3U46A 4ISVB 5IV2B 4O5LL 1FNAA 1BOGA 1NMBL 4OT1H 1NFDF 1U91B 4Y16A 1N6VA 3IFPA 1YEIH 1MHEB 1INEL 1AXTH 1CTNA 1LK3H 3D69B 4P9MH 4PY7A 5A1AA 5IMMB 4CU6A 3DMMA 5L2KE 2IFFL 1FNGA 3BD3A 3KLAB 4M7KH 4WGVB 1L9NA 3LRGA 5D71L 4PJ5B 1E4XH 3NGBC 1A7BA 5T1MB 4WY7H 2V5TA 5IMOB 2EDQA 4OLYH 3GKWH 4WFFD 4F8QA 15C8L 3BESR 4UDTB 2BNUA 4NCC2 2X89D 4U6YA 1I3VA 3GSUB 1R3IH 4U1MB 2ARWA 3O9WB 1YNKH 4M6AA 3RU8H 3ULUE 5DUPL 4DGIL 4NKDB 4PRPB 2F53A 5KZCD 4F3FB 2OL3H 4AK1A 3I02A 2HKFH 5IHUL 1UM4L 4M48L 1Z3GH 2K1MA 4MQXD 2ARJA 2Z4QB 4AENB 4QT5A 5HYSA 3MC0A 4KJPC 1A6AB 4OM1L 4LPXA 1P2CA 3CXDL 5D1QD 3T08A 2NTSP 4E41B 3HCVA 1T80A 3CDCA 1ZSDA 4G6ML 1D5ZB 1C5BH 4FFWD 5E2UH 4KHXL 2FX7H 1Q0XH 1HDMB 5IEHB 4AMKH 1HZHL 3QA3B 2XWJA 4YE4H 1HHIA 5DVLA 1GOHA 5T1KD 4AEIL 4TYUA 3X14B 2HKHL 3TWCH 1ZKAA 5CD3B 4PJCA 1A6VH 4MSWB 2Q7NA 4OZGB 1UJ3B 1N26A 5E1AA 5IMLA 1G7IB 5IM7A 4OKVA 2N1KA 4JN1L 2XWBB 4ONFL 3EOYG 5EBLB 1NLBH 2NX5E 3P30L 5E2WH 5E5MA 3HUJA 1S8DA 1D5MA 4XRCB 1K3ZA 5B39A 4N0FB 2IAMB 3KPPA 1Q72L 1OAUL 3HS0A 2FD6L 5GGRB 2UY7A 32C2B 3FB7A 5BZDA 1LEKA 5SWZA 2Y6SC 3VGHA 2DQTL 3WCYA 2C9AA 2HN7B 5F1OB 5HPMA 3JTCA 4XNQB 1BVKB 4IRSB 4ENEC 2HFFA 3H7BB 2DBJA 5D7IF 3BZFB 1ORSB 3NFSH 3TH4T 2NPLX 3O4OC 4YDVA 5D8JL 3B8SA 4F15B 4F80A 3QRFM 5C07E 4PG2C 2HT2D 4S1RH 2OR9L 1MHPL 1E27B 1NCUA 3WN5B 1ZLUH 3EJJX 1O0VA 4YR6B 3QQ9D 5FGSA 2OSLA 4QRSA 5DHXB 3FHAA 3KPTA 2H3NB 3QUMH 5EIQA 3DX9A 1VESA 5TDOB 4PFEA 5T3ZD 1AO7B 2VZTA 4JZOB 4WU7B 4MVBD 3GI9L 2BVUA 5IJKA 4MQTB 3HLAA 1JNNH 4PLOB 5CILL 1OAZH 2R56H 4ZFFA 1JGVL 4HIIB 1ACYL 4H88L 5DT1L 1A7RH 2AXJA 1HEZB 3MREB 1KTDA 5FUZH 3VXQA 5E1HB 3LN5B 3P4NA 3IGAB 1BQSA 2AI0L 2EC8A 2Q8AH 4WWID 3MLSL 4LDEB 4XPGH 1JF5A 2OMBA 3OKNA 4O58L 3D85A 3CZJA 2XQBH 3C09C 4Y2DD 3JWOL 2GTWB 4FFZL 4XBPA 4G7VL 4J3SA 2VXVL 3OJDA 1E28A 3QIUA 4LAQL 4N0CA 4R3SB 4DUXA 4UIMA 4MQ7B 3IJHB 5DJ0A 5CJXC 1RZ7H 3MRNA 1CD8A 5CJQH 1JE6A 4KVCH 4HIEB 3O6FD 4R90H 3DBXB 2VMFA 3AREA 3O6LH 3UZQA 1W0VB 4JFXB 3W0WB 1MFAL 4TULL 2H2SC 4G6KH 4OZHB 1HHHB 3QG7H 2DKUA 1RZKL 1OM3H 4YHPA 1ZTXH 3E2HB 5F97E 1AI1H 4WEMB 2Y1VA 4OZFA 3RVVD 4JG0H 4NN7B 3TN0D 5E2JA 5AYQA 2A9ML 4GMSL 3OKMB 3UAJD 4WU5B 3PL6D 5DSCB 2EKSA 3MO1A 1RU9L 2X5PA 3SGKC 1T7VA 4OTXH 2FLRT 1RI8A 2PXYB 3DVNB 4WHYG 4KJYB 5E7FA 4JO4L 1BBDH 2FHCA 2FGWL 1MIEL 4XPHH 4UBDC 4FXGA 4NOFA 5F96H 3FMGL 4LSPH 3WXWL 3NMEA 2A74A 5IVXB 2R15A 4NKIH 5J3HC 2NY4C 3VXOA 1F8TL 1XCTA 1I1FA 5AWNL 1BFOB 1I3GL 4QHLB 7FABH 2I9LA 3BD4A 1QFWI 4XAWL 4O9HL 4LGSB 3PWJA 4NZTL 3VG9B 4U1JB 3QIWB 4WW2C 4NQCD 5HHOA 1TITA 4QOKD 1X5ZA 3N1MC 3ZDZE 4EI5C 5F9OH 4JFOA 5M95B 3F12B 5CGYC 1NUDA 5INCA 4RBPH 4WUUB 4HK0A 4UMGA 1X5HA 5IESL 3H9SA 3LEXB 4DN3L 5D7IE 2V7HA 5SWSD 5DDHB 4MA3A 1ZHBB 3CDYA 3HMWL 5JORA 2X1QA 1IC1A 3MLRH 1L0QA 4GAYA 1BGXH 4KVNL 5EZLB 4PLNC 2J88H 4O2FB 1W8NA 3O6KL 2NCMA 3WFHB 2RCSL 3BQUC 3HZYA 1K85A 4NN5C 4QRRD 3JV6A 5FUCC 1FVEB 4FXKA 2ZOKA 2R1XA 1CDJA 5F3BB 4HIXL 3QNZB 5KANI 4PRNB 1MWAL 2Q20A 4BQ8A 4TTDD 4YHMH 5IP4A 2AXGA 3ALWA 2APVA 4LCWA 1QBBA 1AKJA 4NQXA 3QYCA 2ZUSA 5GHWL 2HT4D 4JQIL 3IFLL 1QQDB 5HVHB 1I8IB 3ARGC 4IHOB 4PJBA 3ARQA 4K8RD 4JFDE 5I1GH 1VFOA 5DUMH 1DQMH 3OGCB 3RJQB 3IDUA 1I9EA 4YHLH 1V3JA 3K2UL 3LH2H 4NOBA 3S88H 1AQDA 1DQDL 3RL2A 4BK4A 2VL5A 1BFVH 3T2NL 4BSVB 4KH2A 4HG4K 2PO6A 2J1KA 3UTPD 3U0TB 4GBXC 1UCBH 3FO1B 4PB0L 5HHXL 2YC1A 3BP4B 1MNUH 4EQ3A 4UINL 1IGTA 3REWA 4G8GE 4Z8FL 4KTDL 2FIKB 3BKYL 4JE4B 1KUMA 5HHMB 2IPTL 1DBJL 2O26U 1J0KA 4HMDA 1XGRB 5A2JH 3HPLA 2IH3A 4UU9B 1FNSH 1YMHB 4CDGC 5I1EL 3O3DB 4WNQB 3F65A 5F1KC 1VA9A 4MZ2A 1JZ3A 3GSVA 3IDIB 3QWRD 1K4CB 4QHMB 4X6DB 4K3JL 4ZAKB 1R6VA 4JJHA 4WJ5A 2G75A 1T4KB 4U33A 5ERWA 4IIQC 3IXTA 2CDEA 3DUSB 2WBKA 5CINH 1MCEA 2CLRA 1KPVA 4P2OC 5DGQA 1I7ZA 2A6IA 3CFCL 1HH6A 1H15A 3LKNB 1FL3B 2IGFL 4NQDA 1DL7H 4NBZB 2ZG1A 5D6DC 2DQIH 4HFWA 1FO0A 3RJDA 3O0RH 5HHVH 2MCG1 4S1DC 3RPIB 3C2SA 4QYOB 1QEWB 3PDDA 5JQHC 2DI8A 3OPZL 4GKOA 4L29A 4ELKA 2FBOJ 2R9HC 1UGNA 4K94H 5FYJE 3KLHC 3HZVB 3FT4A 4X4XB 4MLIA 1U95A 4M1CD 1CR9H 3HFMH 3QDGA 3O2WH 3R8BB 3LQZB 3WFBH 1U8QB 4LU5H 2D7PA 3WIHH 1KACB 4EOWL 3FQXB 5FF6A 1KJVB 3QEGL 5CAYB 3O8XC 3ARBD 3TPKA 2VXQH 2BVQA 2HTLC 2OZ4H 4NM8L 3PF2A 4WV1A 4LHUD 1NCDH 3A6OA 4QHKJ 1MJJA 2VABB 12E8L 4OJFH 3WJLA 1IGIL 4I0PC 3UTSE 5JW3L 4PP1C 3WFEL 4UIKL 3UJTH 2DTML 5CMAA 1B0RB 4Y4KC 1MWAB 1A4KA 3TT3L 3FO2B 1YMMB 2IPUG 5HDLA 5K9OA 4M3KB 3CK0H 2KKQA 1MCPL 4OCYH 3S36L 1CFVL 1RK1A 2O5ZL 4LSSL 1F3JB 4LPTA 5F88A 1NGZB 3HC4H 3B2VH 2R69L 1LEIA 4PRHB 2EE2A 3MBXL 5L8KB 4PJEF 4YDJB 3KYMB 1V3KA 3QCVH 3VWJD 2V17H 4KKLD 1PG7L 3MOBL 4RFOH 3HHRB 1X5LA 2GSIB 1XF2B 4J6RL 2JKXA 1G7QA 3N9GL 2GCYA 5DQJA 3VXNA 4HX1A 1YQ2A 4BKLA 2C3VB 1XF3B 1JF1A 2R4SL 1V7MH 4KROC 5DK0A 1I9JL 3HE7C 5ID0A 1RIHH 2PCPB 4NZRL 3V8CA 3MUGB 1WFNA 2XZQH 3P0VH 3KYOB 2M2DA 4H5SA 3ARDC 4Y4FA 3AAZB 4M8QB 2ZCKL 4P2RB 5JDSB 4LCCA 3ARWA 4C55A 4MJ2A 4HZLA 3MUJA 4K3DH 1UACL 3SJVD 2FL5B 1S9YA 3BXNA 1FJ1B 4JFPB 1JGEB 4CDHA 3GI8H 4FQXA 5C0CB 2EYTB 1LWRA 2AK1H 5DWUL 3DRTB 4GAJH 3VXUB 3HI5H 1DE4B 5FHAL 1T0PB 1RJZA 1CFNB 2XWTA 1UB6B 1BVLB 4CUCA 3BHBB 5L9DH 4NRYA 2W07A 4JCLA 2C4XA 3MLPA 3DPBA 1ZT7B 1INDH 4HUVA 3M8OL 1LNUA 3B3IA 4QRUA 1NH6A 1IKFL 3CJJA 4KXZI 1QZ1A 4KK5D 1WZKA 4JRYB 8CGTA 2VLKA 3VRIB 5HI5D 1BMGA 1A9BA 3VGGA 5FO8A 2WAHA 3RUGB 3UBXB 3DHJA 1GAFH 5A2KH 4S1SL 4IOIB 1S7UA 4IRZH 1TXKA 4HPOH 1F4HA 2HH0H 3DETD 2DQGL 1J0JA 5D7JA 5I1CH 1KFAL 2P4AB 4HF5H 1IQWH 4Q6YA 3DJ9A 2ARJQ 1JWUA 4LASL 2WANA 3LPFA 4HS8H 5D6CB 5IF0A 4ZOBA 4OF6A 1KCGC 3KPMB 1ZS8A 3A67H 3C08H 1A22B 5FDWA 3O4LE 2BRRL 3PXHA 3HZMB 4XXDB 3STZA 3BAEH 1RPQA 4PG9A 2IALA 5E8EB 2AJ3A 1UWXK 2GW5A 3NIFF 3OKEB 2B5IB 3DROB 1FRGH 3W39A 3NAAL 2F5BL 5AYUH 5MEQB 2GSGB 4V1DE 3VD3A 4XXCC 1WC7B 4FFYH 3RWJB 3C5SB 2WUBH 2R4RH 2LTQC 3TO4C 1RUQL 3FTGB 1SBSL 3UBXI 1UCTA 3FB8B 5HTSA 4LSTL 5F9WC 3VXRD 4K55A 1A3LL 5EBMA 2QADD 5IVZB 2YS4A 2DN7A 1OGAB 1RJYA 3OB0H 1YEJH 2NXYC 2AABL 4PJEE 1BZ9B 1QOKA 4BM7A 1NC4D 3NABL 3SCMC 1W2KT 1DCLA 1ZK9A 3MX0A 3P40A 3BYYA 2AJSH 3V4PH 1AXSA 4YX2L 4LHUG 4J7RA 4JFZH 3KWWA 1DDHA 2VDOL 5MP6H 1MQKH 4M7JL 1NCWH 5DHVH 3NCYS 3VGBA 1T89C 5CLWA 1ZA6B 3QNXB 5FK9A 1RZFL 4HHAA 3W5MA 4X4YA 4PB9L 3C60B 2XRAL 4I0CC 5HGAB 1HHKA 4CMHB 1P7KA 3T04D 2O5YH 3CH1B 4U3XA 1U8NA 2F5AH 3NTCL 4NKOB 2E6JA 1AGBB 4OGAD 3EDDA 4MD4A 2V5RA 5A3IC 3QUXB 2XTJC 4Y5XB 1A1OA 3VGAB 1GGUA 5C0FB 2GQHA 4MAYA 3QI9D 3GMPA 3SOBL 1JTOA 2Y07H 1HXMA 4JJ5A 4KKCC 5BOZG 4D9LH 4TUOA 1PZ5A 2MCPL 5ABDE 4YBLB 2X1XR 2X4QA 1FLRL 5EU7E 5CIPA 3FQTB 2G5BA 5GJTH 4HCRL 4MCYB 2NW3B 2X40A 1KB9J 1WITA 3ARRA 5A2LH 1UWGL 1U58A 3LKQB 5DRZB 4YGVB 1X5IA 4OZGF 5T3XE 4K94C 3BDYH 1IGCL 1GIGH 1FORL 5KW9L 4JPVL 1D6EA 5LGHH 1I8MA 2QQLL 2APFA 4HIJA 3GK8H 2NNAA 3S37L 3EKCA 4F7PA 1NGPL 3MUY1 1R5IB 4HH9B 4JANB 4YHOL 3VXTA 3BE1L 1NDMB 3RWGA 1EBAA 5DJXB 3AS1A 1K3IA 4MB5A 3QJHB 5FAAA 3ARYA 1LD9A 5HYJB 1NAMA 5CS7A 2OTUA 4N8VA 4XMPH 3UZEA 5E56A 3VH8G 4L3CA 4ZD3H 3SQOH 4LKCB 4YEEA 4OV5A 1Q9OA 5IHLB 1S3KH 3T0AA 1JNHB 3G5VA 4H0IA 4TUKL 5F93C 3VMNA 1FYTE 2V2TB 4KI5F 4BUGA 1OSPH 3NIFE 3RFZC 4JRXD 4PJ8B 5E6IA 4PLJC 4HMEA 5E9DE 3QZWG 5CJ5A 1T0MB 4JO2H 5IHZB 3WDIA 4JVPA 3QQ3B 4HWZB 1ITCA 4RGOL 2HP4A 4PJHA 3QBTB 3AY4C 4EUPH 4LSRL 4EI6A 1I7UB 2D03H 4HV8A 4JLRB 3N1FC 1JWMB 4JG1H 4MD0A 1EVUA 5DRWA 1KCLA 2OLDA 4QXTA 2ZSVA 5KVFL 5DJCB 3RGVC 5BRZA 1TJHL 4XNMB 1PW3A 3LV3B 2X4OA 3BPCB 3RVUD 4PJ5E 1SJXA 4ZFGH 1HHJB 4PRIA 3UCRA 2VZOA 1A8JH 2ATPB 3PP3K 2CK2A 4WUKL 1FIGL 1GOGA 2ZP0T 2VE6A 4XGZA 4G6AC 4OZHF 1PKQA 2NTFA 3DUHA 4PRPE 3U46B 3ESVF 1FLTX 1TNMA 3KHQA 1J88A 1WT5A 2FDBP 3BKMH 1T03L 1BOGB 3ZZ1A 1U42A 2V2WA 3LVEA 4Y16B 3RHWF 4TN9A 3IFPB 4XX1E 1SJEA 1WEJL 3EDEA 3QCUH 3MA9L 3O3AA 4MDIA 1CI5A 4PY7B 3R0MA 3VXSA 4NKQB 4JO3L 5T5NF 2NY6D 3DMMB 5J1AA 4OD2A 2D4DA 5HHNA 4WEBH 3BGMA 3KAAA 3PP4L 2DLTA 4WTXA 4YUEH 1F11A 4GW1A 3RY6C 4XWGL 2A38A 2XZAH 1L7TL 1QFUL 1VPOH 4LVHB 5DFWH 4M6ML 2HJLA 1T21A 2BNUB 1KSRA 4U6YB 5IVXF 5JXAL 4JPWL 2AK4A 4OZGE 4HSQA 5FA4A 2KQMA 4K3EL 3U7YH 4KZEL 4J3TA 1RUAH 4WEUD 3X13A 2F53B 2ZSWA 4P49A 2FJFA 4YQXH 3I02B 4LPWA 3LIZH 1EO5A 4P23C 2ARJB 1MJ7H 5HYSB 4QT5B 4LVNC 5KTEH 5I1JH 5BW7C 1TJIL 5LKNA 1NLDL 1P2CB 2QQKH 4R8WH 3VA6A 3KLDA 1ZSDB 3LEYL 3IFOA 3AXLA 1B2WH 4JFED 2WP3T 5EO9A 4HEPG 5SX5K 3Q48A 1C1EH 3MSPA 4Y4HD 3WIFA 3HMXH 5FHBL 2XWJB 1HHIB 5IB5A 5DUBA 4IJ3C 3SDXE 4Z7WA 1XMWA 1KIPA 5AZ2L 3WNKA 2CGRL 1RIVH 4PJCB 2AQ3A 1U3JA 2B4CL 5F7YC 5E1AB 5IMLB 2JB5L 5IM7B 1JMXA 4OKVB 2Y36H 3KPQA 3U1SL 4DZBA 1A0QL 3TZVC 1AO7E 1TPXB 4CMHC 5E94A 5E5MB 1S8DB 3I6GA 1D5MB 4OQTA 1YECH 5B39B 3TBWA 5C0NC 2VSCA 5I71B 2Q1EA 3KPPB 2X89A 3O6ML 3HS0B 5F6IC 3FB7B 4H0HB 5BZDB 1LEKB 4U1HA 2Y6SD 5SWZB 3P4MA 3MXWL 4FMKA 3VGAC 5HPMB 1DVFA 4ZPTA 5KVDH 1CLOH 1BAFH 1FNLA 4ENED 1CE6A 3HRZA 2GTZA 2HFFB 4HWEL 4IRJC 1LO0H 3SO5A 2XG5A 2PYFA 1JFMA 3O41A 5I30H 1A6WL 1D9KC 4KTYA 4YDVB 1F4YH 1DN2A 4YDIH 2LVEA 2R0WL 5D1QA 2IQ9H 3N1GC 1UXSB 4CADA 2UWEA 4W4OA 2OSLB 2W9EH 4QRSB 5D1XD 1IAIL 2J4WH 3LZFL 4QHUA 3DX9B 2ZPKH 3DI3B 3OAYK 2H32A 1RV6X 3Q6GH 5T1KA 1T7ZA 5IVNA 4MMZC 1WZLA 3W0WE 3HLAB 5I8OL 4X6DF 4X9IA 4ZFFB 4BJLA 3VXQB 1KTDB 1NGXB 2BHZA 1NFKA 1H3PH 3P4NB 4OCLC 4N68A 4JREB 3NPZB 1KJ2H 4PJIA 5GZNC 5TFSL 3O3BA 3OKNB 3D85B 5CJOH 1N7MH 2CIIA 3JUZA 5EORH 1XGYL 5EIIA 3AGVA 2I27N 4HPYH 4ZO6A 3MLWH 4XBPB 1K2DB 4K7FA 1A7PH 3OJDB 1E28B 3QIUB 4FG6C 3S35H 4UIMB 3BP7A 5IK3A 4NO5A 5DJ0B 5DVNA 1M7XA 4I2XA 2JJTC 4PJXE 3MRNB 1LDPL 1VADA 4LEOA 1F6FB 1B4JH 3QISA 1FFRA 5IVXE 5CEZL 1BF2A 4P3CH 5F89A 3AREB 4WHDA 2M8XA 4I4WA 7CGTA 4EVNA 5I6XC 2H2SD 1KELH 2ED9A 4ZTOH 3MJ6A 3GBNL 3K4AA 4YHPB 5MEOA 3OG4B 2AJVL 4KDTC 4TSCH 4BZ1H 5CLTA 4OZFB 1IM9D 1NKRA 2NYYC 3MV11 4XC1H 3MV8A 4UT7H 5ISZD 5DD0H 4MVBA 4RRPA 2BHYA 4NN6B 2EKSB 3MO1B 1QO3A 3GIZH 4JHZA 43C9A 4AIXA 2E7LC 2EH8L 3U6RA 2DMBA 1UM6H 4DN4H 2BY1A 5JIPA 4RMRA 3WFZA 3V6FA 4OD3L 4FXGB 3KYAA 1HKFA 4Q9RH 3RY5A 3TVMC 5KJRL 3B6SA 3LN4A 4ZUVA 2YD3A 1GH7A 2A74B 3MUHL 2PYED 2JLLA 4JY4A 2YWZA 2NY4D 4WWKD 3VXOB 4Y2DA 1XCTB 4FNLH 1I1FB 4LSQL 2I9LB 1JHKH 3MNWA 1P9MA 4OLEA 3PWJB 2ZUTA 3SGJA 3R1GL 1FO0L 4YHIA 1DLFL 1W0WA 3E0GA 3WEXA 5HHOB 3O6FA 4HWBH 3RZCC 4JM2C 1CD0A 4EI5D 4JFOB 1INQB 4L8CB 5CGYD 4RNRA 4Z7OE 5INCB 4HK0B 2UY6A 5B21A 5C6PB 4GJTB 1A64A 3ZTJG 3H9SB 1UB5B 1WZ1H 2V7HB 4MNQE 4MA3B 1BZ7B 5FYKD 4HKXA 4JZJA 5EZOL 5IBLC 2ERJC 3TN0A 4U6XA 4EQ2A 3BPOB 2XN9D 5JORB 3LS4L 2VZ1A 3KXFD 4RWHA 3BQUD 1YJDH 3SDDA 2FJHA 3HZYB 1GPOL 2JCCA 5D5MA 5EB9A 5C2BL 3JV6B 4FXKB 2ZOKB 1BJMA 2R1XB 5HHME 2NXZB 1LE9A 4OAWA 1SM3L 4LRIC 3WDHA 4POYA 2AXGB 3QWOA 2RQ8A 4PP8C 4LCWB 2AV7A 1AKJB 1I1CA 4XVUC 4NQXB 1NBZA 2KH2B 5EO0A 1CZ8H 5KAQF 5AG9A 3TV3H 3ARGD 4LEXH 1MCQA 4NRXA 1FAKT 3CVHH 4TSBH 4PJBB 1DANT 3K4ZA 4KC3B 3T2PA 3WD5H 4APQA 5I17A 4PJFA 5DJ6A 1AQDB 3RL2B 5L2JA 3BKCH 2VL5B 4K71B 3UTTE 3DX7A 4X7SH 3VI3E 2PO6B 1RVFL 4YIQA 5BV7C 4QOKA 5E2VL 4GBXD 5JPNA 1I3RA 3RUGF 4O02L 2FLBT 4IDLA 2YC1B 2AXFA 4XP9L 5HVFB 1IGTB 3REWB 2VISA 1F2QA 4MWFA 1YYMH 2Z35A 3MFGB 2ILLA 5SWSA 5A2FA 4MQSB 5KBNC 4FHBD 4R0LC 5EIVA 5D2NA 1KENL 2IH3B 4Q0XH 1TPXC 1NBQA 1SVZA 3GSVB 4NUGL 3QHFH 2GI7A 1GC1L 4WJ5B 2G75B 3SBWA 5ERWB 1VSCA 2BJMH 5LBSH 3IXTB 3REVA 5GS0L 4YH6A 2CDEB 2IC2A 4Z9KB 3O2DA 1HIML 2VJXA 1QBLL 2CLRB 1KPVB 1QRND 3MLZH 4P2OD 4O5LH 4ZS6C 2QSQA 5FYKU 2FATL 3JWDH 3ZT6A 1I7ZB 2A6IB 2VL4A 1HH6B 2ZUQC 1H15B 3GSNA 4NQDB 4QHKI 1INEH 4PRDA 5F1NA 4HFWB 1ZLVH 1FO0B 1AQKH 4S1DD 2IFFH 1NQBA 3LD8C 4L29B 4ELKB 1WWAX 2R9HD 4XTRC 3RBSA 3KLHD 5E95B 4MZ3A 3FT4B 1U95B 4NIKB 2P46B 1CFTA 5IMKA 1UADC 4PGJA 2OCFD 5FF6B 3MLUL 3KG5A 3O8XD 4H1LA 2Z92A 5FGCB 4B41A 4HUXA 2BVQB 3FFCD 3HG1A 3WS3A 4MAUH 1UEMA 4NFBA 4WV1B 1D7FA 5K9QG 2WNGA 5ESAA 4C56D 1MJJB 4IOSD 2RAMA 4F9LC 4I0PD 4PP1D 5IHUH 4G8FA 1UM4H 3OX8A 2LU4A 5CJ8A 4HJJL 1S7QA 1WBXA 5CMAB 1TTFA 3PHOA 1A4KB 1VKXA 1AGCA 5HPOA 1T04A 1UWXH 5K9OB 2C3HA 1RK1B 4LHQB 1G6RA 4KHXH 2P5WD 2DLIA 3WNOA 5F88B 5TDPA 1JPTL 5EO1A 3QUYA 2PKDA 2YBRA 4HQQL 4EN3D 4AEIH 4FTVD 1LEIB 4ONGH 2HKHH 3V4VH 5C0CE 5L8LB 4KRPB 5F72S 3VXUE 5DQJB 1G7QB 4K9EH 2GCYB 4HX1B 3RAJH 2VDRL 3H8NA 4QHNA 4BKLB 1JF1B 4ONFH 4KROD 2QV2A 3HE7D 5DK0B 5ID0B 1CGUA 1R5VA 5GGSY 2QSTA 1H9VA 1LDSA 3N85L 4RDQF 1Q72H 1OAUH 2VNCA 2VN4A 1UT9A 2YSSA 3X3GL 2FD6H 1XGTA 1IBGL 1OAKL 3BIAX 4XPFL 3OJMB 1OTSD 3ARBA 3S7GA 2X10A 3ARDD 4H5SB 4Y4FB 3RTQA 3DX6A 2SEBA 1U8MA 4DEPB 1NPUA 4JRYE 4LCCB 4UILL 4HZLB 4LAJH 2WIIA 3CX5J 3RUGE 4Y5YA 5D8JH 5A43C 4X83A 1S9YB 3BXNB 4XVSL 1Q9LA 1B0GA 4L4VD 2OR9H 1MHPH 4FQXB 1N0XL 3D87B 2NR6C 4IOFC 2DI7A 2N7AA 1K6QH 3TBTA 2R2CA 1M6OA 3ZKMD 2GYSA 1MRCH 3KR3L 1WUNT 2XWTB 5GRVL 2EC9T 3MFFA 1Q94A 4LOUC 3TIEB 4NRYB 5JPMA 2VXSL 2O5XL 1MPAH 1I1YA 3T0BA 5BS0D 5DA0B 3LSOB 4DW2L 5EC2A 5I1LA 4HUVB 5DT1H 1LNUB 4Q97A 3B3IB 4TPRH 1FBIL 4QRUB 4NZDA 3SKJL 1G7MA 1PLGL 2JB6A 3GHBL 3AB0B 3PWPA 5I15L 2VLKB 2VDKH 4O58H 4MD5A 5E4EB 1A9BB 2XICA 3GJFH 5FO8B 3EYSL 1JTTA 5EFIA 1A47A 1S7UB 3JWOH 5I0ZA 4FFZH 4PS4L 3U2SA 4G7VH 5IKCA 2VXVH 5CSBA 5EU6E 4X4MA 4LAQH 3L3OA 1EX0A 5D7JB 3FB6A 4H26A 1JPFA 2O61A 3V7AG 3PGCA 1EUUA 1OGAE 1A1MA 3UYRL 1JWUB 3V9FA 2AQ1A 1IC4L 1P6FA 4XVTL 5IF0B 3NZHL 2A6KA 1XIWC 4WCYL 5FDWB 4ODVL 5GGTL 2JJUA 5AUMA 3EBAA 1MFAH 3STZB 2VUOA 4PG9B 2IALB 2AJ3B 1MY7A 4D9QE 1J8KA 4KPHH 1KC5H 1S7RA 4H0GA 4HBCH 3W39B 1EERB 2A9MH 2J7LA 3PV7A 5C08A 4OCSL 4WTZA 4XBGA 2YKLL 1RU9H 2XFXA 4X7FC 5E70A 3ALXA 1XR9A 4Y0GA 3VW3L 5DQ9B 4K23H 2UVFA 4JO4H 2VZVA 1L8JA 1G7PA 5DR5H 2FZ3A 1FFOA 2EDWA 5EBMB 1T7XA 4KUZH 2E8YA 4HDIA 5TE6L 1KCVL 1RJYB 5AG8A 3DARA 1KXVC 2NXYD 3M17A 1WLHA 3SCMD 3T0EE 1B3JA 1F8TH 1IKNA 1I3GH 4JCMA 4HC1H 1AXSB 4IM8A 4YXHL 3HAEA 4XAWH 2IAND 1HSBA 4O9HH 1DDHB 3KWWB 4OM0L 2LU3A 1I9RL 2VC2L 4LSUL 1X5KA 4NZTH 4Z76A 2IPKA 4KUCD 4M93B 2DQJL 1DBML 2H9GA 5FK9B 4ZFZA 5CGMA 4FQJL 3TA3C 4HHAB 4X4YB 2J8OA 3J7HA 3VMOA 5EH1A 1HHKB 3W9EA 1P7KB 2WK2A 4B53A 4E5XA 5IESH 3ARFC 3SN6N 2CRZA 4DN3H 1U8NB 2VR4A 3BIBX 3M07A 3TJHC 1P5UA 3M45A 4MD4B 3WLBA 3ISWA 4J3VA 1A1OB 2EDBA 3L3HA 3QH3A 4QKXB 5J8OA 3TFKD 3O6KH 4LSDA 2D7MA 4MAYB 3GMPB 2EIDA 1S7TA 3PDGA 1M05A 2ZJSL 3MACL 5HYJE 1HXMB 3JWDC 4KKCD 4JJ5B 1PX3A 1PZ5B 4TUOB 2XTLA 1NBVL 1MWAH 4ONOA 2X4QB 5CIPB 4HUNB 2G5BB 1X6LA 2OI9A 1QSZA 1LILA 1IJ9A 2F19L 3RVWD 1XZ0B 4GS7B 1U58B 4I77L 5IUSA 4PJCF 4JQIH 2D9QB 2W1NA 3WNLA 4ZUUA 3RKDC 1YEDA 4TVPL 1D6EB 3S36X 5D7LD 4AZ8A 2EO9A 2R2BA 1I8MB 4HIJB 3K2UH 2YN3A 3KYKL 2BVEA 2XA3A 1VACA 2NNAB 2JTDA 3BWUC 4F7PB 2VKXA 3VXTB 1WAAE 3RWGB 1MI5E 4PJ9C 4NHCL 3F62A 3VD7A 5AAMA 3OAZK 5C07D 1PG7X 1LD9B 4UINH 4Z8FH 1OVZA 1NAMB 2HT3C 3BKYH 1TQCB 2OTUB 4N8VB 1DBJH 1JPSL 1SY6H 4L3CB 4KXZH 2EXWC 5I1EH 1KNOA 1U8HA 1Q9OB 4OV5B 4WRLA 3V7MA 4XAKE 3G5VB 4UT6L 4DVRL 4K3JH 4YC2B 3OAUH 3WKML 5GS1A 2EZ0C 5SX5H 2B39A 1JV5A 2BSRA 2IQAA 3P4OA 5E6IB 2DM4A 4PLJD 1CF8L 4XPAL 4JFQA 4D94A 2UZXB 3B8YA 3NCCB 4U49A 1PY9A 1GZPA 4NJ9L 5ALBH 4K9EC 3ZDYF 3WJJA 4PJHB 1JZ5A 5BJTA 3Q1SL 5JW4M 4EI6B 5DMYA 4HV8B 4Z7NE 3OPZH 4MD0B 5DRWB 3QPXL 3VFVA 5BQ7A 3BKJH 2OJEA 4BSJA 4YK4C 3CFEA 4QXTB 2ZSVB 2XKNA 4R26L 1B88A 3RGVD 5BRZB 2C3WA 3QAZB 2DQEL 3EYUL 2X4OB 2AXHA 1SHMA 1N64L 4IMLA 4OQTL 1AY1L 4EOWH 4N0UA 3BVNA 3QEGH 4PRIB 3G6JE 2EH7H 3NPSB 2RR3A 2E8ZA 1Q0YH 2ZCHL 5F7DA 1ED3A 2YPVL 1JFQH 1NEZA 2W0FA 4GUPA 3FT2A 12E8H 4KZDL 2JIXD 4XZUA 1UWEH 2VE6B 3T0VA 5C0JA 4XGZB 2DTMH 4HT1L 1K9TA 1PKQB 3TBYA 1AGFA 3OAYH 2NTFB 2F53E 1MCPH 3S36H 4JRXA 2O5ZH 3WO4B 4LSSH 2V2WB 3CD4A 2IF7A 3Q5OA 1G9MC 1SJEB 4MDIB 3O3AB 2YHGA 3UC0L 2V5YA 5I19L 3VXSB 3MV01 4OQ1A 5J1AB 4OD2B 5EC1A 3MBXH 5HHNB 2I9TA 3BGMB 1PG7H 4ZOEA 3MOBH 1OPGL 1F11B 4GW1B 1JHTA 4H20L 3F5WA 2OBGA 4J6RH 3MCKA 1X4YA 5F44A 3JWOC 3TJEL 2HJLB 1T21B 2FX9L 1RFDL 4PJCE 2AK4B 5FA4B 3C9NA 4U0QB 4R4BA 1KOAA 3SPVA 4OD1L 5DXWA 3DSNA 4AL8L 3X13B 2ZSWB 3HUJE 2FJFB 1NL0H 2ZCKH 2NY5L 2ICCA 4P23D 4LSVL 4FFVD 2GK0B 4P9HL 1QSVA 1OP3K 5IROA 3QSKB 3UO1L 5D2LE 3IFOB 3AXLB 5CZXD 5EO9B 1UG9A 1JRHI 5DWUH 3WIFB 5IG7A 3AM8C 2YEZA 2J5LC 5A16A 4JHWH 1LP9A 5FHAH 5IB5B 5I76A 5DUBB 2AERT 4R7DA 2AJZA 4Z7WB 5DJAA 1DUZA 1KIPB 2BNQD 2YD7A 3HE6C 2NZ9C 4ESKA 1QKZH 5T3ZL 1RUML 2P7TA 4JHBA 1L0XA 3P4LA 4PJAE 3KPQB 4DZBB 3WNPA 3TZVD 4HKZA 3B4NA 4JFDD 1RULH 1N6QL 5E94B 1JI1A 1QD0A 3I6GB 1FAIL 5KSUA 1IKFH 4HGKC 3TBWB 3ZYOA 4ZPVA 5DD1L 2UZYB 4YFEA 3ZDYE 1IMHC 3CDFA 4U1HB 3P4MB 4S1SH 3RIFK 4PJBF 1DVFB 4ZPTB 3FHQA 3FAWA 1CE6B 3HRZB 2GTZB 2DQGH 4IRJD 5KZCB 2PYFB 1CLCA 5FYLH 3O41B 5GGVY 1D9KD 4AQOA 1E4JA 1MJ8L 4LASH 5EOCJ 4PGZA 3U0PA 3OQ3B 1F6LL 3K3QA 5D1QB 1OTUC 3OG6B 2GFBA 4CADB 2YXMA 1OAYH 2UWEB 2BRRH 3D3VE 1P7HL 4JFEA 4QHUB 1A3RL 3EJYC 5E5UB 2H32B 2JE8A 4WO4C 2IBGA 4Q6IC 1KJMA 5T1KB 5IBUB 3S37X 3NAAH 2F5BH 2B2XL 3TT1L 4K7PL 4Y1AD 3VFUA 4JQVC 4M5ZH 5D9SA 2J6EA 3WKNA 4MNGA 1RUQH 4KMQA 1FZOA 1A2YA 2EYRA 5E6ZA 2WW8A 4LSTH 5GZND 4PJIB 4J2XA 1A3LH 1MSPA 3O3BB 4RA0C 2CIIB 5I74B 4PV9B 5EIIB 3MLVH 2AABH 1CIUA 1FGNH 4K7FB 3NABH 3SO3B 4NHUA 1MEXH 3BP7B 5IK3B 4NO5B 4N0YH 1YPZE 4WFGE 4I2XB 1TETL 4YX2H 2JJSC 5FM4A 1VADB 4LEOB 2XNAA 1KB5A 1CIDA 2HTKD 5C9JA 5GRUL 4TRPL 3LDBB 4M6OL 1LK2A 5F89B 5ACZA 4I4WB 5ID1A 4PG2A 1JI2A 4EVNB 1CS6A 4HBQA 3UTSD 1VFBA 1RZFH 4PB9H 4EKXA 2CK0L 4V2CB 5MEOB 4LLWA 2EDKA 1I85C 5HHOE 3WHE1 2NYYD 3MV8B 2NY0C 3GMOA 2VZUA 4MHHI 4JFFE 1QO3B 43C9B 1QYGL 1PEZA 4JRWA 3HAEG 5AEAA 1E6OL 5C0IA 3X11A 3U6RB 5GRVK 5HGDA 4Q7DA 2ZUUA 1J7VR 1R3HA 3V6FB 3ZYZA 4M8VA 1R3JA 2Y23A 4RGNB 5EN2B 3TVMD 2MCPH 3B6SB 1RZJH 4JY6A 3LN4B 4ZUVB 1ZHNB 4ORGA 1FLRH 4YNYA 4GRMA 4JY4B 3WXVL 1I7RA 1NMAH 4LKXA 4PBXA 3DX8A 3O2DL 4Y2DB 4H8WL 1RJLA 4M02A 5EOQH 3MNWB 4U7SA 3CZFA 4YO0A 3GSNL 2X7LA 5GJSH 1PZUB 1Q8MA 5CJXA 2H6PA 1FORH 4JPVH 3THMH 2X4SA 4YHIB 4PJGA 1W0WB 1R3KA 3QFDA 3WEXB 4LCWE 3O6FB 4X98B 5DFVC 1MFNA 3DWTA 4K8RL 4JM2D 3RZCD 3WS6A 1NGPH 4YHOH 4N8CL 3WUWA 4RNRB 3BE1H 2FB4L 3GMMA 4PJBE 4PIRF 5L6YL 5FYJU 5CEZE 5IB4A 3K81A 4UNVA 1CFSA 4F7TA 4HKXB 4JZJB 2YR3A 3W2DL 1IM9A 5ALCL 5TH2A 3TN0B 4U6XB 5K9JH 5JW4Q 3L3GA 5JMOC 3PL6B 4FQCH 3SGKA 2MMXA 4BH8A 2FJHB 1MQ8A 2W60A 5L88L 2OP4L 2JCCB 4JPIA 5D5MB 2DL2A 3GIVB 5JQ6L 4TUKH 1LE9B 3AC0A 4OAWB 1A6PA 4V3EB 1M71A 3MV7A 4Z7QF 2C4FT 3MRGA 4IDJL 4G6JL 4OSUL 3QWOB 5LVEA 3RQ3A 2AV7B 1QUNA 4AG4L 4XVUD 5HYFA 2YMXH 5HYQA 1NBZB 1TQBB 2PYEA 5EO0B 5ESQA 2WWKT 4JDZA 1JCKA 5I8CA 4RGOH 5DD6A 1EHLL 4M1GL 1OP9A 2M26A 4LSRH 3RIFF 1IEBA 2AJUH 4APQB 5I17B 1DFBL 4GSDL 2FBJH 5DJ6B 4WW2A 5FM5O 5L2JB 4NQCB 4PGBA 1CXHA 1CU4H 1H3TA 3DX7B 4PRBA 4YIQB 1C08A 4JDTL 4QOKB 2V5SA 5JPNB 2CLZA 4EI5A 1I3RB 1JWSA 3M1BB 5KVFH 4M03A 4HGMA 1RAMA 2P45B 2R0KH 1B0WA 1TJHH 4WI6A 2FH6A 2AXFB 1UXWA 2VISB 4MWFB 1G9NL 2Z35B 3H42L 2A6JA 4MJ6A 1BJ1J 1JVKA 5SWSB 3O4LD 5E00A 3OSKA 5D2NB 5J11B 3IF1B 3X12A 2ID5A 1N59A 1VEPA 3QDGE 3MYJA 2XN9A 1Q9KA 4WUKH 4UTAL 1A3QA 4Z5RA 35C8H 3QB7C 2IWGA 3BQUA 4LRNL 4UDTA 2VZ3A 1KCUL 4V1DD 3S3JA 3S4SA 5DGRA 4QRRB 5FGCE 2V9TA 2QTEA 3REVB 3RVTC 2YA2A 2VLJE 1KULA 2VDML 2WBWB 1TZIA 3B9AA 3E3QC 1T03H 4YLQT 3GSNB 3SDCC 1IL1A 1LO4L 5J1TC 2VO5A 3F7RA 4I18C 4PRDB 1EJOH 4J3XA 5B3JE 5F1NB 2P24A 3ARGA 4MQXC 1WSST 2DM3A 5C92A 1DBAL 2PR4L 1F4XL 3EZJB 3T0EC 1NEZG 5D96B 1MELA 4HAFA 3PP4H 4X8JA 1O7SA 1LE5A 2MQ0A 4XWGH 4YPGA 1L7TH 5JIHA 1HDMA 4UQ3A 1T0NB 3QA3A 3SKNA 1JTPA 4GBXA 1CFTB 1U0QA 5IMKB 5I73C 1YN7A 4JM4L 5JXAH 5IQ7L 1PYWA 5K59F 2OL3A 4H1LB 4K3EH 4HUXB 2EE6A 3HG1B 5FCUL 3WS3B 4KZEH 1MF2L 2DJ4A 5ESAB 4QF1A 4OI7A 4G8FB 6FABH 3OX8B 1S7QB 1ZVSA 2DQUL 4JB9L 1WBXB 4JEGB 4TNWK 3PHOB 1TJIH 1VKXB 1AGCB 1T04B 4IIQA 5LXGL 2EE3A 1J0IA 2I5YL 1G6RB 1QNZH 2DWDA 3LEVL 4RA3A 1TZHA 5TDPB 5EO1B 4P2OA 5FHBH 3QUYB 2YBRB 2AV1A 3SE8L 2EEBA 2A77L 5D6DA 3T0WA 4LMQE 3V8OA 5DVOA 4JZNA 4Z7QE 3U1SH 4QHNB 4LF3A 3QQ9C 1A0QH 5KVGL 2VB5A 1U93A 1J5OL 2UV3A 1R5VB 3BUTA 3HB3D 2FECI 1D5IL 5TDOA 1HK6A 4JZOA 3MV9E 5TE7L 3GRWH 2NY2D 3O6MH 2YSSB 3BGFB 4JKPL 1IGJA 3CSPA 1XGTB 3B5HA 4KHTH 3DYMA 3O8XA 3ARBB 3MXWH 3PHSA 2DF3A 3FFCA 3MLTA 4Z95L 3DX6B 2SEBB 1U8MB 3RTQB 1P7QD 2DDQL 3FT3A 3LN5A 4HWEH 2VLKE 4Q74A 4ZYKA 4C56A 2WIIB 4I0PA 1IC5L 3QXWA 4Y5YB 2IFGA 3ULVE 1WWBX 5IFJA 1B6DA 3X3FH 3RA7L 4Y4KA 1Q9LB 3OV6A 4OCMC 3BISA 1B0GB 3QUMA 3WNNA 5JZ7D 4FFEX 3B9EA 5ADPH 2NR6D 1CXEA 1I9IL 2BVPA 4IOFD 1Q1JL 4OLWL 5MEND 1IAIH 4P46C 3LZFH 3IJHA 3TBTB 1M6OB 4MCZA 5HGBA 4NCDA 3MFFB 1Q94B 3VFMA 4ZXBC 1CL7L 3O6FC 5JPMB 1ETZA 1IGFH 4FTVA 2BZDA 5E9DD 1I1YB 5I8OH 4XC3L 5E8NB 8FABA 3EFFA 5EC2B 5TQ0H 3VWJB 3K80A 5I1LB 1RZJC 2EKJA 4HJ0D 5FM8A 4NFCA 4ODBD 2ED8A 4OLZL 3JSSA 1G7MB 2YXFA 2JB6B 1MFDL 1FPTH 3PWPB 1FH5H 4UZGA 1EAPA 3HE7A 3K4DA 2X4RA 1K4DA 3LQAL 5TFSH 4MD5B 4MXWH 3WIIL 5DZLA 3UAJC 1XGYH 5EFIB 5I18H 5EBGA 4AQ1B 3PL6C 3U2SB 3MRRA 5IKCB 2VXTL 3L3OB 2VLME 4PJHF 3ARPA 2BFVL 4R6UA 3FB6B 4H26B 2B1AL 4HZAA 3RNQA 1JPFB 3ARDA 2O61B 3OXSA 1LDPH 1BIIA 3PGCB 1CVSC 1A1MB 5MHSD 4PTTA 5TPWL 1BQHG 5K59E 1OQOA 2A6KB 3OAZH 1XIWD 5AUMB 1KN2L 4BQ6A 5DO2C 3QFJD 4GXVL 5JOFA 4L4VA 4XNYL 2Z8SA 3GBNH 1ADQA 5H37G 4KQ4L 1UEYA 2VAAA 4Z18A 1S7RB 2DKSA 2E7HA 1KEGH 3RDTC 4GRLC 1YNTA 3IDXL 5C08B 4I3RL 4MLSA 2CKNA 4XBGB 5LCVL 3FO9A 1XFPA 4LQ1A 4Z0XA 2XFXB 4O2CA 3VCLA 1XR9B 3H3PH 5BS0A 2EH8H 3Q6FA 3TO2A 5IGXL 1NCCL 4DJMA 1G7PB 2AEPL 3MNZA 2FZ3B 1FFOB 3TBVA 4OD3H 3MCLH 3CDGA 4OLXL 1IAKB 4OLVH 4HDIB 5KJRH 4R97B 1CN4A 3BT2H 2BOBA 3L3DA 5J06A 5I9QB 3L1OL 4LSQH 1OY3B 4O2FA 3HAEB 1HSBB 4E9LA 4Z76B 1V3LA 2IPKB 1NDGA 4HLZG 4YXKL 1FO0H 2Z31C 4UV7L 3LRHA 2H9GB 4ZFZB 4TTDC 5IFHH 3FO0L 3KLSA 1F5WA 4NP4L 5TQ2L 4MJ4A 2BXYA 3FRPG 5CKGA 1T1YA 3ET9F 4TNWF 2YD1A 5LAXA 3W9EB 4YFLI 1WQVT 4J1UA 3ARFD 4E5XB 2CPCA 4OCRL 2JELH 4NZUL 5EZOH 4IRSD 5F7NC 1MCOL 1RUKH 2ZOLA 4KV5F 1WVZA 3WLBB 3MRKA 4CBPA 4Y5VC 3I3BA 5C0GA 43CAA 4XXCA 1TVBA 3QH3B 4HUKB 2VH5L 1KJ3H 4RGMB 4LLYA 5DMIL 1S7TB 1M05B 1F3DH 3TO4A 1TJGL 1EGJH 1GPOH 3BPNC 4ZODA 5DZOA 3BP4A 5DK3A 3ZO0A 1SM3H 2QADB 2P5EA 3BIKA 2YA1A 2OI9B 1BF8A 4I5BA 3NVQA 3ABZA 3ILPA 3TCXA 4Z7WF 3SCMA 1CYGA 3CMOL 1IE5A 1J10A 4ZUUB 3RKDD 4EDWL 1YEDB 2IANA 2R2BB 2W9LA 2CXKA 1HI6A 1EFQA 4L8DA 3KVQA 1H8OA 1DSFL 1T89A 1VACB 3BPLB 1C5CL 1CL7I 5DQDL 2EYSA 1QHOA 1VEOA 1JNLL 4PJ9D 1FC2D 5E2VH 1L6XA 3BW9A 4PJHE 3CU7A 4O02H 5EOCL 4X80L 1BEYL 2HT3D 3G04A 5EA0L 3WFDL 2CR6A 2AAVA 1QEWA 3SGEH 1KENH 3GMLA 1PAMA 2EXWD 2WP3O 3JXAA 2BY0A 4ALAH 5BRZE 2VWEE 1KNOB 1U8HB 1OP3H 4POZD 4QRQA 3WL9A 1GXEA 4P2YA 4DGVH 5GS1B 2EZ0D 1OARH 3A6BH 1GC1H 3TPUA 4PRIE 4MJIE 4RCAA 4G80A 2HLFC 1JV5B 2UWEF 4NRZA 5F7MC 2BSRB 5GS0H 2IQAB 3P4OB 3PHQA 3CLEL 4NUJA 3AS3A 4XP6L 1HIMH 3ZHKA 4JFQB 4TNVF 3GJEA 3K2MC 1GZPB 4OLUL 3NFPA 1NAKL 1TVHA 2HWZL 3RIAK 2AJYH 3WMSA 4LCYA 5BJTB 2PXYD 4G5ZH 3ZSSA 4X6CA 4MDJA 5IW1A 2IEPA 3HZKB 4Z0BL 5D7LA 3TEUA 4FQIL 2ORBL 4JO1L 3VFVB 5BQ7B 3WIHA 2ADJA 3CFEB 4PJIF 2XKNB 4TVPE 5CP3A 3VXSE 1NGWA 2GJ6D 2XI9A 3L7FA 5HVGB 2FIRT 2OZ4A 4JAMA 4IMLB 4N0UB 5C07A 5EWIL 3BVNB 3MLUH 2W0KA 1RK0A 4PJ7A 5F7DB 3CX5K 3VWJC 3ULVH 3H9ZA 3HI1A 4XP4L 3T2QA 4DKFH 3QIWD 1WWCA 1NEZB 2CKBA 2W0FB 4GUPB 4NQTA 4X5WA 5D72H 3FT2B 2AK4E 3GFUA 4U0RC 4XZUB 5C0JB 4J3OC 2QL1A 1S7VA 4OV6F 3TBYB 1AGFB 4XHJD 2YOCA 1R24A 5JOPD 4JFYA 1H5BC 4JRXB 4KV5E 1X5YA 2AJXH 2VDQL 3BDXA 1C7SA 3TF7C 1JPTH 1EFXA 4JPKL 1WBYA 4ODSL 3DI2B 3V6BR 5EC1B 3B9KC 1F97A 4QRTA 4JN2A 2I9TB 3AY4A 3V6OC 4KMTH 1ZGLA 3OHXA 1X3DA 3LKSA 3U9UA 1JHTB 2ZUVA 4MA1C 3F5WB 4EDXA 4J3WA 4ZNEE 2E9BA 3MCKB 2Z8WC 5KS9A 1L6ZA 3MJ9A 1CXLA 1FNEA 4Z7WE 4S0SD 3UYOD 5B8CC 3RGVA 3L5XL 3PGDA 2FX8L 3C9NB 1EZVY 4R4BB 3N85H 5CD5D 1UYWL 4AIOA 3SPVB 5EU5A 4U1NA 3CSYA 3X3GH 2C1PA 1U92A 3DGCR 3BX7C 4ORZC 1IBGH 3RKPA 1J87A 1BM3L 1MFEL 1G7JA 1DEEA 4WFFE 4MNQD 1FGVL 4UILH 4XNZB 2P43B 1NANI 1ZANL 1NKOA 4NO0A 3I50H 4N5EC 2JIXA 3O2VL 5J6GA 4OCWL 1KB5L 4GAGL 4BFGA 4R97C 4HWNA 3QCTH 1EHXA 3DURA 5GPRA 1KYOK 1N0XH 2LABA 1NMCC 5IG7B 1AP2A 1QSED 2YEZB 5HHMD 5A16B 4P5TC 5I76B 1LP9B 3VJ6A 4D0DA 2JJVA 1FE8L 5IBTH 1JGUL 4R7DB 2AJZB 5DJAB 1DUZB 3DO7A 3QDJD 3HE6D 2LAGB 2NZ9D 1Y18A 1MRFL 5DRXA 4ZMAT 1SVCP 2O5XH 2X1PA 2UWEE 2JCCF 5D5MF 3DSFH 3BSZH 2QHRL 3X17A 4HKZB 1LO2L 3NGBB 4I0KA 3V5KA 1Z0NA 3RY6A 1JPGA 3BZEA 2DQCL 5KSUB 3F6LA 4ZPVB 5I15H 1F4WL 3UTTD 3IAGC 3ZTJH 5CIPH 2R29L 4WI7A 3FN3A 3MRJA 4PJIE 4GLRI 3UTQA 5IVOA 1EEYB 4P23A 5BVPH 3U0PB 5BW7A 1KIRA 1OCWL 2DQDH 2H41A 3NZHH 1OTUD 4WFHD 4WCYH 2GFBB 5GGTH 4ODVH 1DQJA 3ARVA 4JFEB 4X4ZA 4BSWA 4AH2A 5HVWA 4Y4HB 3V5DA 5C71A 5M94B 1KJMB 4BFIA 5T5NG 4OCSH 1IAOA 3SE4C 5JOEA 1ZA6A 4RMWA 2BNQA 2YKLH 1T20A 3VFUB 1NCBH 3OL2A 5D9SB 1IZJA 4NGHH 1S7SA 4RX4D 2KBGA 1FZOB 1A2YB 4JFHE 2EYRB 2PETA 1F6AA 3TZVA 4N1EA 5T3ZE 3P0GB 3MV8E 1CDGA 4HK3J 4JFDA 4NJAL 1N4XH 2Z8RA 1OT2A 5TE6H 1KCVH 4LCIH 5KANG 4M1DH 4HXBL 1FL6A 2VLRD 3QUKA 4NHUB 4OF7A 5GSVA 5DHVA 2YZ1A 4YXHH 4RGNE 2CQVA 1UA6H 3QI9C 4PTUA 3ZKQD 2XNAB 2YRLA 1KB5B 2VC2H 1I9RH 4IRJA 1I75A 4KK8C 5C9JB 3O4OB 1D9KA 4M7LL 1GOFA 1LK2B 2DQJH 5ACZB 1A6UL 1DBMH 3ARTA 5ID1B 3AUVA 4FQJH 3K8KA 1UZ8A 1VFBB 2VIRA 1IT9L 3LRSA 5FKAA 3MRDA 2DOCA 5ITBL 1UH2A 4LLWB 3IRZA 1FSKC 4DZ8A 4YBQD 1KCRL 1S7XA 1IEAA 3GMOB 3S96A 3DV4A 1FL5A 1KV3A 4UTBH 5FGBC 3NCYP 5C0IB 3X11B 4HH9A 4Y1AA 5HGDB 2DRUA 4EJ1C 3VFTA 1R3HB 4ZTPL 1R3JB 1S9KC 1NBVH 3VXUD 1HINH 4JY6B 5CSGA 1EEZA 4ORGB 2VUYA 4YNYB 4GRMB 1I7RB 4LKXB 3C09B 2Z8VC 3DX8B 1KTRL 1AXTL 4POUB 1LK3L 4P9ML 1RJLB 2JCCE 3QRGL 2F19H 3CZFB 4YO0B 5FV1L 2MPAH 5C0RL 2X7LB 1H3VA 4LP5A 1E4KC 5AZEL 4CAGA 2JJTA 2H6PB 5D1ZD 5K33A 4TVPH 3GUTA 2L4OA 1E4XL 2X4SB 4PJGB 3R8QA 1R3KB 3QFDB 4WY7L 3AVEA 5DFVD 1B4RA 3IDYC 4X9FA 3KYKH 3QULA 4K7PY 4JRYD 3WUWB 1I1AC 3GMMB 1JPST 3FQRA 1U3HC 3GSRA 4NHCH 4R4NC 5I1HL 2OK0L 1R3IL 3ULVC 5IB4B 2PW1A 1MHCB 3QWQB 1CFSB 1YNKL 4KDTA 4PJFE 3RU8L 4F7TB 3PQYD 1IM9B 5HI3C 5C3TA 2LU7A 3L3GB 1CXFA 2OL3L 4QOKE 4YHYC 5L0QC 1JPSH 5DFTA 4L4TA 1WISA 4XHQA 1BP3B 4BH8B 1LO5A 2E7LA 1BHGA 4JPIB 4DVRH 4NWTL 5SWSE 3PJSA 4X7CC 1C8PA 4YEFA 1C5BL 3BPCA 5E2UL 5D2NE 4GMTL 1M71B 3MRHA 1SQ2N 3EOTH 3MRGB 5TGBA 2FX7L 1HHJA 3TVMA 1CF8H 4XPAH 5HYQB 1NCAL 4BA8A 4BZ2H 4EUPA 2PYEB 5ESQB 1AFVH 2NY4B 2ZG2A 4JDZB 4U1KA 2V2XA 1A6VL 4PGDA 5DD6B 2FEEL 2F54A 3Q1SH 4QXWA 1IEBB 4NQEA 4GQ9H 3EHBC 5EU6D 4WW2B 3VFPA 2ICES 3KS0H 1NCTA 3MR9A 3QPXH 4PGBB 4PRBB 3RZCA 4JM2A 1C08B 2VERN 2CLZB 4EI5B 1OGAD 2ZKHL 1JWSB 1BBJA 2XZCL 3HC0A 2CUIA 1YUHA 5J12C 5FA3A 5F7UA 3EYUH 1UXWB 4CW1A 1U8IA 4OQTH 1AY1H 2A6JB 2FO4B 2NY6C 4MJ6B 2X4NA 1SJVA 2YWYA 5E00B 4LQFH 1ZA3A 4L1DA 1OWRM 3V52H 2F8VA 5DMKA 3MOAL 3X12B 1N59B 2DM2A 5J7CC 4D9QD 2MSPA 3MYJB 3W11C 2XN9B 5JTWA 1Q9KB 2RB8A 2XY1A 3WSQL 4Z5RB 2GT9A 3BQUB 2J3SA 4S1RL 4KDWA 4NN5B 3S4SB 2GJJA 3C60D 3RVTD 3HG1E 1OW0C 4LVOC 1V8HA 4LRIA 1TZIB 3QUML 2BY2A 1KT2A 3TH2T 3SDCD 1IL1B 3SHSA 2D7TL 4HS6A 3ZKXC 4BZYA 4RFNC 4YFLF 2P24B 3ARGB 1P69B 1OAZL 4KK6C 3OBAA 2H32H 4L1HA 5FOBA 1HILA 4HMCA 4QNPF 3T0ED 2A0LC 3GSQA 5FUZL 4CMMA 2COQA 1QFWL 1OPGH 4X8JB 2Q8AL 1XR8A 2ICEA 4H20H 1LE5B 4YPGB 3RWHA 4UQ3B 4Y4HC 3QDAA 3TJEH 3SKNB 4GBXB 4YJZL 1RFDH 1G0YR 1YN7B 4K7PX 1PYWB 2V9QA 2EE9A 5IB2A 3JZ7A 2OL3B 5FYLD 4OD1H 5J1SC 3UPCA 3CMGA 5IIEA 3O4LA 5EPMA 2H45A 1KIUA 4AL8H 1RZ7L 4R0LA 4QF1B 2L7UA 5CJQL 5J13C 2WWMD 1JK8A 5KSBE 3PWVA 5CHNA 5SWQA 1OD9A 2NY5H 3DGGA 1ZVSB 3ELAT 4LSVH 5IWLC 5JR1L 3L3JA 1Q9WA 1IQDA 3MLYH 2CDGA 2VYRE 1SBBA 4P9HH 3T1WA 4V1DA 1QVOA 3FRUA 4G6KL 4IIQB 1OLZA 4FQLH 4NNXA 4UOW1 2N4IA 2DWDB 1AI1L 3VA2C 1E4XI 2Q76A 2J8UA 2AKRA 3HNSL 1TZHB 1LQSR 4P2OB 4MXQD 3EO9L 4X7TA 2BVTA 4RWYH 1ADQL 5KAQG 4ETYA 2AV1B 2GK2A 4AYFA 1CVRA 4JQXC 4M3JA 4OTXL 2W9DL 2D0GA 4JZNB 4MX7A 1BBDL 3OB8A 3PXJA 1UXSA 1P4IH 2VQTA 4LF3B 1XGQA 1H3XA 3VFWA 5C9KA 1CLZL 5D1XC 1N6QH 1U93B 2R8SH 4WTWA 1FAIH 3UBXG 1A9EA 2W0LA 5DD1H 3NA9H 1IGJB 3B83A 1MI5D 5B38A 2EEDA 1A7QH 3O8XB 1RIUH 2PTVA 3FFCB 3MLTB 3U79A 1AGEA 3PABA 3PWPE 1NGXA 1GGCL 3RNKA 3FT3B 4M5YL 3TP4A 2HMID 4HEME 1FG2A 4ZYKB 4C56B 4F9LA 1NFDE 4I0PB 5JUEL 5IFJB 3EOAA 1YZZA 4U6HA 1MJ8H 5F9OL 4KJWC 2A6DA 1MUJA 3FB5A 4Y4KB 1F2XK 1T66D 1SYVA 3QUMB 1KEML 4X4ME 5DURD 2FEEI 3DOSA 2ZZUT 2E6PA 1K2DA 2BVPB 4XAKD 4OGXL 4X6BA 4P46D 4XMLL 2AVGA 1A3RH 2OTPA 4MCZB 5HGBB 4RISL 2M1KA 5BZWA 3VFMB 4ZXBD 5JNYA 2PTTA 4UAOC 1YEGL 3D18A 1ETZB 3KJ6L 3MLRL 4FTVB 1REIA 2J88L 3WS6C 2BSED 2B2XH 1LGVA 4K7PH 3TT1H 3B9DA 8FABB 3EFFB 1KJ2A 4NO2A 4L3AA 4WI3A 4IMKC 5DC4B 5JIIA 1QTYT 1EAPB 4KROB 4KJQD 1KGCD 3HE7B 5C08E 4AEHL 2X4RB 1K4DB 1NJ9A 1J11A 1P84K 4QNPE 3MRRB 3BFOA 3DMMD 3P9WB 1FFQA 2CRMA 4WVRA 1MJUH 5E08L 3RNQB 3ARDB 1TETH 1VB9A 1F42A 3OXSB 3WYRA 3OWEA 4YHLL 1BIIB 1P7QA 3LH2L 3HNVL 4GG6A 3GEWB 5T33H 4PTTB 4TRPH 3KPLA 2Z91A 4M6OH 5DA4A 2R2HA 1VENA 1UCBL 5SX4H 5DO2D 2X9WA 5JOFB 4NCC1 4L4VB 4WWKC 1UKSA 3WLWD 1FZKA 2QSCH 4UDUA 1YEHH 2VAAB 2BSTA 3EW3B 3G6DH 5MENA 5CZVL 1P53A 3AFLA 4ZO9A 2F53D 3RDTD 4GRLD 1YNTB 1ZEAH 2ADFH 1MFCH 4LFHG 3FO9B 4Z0XB 1A14L 5A40E 4O2CB 1N2RA 3VCLB 5E9DA 2QHLA 1E6OH 4O4YH 5BS0B 3Q6FB 4G59A 3TO2B 1INQA 4L8CA 3MNZB 1D5XA 3TBVB 1RUPL 2L0DA 5CUSL 1UB5A 2R1YA 3CDGB 3I2CL 1BZ7A 3P0YL 4LDLB 5CINL 3ZE2F 4KY1L 4RDQG 1JUFA 1DUYA 5F7EL 1KN4L 3QDME 2BOBB 3L3DB 5I8KH 3WXVH 1DL7L 2ESVA 3O2DH 2DQIL 4H8WH 1A7NL 1GRWA 3KPRA 5HHVL 4L3EA 1KTLA 4HWBA 1N3NA 4O51A 1RURH 1NDGB 1MREH 1YQVH 2Z31D 4Y8DC 1M7DA 5D7SH 1OT1A 5C0AD 3HFML 4PDCE 1XIWA 1MCDA 3WIHL 4JR9H 2FB4H 1T1YB 3QFJA 5LAXB 5L6YH 2EXYC 4HG4J 4J1UB 2ICWJ 2NY3C 2VXQL 3VFNA 3KPSE 2OZ4L 3W2DH 3OKYA 3BRFA 5ALCH 2ZOLB 4NBXB 5IFAH 3MRKB 4L9LC 43CAB 5C0GB 4OI9A 1TVBB 3B43A 3GGWA 3EYFA 3KGRA 4LLYB 5L88H 2CKBL 2OP4H 2LTQB 3TO4B 2UUDK 3ULUH 1T1XA 4KWUA 2Y5EA 5F9WB 3T3PF 3IFNL 1OOAA 2PN5A 2P5EB 3BIKB 2X09A 4IDJH 1LP9F 4G6JH 1OAXL 3HC4L 2NXYB 3B2VL 1JZ6A 4I5BB 3ILPB 4AG4H 3SCMB 3ZDXF 5BOPA 4X7EC 2G5RA 3QCVL 3DXAE 1T7WA 2IANB 4RFOL 4ZQKA 1HKLL 3RVXD 1HI6B 3UTOA 1WIOA 1BREA 3MRCA 4L8DB 4GSDH 5CCKL 3N0PB 2BNRE 4CVZA 2VDNL 2EYSB 3NA4A 3TA3A 4JDTH 1PD6A 1VFMA 3BW9B 5EUOA 3MJ9L 5E03A 2C4FU 2ADGA 5E8PA 4M62L 5IW6A 3QIUD 5JHLH 4GKSA 4N0CD 3ARFA 3G04B 2EEAA 4PV8A 3MROA 3D3VD 1II4E 2I25N 3TJHA 3VXMA 3OKOA 3GMLB 5C2UB 5TF0A 3DYOA 4DK3A 2NY1C 2B1HH 4Y89A 2XTJB 3N50A 4QRQB 3WL9B 4KI1A 3F8UB 1YYLL 2D3VA 4N0UE 4LRNH 3TPUB 5GZOC 3SDXA 4G80B 4GOSA 2HLFD 4NRZB 3CLFH 2WLZA 1UENA 4F7EA 2AK1L 3UP1A 3PHQB 4NUJB 2VDMH 1F02I 3T65A 3S3SA 2OM5A 3GJEB 3QPQC 1LO4H 3NFPB 3FQWA 1CLYL 3L95A 1TVHB 4LCUA 4LCYB 4X6CB 4MDJB 4AJ0A 5IW1B 3IDJA 4JRXE 1INDL 1F4XH 5D7LB 4JVUA 5DYOA 4PJDA 3NCBB 3ZE2E 3ZMRA 2BDNL 2ADJB 5IW3A 5IJVA 1NGWB 4D2NA 2WSKA 3L7FB 3Q2CA 4PJ9A 2DD8H 4JAMB 4K2UL 1QHPA 3G6AA 4EN3C 4DKEH 2H2PC 5IQ7H 5MI0C 5C07B 2FCBA 4IRZL 4XCCL 1RK0B 4PJ7B 4FABH 2CMRH 4CKVX 1U3ZA 3HI1B 3NN8A 1MF2H 4F7CA 5HYSG 2CKBB 4X5WB 4HF5L 1JL8A 4NDMA 5FUOH 3D9AL 2IBBA 2DQUH 4MNHA 4WI4A 4JFFD 4PPTA 1S7VB 4LARL 3A67L 3C08L 2EDYA 1BQLL 3BAEL 1R24B 3MRIA 4JFYB 3INUL 1W8OA 5LXGH 2I5YH 5GXBB 3ZE0F 3LEVH 3S6CA 1MCCA 1OTSC 1A7OH 5EZJA 2EDNA 1EFXB 1WBYB 4Y19A 1FRGL 2J12B 4WI9A 5HHQA 5FB8A 3SE8H 3B9KD 4FFYL 2A77H 4QRTB 4JN2B 1ZGLB 3OHXB 3LKSB 3T3PE 3U9UB 3G08A 4EDXB 1N8ZA 4Z78A 1NGQH 3MA7A 5I1KH 5KS9B 5B39G 5KVGH 1FNEB 4PJXA 3ZDXE 3ZKMC 4LCWD 1WK0A 2GJ6A 3RGVB 2OXHA 3PGDB 5TE7H 4KRMB 3DECA 3TIEA 4U6VL 4Q9BA 3AU1A 3CSYB 4U1NB 2AJSL 2C1PB 5EU5B 5D70L 1U92B 1NUFA 2E7CA 1FN4A 3V4PL 3RWIA 2DIBA 4JFZL 1G7JB 1DEEB 1J8HE 1MQKL 3BJ91 3LSOA 4PRAA 1NGYA 4LL9A 4PJGF 1NCWL 2DQHL 4L5FH 1NUGA 2FH8A 3HAEH 4NO0B 3CNKA 4N5ED 2JIXB 4MB4A 1IC5H 5J6GB 2PO6D 1EV2E 3RA7H 3DURB 4RFEA 3UDWC 2AEIT 1TCMA 4F58H 4DVBA 2R0ZL 1Q1JH 1AP2B 3RBGA 4P5TD 4P4RB 3VJ6B 4OF3A 4D0DB 5JW4N 3C6LC 3KPOA 4URTB 3DO7B 5HDBF 1Y18B 5DRXB 3VWKC 3CC5B 1RMFH 1CQYA 3PNWB 5L7XL 4XH2A 4XBEL 4JFEE 2WIMA 4XC3H 1QSFA 4PGCA 1UH3A 2Y07L 2HFTA 3V5KB 1RZ8A 3GJFA 1JPGB 1QPXA 4M6NL 3BZEB 2B0SL 2UYLA 2WINA 1EH9A 2F74A 4H8WC 1DZBA 1I7TA 5ELIA 4G42A 5GJTL 3I85A 1F58L 4PD4J 4BFBD 3MTRA 4MNGE 3D48R 2OTWA 4FXLA 1QFOA 4FN0A 4F9PC 3BDYL 4K3HA 1GIGL 4WFED 5DQ9A 2BFVH 3MRJB 4DCQA 3OR7A 3UTQB 2K7QA