2AXGA

The immunogenicity of a viral cytotoxic t cell epitope is controlled by its mhc-bound conformation
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
276
structure length
276
Chain Sequence
GSHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRTEPRAPWIEQEGPEYWDRNTQIFKTNTQTYRESLRNLRGYYNQSEAGSHIIQRMYGCDLGPDGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGLCVEWLRRYLENGKETLQRADPPKTHVTHHPVSDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The immunogenicity of a viral cytotoxic T cell epitope is controlled by its MHC-bound conformation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system/gene regulation
molecule keywords HLA class I histocompatibility antigen, B*3501 heavy chain
total genus 77
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 2005-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2axgA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 2axgA01
3T0EE 4LMQI 4YDVB 5HYQA 1AQKL 1FORH 1NBVL 1F5WA 2G5BA 3VU2A 2DQCL 5ICYB 3ZSTA 2NTFA 3CU1A 3QJFB 3QDMD 4TVPL 3TO2A 3L5WA 3CLFH 2LVCA 3RGVD 1IBGH 2E27H 1OP3K 4X4XA 4HIEB 4D2NA 1MEXH 1OAUL 1ODAA 1QOKA 3B8YA 3PWJB 3IDNA 1S7RB 5GS1A 4LSRL 1KTKE 3KS0J 5FGRA 1X6LA 2Q76B 1AKJB 2AJ3A 3LPWA 4UT7L 4XPBH 3HPLA 5TF0A 3TYGL 3ARYA 3O6FD 5DURB 4L9DA 2ENSA 3HR5B 4K3EH 1H0DA 1N3NB 2HN7B 4G8GB 2Q6WB 4EN3D 1BBDL 5E8NA 1U8MB 4ENED 4RQQA 3C5JB 5ISZD 5D2NE 2DL2A 3P4MA 5I30L 3BPCA 1A0QH 3W39B 1CVSC 4UU9A 5HVHB 3DO7A 3LQAH 4ZMAT 2D03L 4XPGH 1A1OA 1UXWB 2Y07H 4ZPTB 5DHXB 1OAXH 5T33H 3VXRA 3RVVC 4HUXA 4JFPB 4OFDA 1AGBA 2R1WB 3V7MA 1CXIA 1OAYL 5IFHL 2VH5L 3NCJL 5JXED 4OFPA 4JPVH 1HK6A 1DEEB 1I9EA 1MLCA 1A6WH 3Q5YA 4S11A 1C5BL 5DJYA 5IF0B 4JM2F 2VL4A 5FUOL 2DQJH 3I2CL 5K9QI 3BP6A 2GTZB 1QPXA 3AROA 4RAUA 1WZKA 5JHDE 1IEHA 5CEZD 4RA3A 4ODWB 2XZCL 3VRIB 4JG1L 1T3FA 4NKMB 1FVEB 5EU4A 3UTZB 4Y16C 1TZGL 3VXRB 3BKCH 4BYHA 1N6QH 4GG6A 3EBAA 4LCWD 1RZKC 5CZVH 4HK3N 3UTQA 2BZDA 1GOGA 4KZEL 3W2DL 3H9HA 3T3PE 3FQXB 4NQTA 3B83A 4LEXH 4I2XE 2UYLA 4WJ5B 5E7BA 5I1GL 4P4KA 3HI1B 3GGWB 4M7LH 3X17A 2W0LA 1JZ2A 2P1YA 4OI9A 1F6AB 3MOQA 3MRHB 5MI0B 4DOHB 1KV3A 4M7KH 3H9ZA 4Y7MA 2EXWC 4GRWB 3MRJA 3L5XH 1R0AH 2FL5B 3ALXA 2J5LB 5EOQL 2KBGA 3MR9B 4IOFC 5DRZB 5FIEA 5IROA 4HIIA 2IH1A 3TZVD 2FX7L 2I27N 2CXKA 1B0RB 1MCOL 5F1NA 1NAKH 3EJYD 4K94L 4IRJB 4LOUD 5SWSE 4M48L 5MEOA 4X4XB 4MNHA 3VXTB 3KPMA 1MY5A 5JIIA 5EWIH 5D8JL 4BQCA 1W0YT 2D9QB 2E7HA 5FUCC 2FL5A 1IRAY 2BSED 1KTDA 4Q6IA 2FATL 4F7MA 4KC3B 4LKXA 3QIBB 4Z9KB 2P47B 4X9FA 4P9HC 4HXBH 2P5WE 3PV6A 5DD0H 4QNPF 3RI5K 5IIEB 5L2KD 1WWCA 4EDWL 1UVQA 4PJFE 5IJKC 4MNQA 2F5AH 1I85A 5HDQL 3QIWC 3K4DA 4KXZI 1WAAA 1P6FA 3QUXD 4APQC 2VQ1A 2ED8A 4C83A 2E7LE 3FO2B 4ODHH 4MGXA 1GGUA 4JRYA 3MRIA 4Y8DC 3VFVB 2GTWB 4QHNB 4KGLA 5E08L 3VGAB 4MNGB 4OFVA 1FL6A 4ONGH 3NABH 5ACLA 4DW2L 1OQOA 5GPRA 4KKBD 4N0CC 1MCJA 2B1AH 3PWJA 1W0VA 5GS1C 3HNSL 1U8JB 5F96L 1DQQB 4JFHD 2DQDL 3DV4A 4A2MA 5DTFA 2IH3A 2UVEA 4XAWH 4MAUL 1OSPH 3FONB 2P7TB 1WUNT 3D25A 2KZ1B 1TJIL 4YDLB 2CDFA 1QFUL 3CFCL 5E2WL 4RMTA 2HVJA 4RGMB 4FFWD 3SDXB 3ISWA 3MUZ1 3U0TA 5B39A 4UU9B 5EOCL 4DEPB 4KVCH 1OPGL 5FEBA 3P73A 5J6HA 4GXVH 1UB5B 1GZPB 4RFNB 4V1DD 4O02L 2R69L 2YUWA 1YUHA 1LVEA 2CUHA 5I16B 5EU5A 5JOFB 2CPCA 1CBVH 2FX9H 3V8CA 1WV7T 5CZKA 1IEAB 3IRZA 3QO1A 3QUZD 4EUPB 1DBML 3MV7E 1ZHLA 3GSOB 5J57B 5JHLL 5JLZB 4V1DB 4RMSA 1PYWA 5I9QC 5KANI 1MRDL 4PRAB 1NGWA 1R5VA 4P2RB 5K59F 2DOCA 1FZOA 1CFSB 1G7JA 4OT1L 1PJ9A 4R7NB 4JRWA 3TO4B 2NY4B 3MFFB 3N1GC 4QTHA 4KUCF 1PG7L 1CXLA 1U8QA 5F6IC 2YXFA 5I71C 1TVBB 4DVBB 3BWAB 3K74B 2X4OB 3U4EB 4UIKH 5T3ZH 1ZS8A 4ODXA 3ZMRA 1FPTL 3NPZB 2NY5C 4GKNB 4DK3A 3I50H 3QFJD 4TULL 5HYQB 2VLRA 3GMPB 2WMPA 5FGSA 4X6FB 5I74B 1LNUB 4Z76B 1QKZH 3FQNA 4WO4C 4TNWK 4Z7VB 4YHPB 1QR4A 4L3AA 4EN3A 2R8SH 3QXVA 1OAXL 1Q9KB 1RIVH 4HJGB 2A6IA 2ESVD 5E00B 3WJJC 3AM8C 1A64A 4I77H 3G9AB 3K1KC 2A1WL 4HHAA 2RJMA 3RVTC 4DK6A 1OQXA 2OJEA 1OP9A 3VJ6A 3WLWC 2OL3B 2D3VA 3VXUD 4EJ1C 5EO0A 5MEPB 3ARBC 1Q9OB 4X7FC 2EKSA 2NZ9D 2IF7A 2YC1A 4NBZB 4Y4FB 3QIUD 4YXLL 1KCVL 3HAEH 4ZO7A 3CFBA 3GSXA 3QG7L 5T3XL 4UILL 2A0LD 4MD5A 2GSIA 3QDGD 4L3CA 3O11A 5T1KA 3BW9B 1QR1A 4HCRL 4NZDA 2F8XC 1QSZA 4FFWC 3AXLA 4X9HA 4XNXL 5J9PB 3ZE2E 1VESA 1QBML 2XN9A 4D0DA 4YPGB 1I1RA 1T7XA 1XGPB 2N7BA 4R26H 1WT5A 5EC1A 5TF1L 5DD1H 5J1AB 4NO0B 2IAMC 4XC3H 5IFAL 3JVGA 3ARBB 1PX4A 3LS5H 3GHEH 1MCOH 2R2HA 3JBG7 5H37H 2BSTB 4UNTA 3CFBB 5JA8B 4I3RL 1CL7I 5J6GA 4NWTL 3DHMA 4H20L 2IAND 5C0FB 2H26A 4KK8D 1JPFB 4HWBH 4X6BB 1QQDA 1UKSA 1RPQA 3CLFL 4I0PB 1P4BL 5JA9A 2DMKA 4XZUB 2FIKA 2IALA 1JNHB 5FM4A 4EI5D 4EXKA 1UWGL 2PYEA 2C4FU 1AQKH 2XWJA 3MCLH 1MIEL 1J88A 1LEIB 1QSFE 1XZ0A 4K2UL 5TE7H 1F11A 3PGDA 4QWWD 3SKOA 4UT9L 5GS0L 3LHPL 5DEGA 5F7DA 4KK9C 3V5DA 5CZVL 1SJEB 1NBYA 4H0HB 2V7HA 1CXEA 3C5ZC 3IF1B 3W0WB 3HE7B 4CJ0A 3KS0H 2DQFB 5BO1H 2K1MA 3R4DA 2YMXH 4M6MH 4CW1A 4GRWF 1J12A 3VFSB 5I9QB 4EUPH 4I5BB 4CUCA 3FB8A 1QKZL 5JW4R 3EHBD 4ORGA 4EUPG 3NCYS 3D3VA 2XPGB 4MXWL 2NLJA 3PWNB 1KNOB 2IMMA 4X9GA 1ZGLA 3H0TB 4GJTB 2W9LA 4ZXBA 5IFHH 2P46B 1FBIL 1YJDL 1II4E 4RCAA 4L4VA 3VFWA 3TPUE 5F7YC 3GSOA 2C9AA 1Y6NR 2KZWA 1FL6B 4NZJA 3T3ME 2NX5D 4FQXD 2IMNA 5E4EC 4WW1A 5ISZE 2EDYA 2D03H 1KBGL 3FZUC 4XPGL 3T0ED 5C0JA 3IDUA 3PDDA 4OQ1A 4ZAKD 4GFTB 2PXYC 4L4TD 4NQXA 5IW3A 2VQ1B 4K55A 3LRSB 1DLHA 2Z93A 3I3BA 4N8PA 5E5MB 3VFRA 3U1SH 5EIQA 3UDWC 1XIWB 2GITB 4HKBA 1NJ9B 4YBLC 2F8VA 4RMRA 3LVEA 5L8KB 4QHUA 2YA2A 2YA1A 3T2PA 1JGDA 1NCDH 3QJHB 1IARB 3U0WL 1B6UA 4YX2L 2OZ4A 1IGTA 3CH1A 1HNFA 2F15A 1R3KA 4D3CL 4Q58C 4R97C 5HGBA 4KK6D 2VZTA 2XFXA 3KPQA 4YZFE 3UBXG 5IMOB 3DYPA 4G8GE 5FO9A 4LSVL 4MNHB 3BKJL 3VDBA 1IGIH 4KH2A 1FCCA 4U1LB 3RTQA 3C87A 2CGRH 1JFQL 1YEIL 1L7TH 3MREB 1T1WA 2EKSB 2W0PA 3QDMB 3TIEB 4WNQB 4OM1L 2ICES 2BRQA 3TCLA 4G6JL 4D3CH 1CDHA 4BK5A 4FTVA 4NPYA 3GHEL 3LSOA 1MJJB 5TDNB 2CQVA 4OCWH 2ZKHH 1AHWC 1L4IA 1PG7W 4N90D 2E5EA 1JYXA 4FMKA 4M1GH 1MCKA 1HYSC 4RRPA 4WU7B 5EC2A 3IU3A 3K3QA 2N4IA 3BKJH 4JN2A 4OCSL 2XI9A 4XNMA 2VO5A 1MAML 3LEXB 3P40A 1P53A 3RX5A 3QNZB 4JY4B 3OPZL 4RSVA 1Z9SA 4AIZA 2V5YA 3L9RA 5J1TC 2YUZA 1NCDL 5E1AB 3CXDL 1IM3B 3DXAE 3VCLB 1BVLA 5D7JD 5FDYA 4ESKA 7CGTA 3CVIL 1T7YA 1S7SA 4GOSA 3OAYK 1XGRA 5D1XB 1ZT4B 1IAKA 3CFJA 3GM8A 5LBSH 1QVOA 3O6FA 4EQ2A 1P6AB 5AG9A 1A7NL 1U9KA 2DQEL 1S5IH 4XPAH 5FA3B 5E9DD 2QHRL 3KR3H 4I13B 1ZLSL 4DOHE 1WSST 1WIOA 1C7SA 2D7MA 3C09C 2CLVA 2J8UE 3S35X 1TQCB 4NQDB 4Q74A 3K2MC 1Z3GH 4QRQB 3ARFB 3HI5H 5E1AA 1KFAH 4HPYL 4LU5H 5EOQH 4NKIH 5KSAA 4JZNB 1CXFA 1S78D 1M7DA 1A9BA 4LK4A 3TPKA 3MJ7B 5DRNB 2OXHA 3TNNA 3H9HB 5T3ZL 3QHFL 3GNMH 3U30C 2QQKH 4NRXB 3QHFH 5CUSL 4UV4H 3QIUC 4S2SA 5I8EB 2YMXL 3KYOB 5FK9A 4IRJD 3MRFB 4M7ZB 1DVFD 3ZDZE 3K1DA 5AWNL 3MXWH 2I07B 1NGZA 4NWTH 3GMRA 3BRFA 1YY9C 2BVPB 5IB4A 4OFKA 5IMLB 1GGBH 4FXGA 2NR6D 3IXAA 4GKSB 4OZGA 4NKDA 3HZMB 1N6VA 2WLZA 4X4ME 1F13A 5FB8B 3TIEA 5DS8B 5TPWH 3GM0A 43C9B 1JPGB 2DQEH 4XPAL 1XGRB 3ZYJA 5CJQL 5EBWB 4LPXA 3BP4B 1Y6MR 4MCZB 1LQSR 4NN7C 3DRTB 1BWMA 3QULA 2YKLH 3MLVH 4P2RE 4RDQF 3AU1A 3C8KA 4KTDH 2DICA 2X1PA 4MAYD 4K3DL 2QSVA 3QNYB 4URTB 3TV3H 1SVCP 1XH3B 4GG6B 1ZTXL 4M61B 3WFCH 2H9GB 3S88H 4LPVA 4FG6D 3MJ9A 5J06A 4TTDD 5F7EH 5HXMA 3KPLA 1Q38A 3MROA 1PLGH 5F1IB 3EYFA 1IQWL 4ZAKC 3QUZC 1KJ3L 4PGCB 5IJVA 1HH6B 1NQBA 3Q3GA 1NGZB 5C2UB 4NOFA 4BH7A 5FO8A 1VSCA 5D5MF 3BKYL 4OB5H 1R3HA 2VDML 3KYKL 4HIIB 1SEBA 3M1BB 5E6IB 2WNGA 5DMGD 2FEEI 2VAAB 3B43A 3QISA 1WZMA 4G43B 5C09D 3ULUE 3ZZ1A 3BFOA 1J8HD 2DRUA 3U9PL 5IB4B 2GK0A 3WLBA 2G5BB 4JO1H 3VGGA 5IMMB 2P44B 1KJVA 1F8TH 3GFUA 1XGQB 1FPTH 4JHWL 2CRZA 3MRDB 3UPAA 1L6XA 4JFEE 4MQ7B 2OXGA 4J3WA 5ICXB 3CSYB 1QPPA 1MIML 3RRQA 4RISL 1AGDA 2EDNA 4LGPB 5HHQA 1CTNA 3RQ3A 4NYLA 5TDOA 5EWIL 4JZNA 2FEDC 5ESAB 1CD9B 3MXWL 4H5SB 4NKQB 5K9KA 3SDCD 3WD5L 1L7TL 4GXUN 3TIDB 1NDMA 2F54A 3PG2A 1A4JB 4WWKA 4Z77A 2CLRB 3P3YA 4EI5C 4P3CL 2YD7A 3GMQA 4FTVB 4ZUTB 3OXSA 4HT1L 1WWAX 3KLHD 2ID5A 3WFDL 4AH2B 1TLKA 5LWYH 4KJWD 4HMDA 1FQ9C 1KIQA 1T89C 2C26A 5D6CA 4JPWL 3QUXC 3ZKXB 5KVMC 3WFHB 2B0SH 4K7FB 3W9EB 3SO3B 3BGFB 5L88H 2R56H 1UQSB 5F7UA 3G04B 3SO3C 2BP3A 2D4FA 4FZEH 4MCYA 4LEXL 3EDFA 1IVLA 3JWDC 1MVUA 2HMID 2DQHL 3O3DB 2B7DT 4FMFA 1NMBH 3EIFA 3PF2A 5M95B 1HXMA 5DK3A 3T1FB 1U8HB 3S36X 1NFIB 4MA7L 3WFBH 4QOKE 2ADGA 4NN6C 2Z92A 2P8PB 2X9XA 4PD4J 1RULH 3HG1A 1U41A 5LBSL 1GOHA 5BO1L 3FQUA 3QWRD 2BXZA 4XAKD 5JR1H 2AP2A 4JO4L 5ADPL 2DBLH 3SY0B 1F4AA 2CO7B 1FDLL 2XZAL 1OT1A 2EDTA 3VXPA 1X5HA 4RFNC 3EOAB 3U46B 3O6FB 5DURD 1NMAL 4K8RH 3C9NB 3BI9X 5C0AB 4DGYL 1B0WA 2GFBA 4CMMB 1NBZB 4ODHL 1ED3A 5D72H 1A2YA 3EYUL 1DQTA 4XB8A 1EJOL 4DVRH 1H8SA 1FZKB 1CGTA 1BZ7A 1MCCA 3BD4A 5DUPH 1FNGB 4RWHA 1JPSH 4F7CB 1NC2D 3JTSB 3VFGH 3MOBL 2E7LC 5DD0L 3BMVA 2BSTA 2R4SH 3GMNA 1JV5A 5JXAH 5TJWK 5I74C 4PGZA 4K23H 1A6ZB 1FNHA 4XGZB 3TNMB 1TVHB 3LS5L 4JREC 1AGFB 4Y5VC 2HMIC 5ACZA 2P49B 2YN3A 2DLFH 2VLRB 3SCMB 3R1GL 5J9PA 2DM2A 4JDZB 4WFGE 4U6XB 1RZJC 4L4TA 3C2AL 4K3DH 5CMAB 4M6NH 3T3PF 3QXUA 1UH3A 3H7LA 4EDWH 2CGRL 4H0GA 1RHHB 4YGVA 2EIEA 4HS6A 3VDAA 3U30B 2FO4B 5J56B 4R96B 1KN4L 1IC5H 1YEHH 1ZLVH 2HTLC 1HZHH 4PDCE 1V7ML 2PO6A 5EUOA 2B1HH 3QEUA 3QCVH 1IAOB 1S7TA 2Q86B 5LAXB 4TSCH 2H45A 5I0DA 1XGUB 4KDWA 1JN6A 1GC1L 4EQ3A 3KPSB 1G9NH 3TF7A 32C2B 3NCFB 3WN5A 3QG6B 3AS1A 3EYOB 2NLJB 3G5ZA 1MUJB 4E5XB 3FT4B 4FQ1H 4HXAH 3RIAK 4PJHA 4WHTB 1CCZA 3K7UA 1SM3L 1UZ8A 2XZCH 5DUMH 3U0TB 1AI1L 3VWKC 1AO7B 3O3DA 1K9TA 4MB3A 3HE7A 1CE1L 3TFKA 1IGJA 4GKOA 4P46D 1INDL 5CP7A 3BH9A 3WXVL 1T6WA 4XWGH 1FL5A 1CDGA 3B9VA 3AFLA 2EYSA 3BHBB 4P5MB 4TN9A 2FBJH 2B4CC 4POZD 5T3XE 4MJ2A 2VKWA 4F3FA 1C12B 1K4CB 1MCPL 5INDA 1MCLA 4KTEL 3VGAC 1QFPA 2YC1B 2C1PB 3BN9C 4KKBC 4N0CD 4QRRB 4XX1G 5KJRL 4UTAH 4YGVB 4OTXH 3QAZB 4RFOL 3V6ZB 4IIQC 5EBLA 4JFDD 2Y1VA 4IHOA 4LAQH 3IETA 1ULVA 5CP3H 4F33A 1IGJB 1LO0H 1RZFH 4YPGA 3FO2A 5IHUH 1P84J 3VD5A 1FO0L 1MLBB 1AD9A 1B2WH 1FFRA 5ICXA 2GUOB 5DMKB 4MA8L 3T1FA 1PG7H 1FNSH 3BESR 2EICA 4TSAL 4Z76A 5L2KB 2IJ0C 4KJYA 5GRUH 1I4FB 2BXYA 4H1LA 3L6FA 3RDTA 2EXYC 1ZHNA 1MFBL 4XNZC 4Q6IB 4QHMA 4YDIL 1P9MA 3HUJA 4XP6L 1JF6A 1DLFH 1NUDA 1AKJD 5HHNB 3TO4A 4UMGA 1CDUA 2BNQD 4M03A 1TETH 2AEIT 4QRPA 2R0LH 1I7RA 3CZFA 2NXZC 1BREA 1FORL 3QUYA 5EZLB 1MHHA 1KJ2A 5CD5C 6FABL 1T5WA 4S1QL 4QY8B 4YHLH 4P4RB 4NBXB 3ZYOA 1HZHL 1RHHA 3AY4C 4WV1A 3S36L 4IOFD 2FJHA 1SVZA 3OAUH 4OZFB 4QHNA 4NCC2 1GJIA 4BUGA 3O9WC 5CEXA 3H6JA 2XY2A 3H3BC 1TFHA 3QAZC 3INUH 3QNYA 1JPSL 1YEIH 1W72B 4MAUH 2UZXB 5I18L 2HJLB 2X4PB 1M05A 1WF5A 3BD5A 3PQYE 1FO0B 3RUGB 5IB3B 3BPNC 1A6AA 3OKMB 3CAFA 3P4NA 5E99L 5DJDA 4PYHA 2OR9L 1BZ9B 2IBBA 1CFSA 1G7JB 3BN9D 4BSWB 4DW2H 2EDLA 3RPIA 4R4BB 4PRAA 4I77L 2VXSL 5DHYA 1KIQB 2I9LA 5IK3B 3D85D 4ODSL 4XNQA 2VLME 1JTTA 1CDYA 2PR4H 4JFXB 4E41A 3A6OA 5I16A 25C8H 4ELMF 1NMCB 1MFEL 1KBGH 4FTVD 5F1IA 4HC1A 1DP0A 3BH8A 5ALCL 3L5JA 5EFIB 1PKOA 3U36B 4MJID 4PGDB 5LKNA 1UM4L 2R1YA 4QXTA 4V2CB 4ONOA 3CU7A 3L1OH 4YWGL 3RDTD 3HRPA 4ZSOE 3X3GL 5BV7C 4GSDH 1T21B 2AI0L 1WCBB 3O8XB 5E7FA 1R3IL 5TPWL 1N2RA 2VZUA 3GBMH 1RZJH 4O2CA 4QTHB 3F58H 3MZTA 4HC1H 3SOBL 3RNKB 3P9LA 1DQMH 2V5TA 4I2XA 3CFDA 3NIGF 2ADJB 2OK0L 1KCUH 3EDKA 3ZE2F 3LQZB 2R1YB 4QXTB 4Q97A 3WD5H 3C6LC 3VI3F 3BDYL 4YFEA 5GRJL 4LLWB 1KN2L 2R29H 3LIZH 5CD5D 1BX2A 2HT2C 3ZDYE 4K71B 1YY8A 3IDMA 3VD4A 1VB9A 4EXPX 3IFLL 2X1QA 1GYAA 4U1GB 3T0AA 4YHOL 3RY4A 3GMRB 2O93L 1U93B 2QQKL 4PFEA 3GK8L 2ITDA 4ODVH 1QTYT 1TJIH 5TDPA 3EYVA 1NCWL 3O0RH 2H2SD 1MWAA 5I66B 1KPRA 5SWZB 3KVQA 5H94B 4QHKI 3MJ6A 3ZDZF 4QOKA 4NKIL 1E0OB 1NUFA 1GH7A 1S8DB 4ZO8A 4BFGA 2R2EA 2DJSA 3DO7B 3S35L 1KTDB 1MIMH 3FT3A 1FIEA 1DBBL 4LDLB 1IKNA 4N5EC 4MCZA 3OB0K 4ODUA 5FXCH 3STLB 4TSBL 3T0BA 4HQQL 4P46B 1DR9A 4YIQA 5TF1H 2ERJC 1BOGB 3LCYA 1NCBL 4IRJA 4KQ4H 3VFUA 4AT6B 1D5XB 1YYLL 4KKAD 3HC4H 3OKNB 5GJTH 3CVIH 3EOBB 4GAYB 4GBXD 3QBTB 2AABH 4P3DB 4G59A 3ULVC 3EGSA 2GJ6D 1WWBX 5FYLH 2GTWA 5FYJU 2F74B 3VGEA 4IJ3B 2I07A 2NNAA 1CG9A 2X44D 5GQBA 5FO7A 5KVFH 3DROA 4NNPL 1BLNA 2HFEA 5IHLB 1UCBH 1PLGL 1IBGL 4YC2B 1OARH 4U6HA 1UXSA 2QSCL 5ICZB 1UM5H 3HZVA 4P2QE 4XNMB 4HLZH 2G60L 3RUGA 3QULB 2XXCB 3HA0A 1W0WA 4IMLA 3HMXA 4U0QB 3UZQA 2FRGP 4OD1H 3ZL4H 5DJ6B 3GSNA 2IFGA 1E4XH 2NNAB 3TC9A 4FS0A 2PN5A 3C60D 5DK0B 1H0DB 1N3NA 2OJZH 5EN2B 4I9WE 4JFXA 1XR9A 3FB6B 1JFQH 4ZOAA 1INQB 2IANE 3A67L 3J8F7 3MBXH 5IGXH 1P69B 1YEDA 4OD2A 2X6MA 4F7PB 1FFPA 1F4HA 3LB6D 4X7SH 4YZFF 4JFOA 1JWSB 4JPKL 4PRPA 5DC0A 3WIHH 1DFBL 2EE2A 4NNYA 1DUYB 5KG9A 3IAPA 2VXVL 4AL8L 5BZDA 3QH3B 2FEEL 4UDTB 2NY3B 4KK5C 4NSKB 4NZUH 3W5MA 1KN2H 2VLLA 3FO1A 2X4TB 2JCCE 1J10A 1CXHA 1T21A 1FFNB 4DGIL 4NZRL 3VFMA 3HB3D 5D7JC 3WUWG 3I2CH 1CFTB 3O2DH 2A73B 3NVQA 4OUUB 1V8HA 3BVNA 1J1PH 1M7IB 3CDCA 3LRSA 2JK5B 4P4RA 5K9QG 5L6YL 2R2CA 2EDJA 3EYOA 3AREA 3IKCA 2VZOA 4X4YA 3BEWB 2IGFH 2NZ9C 3MA9L 3QIWB 4XAWL 3L3KB 1T5XB 1EBPA 5IT2L 3JZ7A 5FYLD 1I7ZB 3MBEB 1ZOXA 4UB0L 1KEGH 3BSZL 4KMTL 4Z7UB 2H8PB 4M6ML 2I9TA 5C6TL 5FO9B 1YMMB 3GSRB 3UTOA 2EDRA 3IJHB 4LSTL 4PTUA 2LU7A 1QSFB 1FL5B 4TNVK 3LPGA 3NABL 5GSRA 3TJHD 1A7QL 4PBVC 3L3IA 2XWBB 1OM3H 4JVUA 1FLRH 1IGFL 4HW6A 2XG5A 2V5MA 5AYUL 4G8GA 2P43B 4LQFL 4MHHI 1ETZB 1VGKA 4AMKL 4F9LA 3V2AR 4NIKB 5F3BB 1WBYB 1MUJA 1RV6X 2F5AL 4LCYB 4E5XA 2IPKB 2J88L 4S10A 3N1FC 3QQNA 2F53A 4H8WC 3CVHL 3N50A 5LXGL 1BFOA 3L5IA 4PV8A 1MRFL 4QHKJ 2O26U 1DVFC 5ESVA 1CT8A 5C0FA 2AW2A 4GRWE 1J0IA 2NY1D 2OL3L 4HJ0D 1IAOA 3SDDB 1AGEA 4H1LB 4YK4C 2IPKA 4K94H 3U1SL 2X4SB 1GZQA 4ORZC 3C09B 1MQKH 4XBGA 1BM3L 1F42A 5LGHH 4PJCB 4N1CA 5DD3L 4YHPA 4IIQA 4U1KB 1BIIA 4WFHD 3MJ8B 4AG4L 4OZIF 2AV1A 2VISB 4M02A 3QUYD 1BQHG 2X4UA 4PJ9D 5GGVL 2DYPB 3RWDB 1IZKA 4A6YA 3UYPA 3WCYA 3VRLF 1MFNA 1SJEA 1TVHA 2W07A 4IHOB 3LQAC 4G6FB 3L7EB 4PJHB 4WHTA 2HH0L 2HKFH 1KC5L 5TE6H 4QEGA 2VDOL 1U8QB 5CKGA 1TCRA 5IVNA 2VMFA 4DN3H 2X89D 1ND0A 4M6OL 4NT6B 1RZFL 4F33B 1G7QA 2I25N 2IALB 4JRXB 4Y4FA 3DLQR 4ODTH 2ORBH 3AS0A 4HAFA 5HI3D 4Y19D 4YAQA 1Q9OA 5FYKD 2EYRB 4D0BA 1BFOB 3R8BB 3QI9B 2OMNA 1X7QA 2C1PA 3B6SA 3LKSB 4XX1E 4MLIA 4BQ9A 4ZNEA 4IBLT 5A2LH 4GG8B 1J0YA 2R0ZH 3ZTJG 5F3HA 1FBIH 1YJDH 1P1ZA 4NJAH 2VERN 5GGTL 1L6ZA 2PTTA 5FYKL 2V9QA 1ZT1A 3RY6A 3G5YA 4K7PL 1IC7H 2CK0H 3WNOA 5CLTA 1I1AB 4YK4B 2ZPKL 1J1OH 1U92A 4Y4KD 5A3IC 2XN9B 1MLBA 4PREB 5MENB 3QIBC 5CJ8A 1U3YA 1OAZH 2AJUL 5AUMA 1ZSDB 4OT1H 2NY3D 1KLFA 4PJ5A 3V0AC 1H3PH 1DVFB 3A0OA 3S34H 3CC5A 2HRPL 3LN5B 5KVEL 1BBJA 4ETQB 1U95B 4GLRI 2Y9RT 5ITBH 4KVNH 1EVUA 4B41A 4LPYA 2BJMH 5DO2D 4CMMA 4LVEA 1C8PA 1QLRB 3E8UH 3MLWH 4RIRB 5TE7L 4X6EB 4YUEL 3TZVC 4JFOB 3V0WH 3X14A 4I0PA 3L3KA 1MI5D 5DRWA 5JOPD 3CK0H 4PJAF 4TSCL 1VADB 4TVPE 2EXWD 1I75A 5I1KH 2R9HC 5ID1B 3LKQB 4JFEB 5EU5B 5IJVB 1N8ZB 5D7LD 3HG1B 4QXUH 1R3LA 3G6AB 1WZ1H 1YNKH 2EDXA 2EXYD 2X70A 1Z0MA 4LBEB 4O00A 4XI5D 3VFPA 2EH7H 3KHOA 3MLRH 5JW5B 5ESAA 5C08E 2QR0B 2MKWA 2YPLB 5CSZB 3RVTD 2OYPA 2JB6A 4HK0A 5E4EB 4MSWB 1CFTA 2I26N 4QTIL 1JHTA 3T0WA 4YXLH 3HLAB 4PRID 1MWAL 5KTEH 1SYSA 3O41B 5E1HB 1FVCA 1AIFB 4JVPA 5HGHB 4MJIE 1OLLA 4OFYD 5IHZB 5JW3H 4PLJC 5J12B 4W70A 3OGCA 3D0LA 1D3CA 1NLDH 1KJVB 1C7TA 4QGYA 4YHNB 4UDTA 2A1WH 2MCG1 3PABA 4F37F 2ZWLT 1QSVA 3OB0H 4GXUM 2F74A 2DWEA 4XNYH 3V4UH 3SDDA 2BHUA 1F4YL 4NRZB 3VXSE 3HE7C 4H5SA 4OQTH 3PGFH 1MPAH 5D7KE 2GJZB 4FFZH 4NKOA 3ZT7A 1A4JA 3FT2B 4P2OB 4U6XA 4M43L 4CBPA 2UUDK 3AREC 1JYNA 4HFUH 4XP4H 1A4KB 1YN6A 2EDFA 1P7HL 2GJ6A 4LHJB 1GGCL 1NC4D 2D7TH 5DMIL 4JFZL 5B38G 4IMKC 2E7MA 5LVEA 5EO1A 5F9JB 4PRBA 4XCYB 3DURB 5FUZL 3R8QA 1KPRB 3MNZB 5SWZA 5AD0A 3ARWA 3VW3H 4L29A 2G9HA 5C9JB 2WP3T 1BLNB 3L7FA 2DQUL 4N0FA 3FQWA 2FO1A 4NNYB 5KG9B 4V3EB 1S9XA 3PP3K 2V9TA 3ZKSD 4ZFGL 1HCFX 3Q1SH 3RAJH 4JPWH 3EYFB 4ZFOB 4WWID 1QFOA 3SY0A 4RAVB 3FL7A 3D1MC 2Y5EA 2VLRD 3RX7A 1EFXD 1CICC 3TVMB 1TTUA 5EN2A 5FYKE 3VFUB 1QFUH 5A16A 3ARGB 4QGTA 1AR2A 4JHZA 3U7AA 1JGUL 1EIBA 3EO9H 4WUUD 3RIFK 2R23A 1BOGA 3T04D 5JUEL 1ORSB 3ZSSA 2R2BB 3FFCE 1RJYB 1C5CL 4AIZB 2JJUA 3DRTA 4PJBF 5IEHB 1YQVL 1HSBA 1LO2H 1ZWIA 2GJJA 4R3SB 4LCIL 3UEZA 1ZLUH 4QXGL 3VRJB 5EOCH 2CDFB 1KLGA 3CGTA 5IB5A 3GB7A 1QZ1A 1HIML 3EUUA 4C56D 4ZAKA 3UTSE 4PJXE 3SKJL 3PXJA 4ONGL 5CD3B 4NP4L 2O61B 2A9NH 3DROB 3HFMH 3P30L 3I75B 1YPZB 5TFSH 2ZCHH 1XGTB 3IXAB 3ZLQC 5HVFB 1T66D 3M8OH 4KHXH 3B9KB 4C59B 3RL2A 4JO3H 1YDPB 3WO3B 4LHUD 5B3NA 1L0XA 2Z35A 3QI9D 4O58L 1QSEA 3U2SB 1OP5K 5CSGA 1IC4H 4PP2B 5I2IB 3O2VL 1Q72L 4JFQB 4LLUA 4MZ3A 3WUWA 4NM8H 4JRXD 5HDLA 1YN7A 3DO3A 2OP4H 3SCMD 2YBRB 4WEBL 3G6JB 2F19L 2Q8BH 1M7DB 4DUVA 1GL4B 1YY9D 1P4LB 4JEGB 4HGWA 3X3FL 2PYED 2YD6A 1Q0XH 4JE4B 3TYGH 3V52H 1YN6B 5TH2A 4HPOL 3WSQL 1XF1A 4Q9QL 4UTBH 2PTVA 2B8OT 2DKSA 2QEJA 1ZWIB 4N0UE 3ZE1E 1XIWA 4QOKB 5T1MA 5BQ7A 5GZOC 4U1NB 1ADQA 3MJGX 2P8LB 4YFDB 4EI5A 1DL7H 4OQTL 3ARFA 2I60H 4R6UA 4RAUB 1S9VA 4XP5H 3BZFB 3EFDL 3RTQC 3OSKA 4PJXB 1U93A 1WBZB 5KN5B 2DIBA 3RY6C 2ZUTA 1E6OL 1JNLH 2DQCH 1N5AA 3PJSA 4J4PA 5C2BH 3L7FB 4G42B 1UA6L 2R1WA 1GXEA 5DHVA 3RL1B 1K3IA 4L8DB 4LEOB 2AS5M 1ITCA 2FHBA 3TPUB 5JW4M 4Y88A 3BAEH 2SEBB 4JKPL 4AIXA 3I9GH 3ESVF 3IFPB 3UJIL 3MNWA 5C92A 1GHFL 1CFQA 1IAIH 5D71L 4YR6B 4ZXBD 2QADC 1EZVX 2YBRA 2X4RA 1A6PA 2VLRE 4CVWA 1LO4H 1JPTH 2J7LA 3B5GA 1RU9L 2JE8A 1FGNH 4WU7A 5EC2B 1OAKH 4G9DA 5I75C 1TMCA 2AK1L 3D9AL 4BQBA 2DQTH 1GIGL 5C6WH 1RIHL 2ICWB 2VZVA 5EULV 1N8ZA 2VL5A 3L3GA 3LKRA 1QUNA 2FDBP 4OLZH 3L3JA 2VR9A 3O45B 5HYIA 1EMTL 3HNVH 2CDGB 2NY0B 4HS3B 4V2BA 2CLZB 2UWEF 3RTQD 4UUJA 3PHQB 2PUQT 4I0CC 2UZIL 3PQYB 3QDMA 3UTTB 5T5NF 2ADFL 4JPVL 3NPSB 3L3OA 3MRGA 1DVFA 4QOKD 5EBMA 4Y19E 2E8YA 4KI5C 1BZ9A 1FVCB 4XP1H 3TM6A 3DMMB 3BEVB 4R3SA 2XRAH 5LGJB 4AENA 5LCVL 4MNGE 2WV3A 5C07D 5FECA 2C5DC 3OPZH 1P5VA 4NQDE 3IFNH 2BVYA 3KPNA 4XCNA 1X5ZA 2D9CA 5I30H 2XWTB 5JMRA 2DJUA 5T1DH 4DWHA 3QRFM 3N85L 1DQLL 2GJZA 3LMJL 4J6RL 1BQUA 1K2DB 4PJCE 5I1IH 4Y2DB 3KLAA 4FFYL 5HGGS 5KVDL 1U2CA 2HLAB 1YYML 3LH2H 1T0PB 1JNHA 3LKQA 3K81A 3VG9B 4R90L 1ZGLB 2R0WL 4YHIA 1JHKL 3QO0A 4PJ7B 4MJ6A 1VACB 3MYZA 4P59L 5JHDB 1KC5H 4PP8C 1BBJB 2AKRA 5AZEH 3L7EA 1ZT7B 3KYNA 3HPJA 3CFIC 1IAII 1B4JL 3D85B 3LV3B 2P48B 3C5SA 5D96B 3WL9A 1MJ8L 2VITA 1ZHKB 1YEFH 2GQHA 5J1AA 5IB2A 3T3MF 3TLRA 1FV1B 4XXDB 3RHWF 2X4UB 3WNKA 5IQ7L 3DECA 4FFVC 4CVZA 2Y06L 4KUZH 4ZXBC 5DD6B 1NUGA 3Q0HA 5IBTH 1EEZA 3BE1H 2WQ8A 3DYMA 3HI6H 2Y6SC 2BRRH 1CD1A 2C7UB 5KZCB 4CMHB 1Z9MA 4DGVL 2HLFC 1NBZA 5IBUG 1E4JA 2F53B 3KPSD 2Z8RA 5C0RL 5INDB 4QWWC 4ELMA 1EERB 4ZUSB 1B0GB 3SE9L 5CIPB 3BZEA 3HC3H 4X8XA 4YXHL 1AP2A 4X5WA 4X80H 1RMFL 3HC0A 2W9EL 2IBGA 3QIUA 1EPFA 1K6QL 2IPUG 1AO7D 1IGTB 4OCRL 4Q0XL 4N8VB 5CJOL 4OV5A 3S98A 1I9IL 1A7QH 3MLZL 1RIUH 2ESVE 1DZBA 4IIQB 4KRPD 4U1KA 2X41A 2BY3A 2GUOA 1CZ8H 1EAJA 3OR7A 1KIRA 3WL9B 1DQLH 4O2EB 4E9LA 3GSNH 1C1EL 4MMZC 4M5YH 1QSEE 3F6LA 3MV8E 3ME0A 1J05A 4K7FA 4DKFH 3WHXB 1RUKH 1LEKA 4U2ZA 4WI4A 4GUPB 5MP6L 4JREB 1CI5A 3TBWA 2H6PA 4LFHG 3ZT6A 1HKLH 1J0HA 2PTUA 2XA8H 4X6EA 3MLSH 4PGBA 3GI8L 3TIDA 3K4ZA 3WHE0 1YECL 3MJ9L 5F7KC 1I3GH 5K9KB 3ZDXE 2N7AA 1GPOL 4FZ8L 3QWRA 4H20H 3PL6A 5BRZA 5C0RH 5FA4A 3KPPB 4LSPL 3TT3L 4MHHG 2CKBL 1CTOA 3WIIL 5MEQB 2ZG1A 3DARA 2JK5A 4NDMA 3T08A 3ULUH 2X42A 5DJXB 4MA3A 5GGTA 3QEGL 2R4RL 3HE6D 2AJSL 1U6AL 3TBVA 3IFPA 1Q1JL 1X5GA 1Z9OA 3O11B 2OX5A 3FB7A 1FGNL 5IMKA 4KI1A 3IDXL 4XHJC 3RWIB 5IMMA 1KOAA 4XNXH 3MOAH 4X7DC 5DYOB 4Y1AE 3FFCB 3PGCB 4JPKH 4WHCA 1S7QA 1BZ7B 2DLTA 2VLJE 5JLZA 4JPIA 1CT8B 4XP9L 1J8KA 1YMMA 3GSRA 4UNUA 3QO0B 1ZGLM 4EUPA 5FO8B 3TJHC 4JFYA 4OF6A 3WS6C 2AV7B 2OTWA 4WO4A 1X5XA 3CX5J 5J6GB 1U8JA 4NGHH 1NCAL 5FCSH 1QYGH 1MI5A 4LFHD 5DDHA 5H35A 1K8IA 5B8CC 4JHAL 1VPOH 1JJUA 1XEDA 2MWCA 4Y5VB 4JFFA 1LQVA 1NAMA 4X6CB 3ARPA 4M1CC 4OGAD 4DFHA 5DC4B 4AT6A 1TCMA 5GGVY 1LE5A 5T1MB 1X5JA 1N5YL 4P9HL 2NY3C 3HNTH 2AK4D 1MCFA 1GAFL 3WKMH 3NCEB 4GKNA 1F6AA 1CF8H 1JI1A 4JGUA 4N0RA 1CFBA 5C0CB 4WI2A 5IB2B 2ARJA 2J6EH 2X4TA 5HTSA 1VFOA 5I1AB 4X6CF 1MCHA 1ZHBB 5ETUA 4MD5B 2R2EB 3Q2CA 4AYFA 5ISZB 1HEZB 1UJ3C 3CFKB 3OZ9L 5I8OL 4NGHL 3LD8B 2EO1A 5I1CL 2A83A 3QXDA 4ZOEA 4P3WA 3O6FC 4HKZB 5F7LB 43C9A 4I3SL 3IXTB 4FQCL 3RPKA 7FABH 4RGOL 1IEBA 3LEVL 4CU6A 4NC2B 2EIBA 2WUCH 1IEAA 3QO1B 4KJPD 3SDCB 3VFOA 1RK0B 2X4NA 4GMSH 4PGEA 2CLRA 4PGCA 1KYOJ 3D87B 3EGSB 3MLUL 3HCVB 1BX2B 1BEYH 2VN4A 4HV8B 3MR9A 1AGBB 2MNUA 4U49A 1YA5A 2ED7A 4BZ2H 4DQOL 3MRJB 5B39B 2P8MB 1YUHB 2C3HA 4A6YH 2ZOLA 3GMPA 3MODH 2X4RB 4JO3L 5FYJL 5JIHA 1C5CH 1UB5A 4D94A 4OCXH 3HAEA 4H8WH 3ZDYF 1OPGH 4KKLC 4KVCL 1L9NA 5H94A 5KSBF 4JCMA 3C60C 1I3GL 2IPUK 3TJEL 2VLLB 3FO1B 4L3ED 2P45B 1MF2L 2YSSA 3TA3B 4YHML 3G6JF 1NSNL 3R06A 1WBXB 3KLDA 3VXUB 1I8LA 2DM4A 3NACH 2P8MA 3JWDL 1T3FB 1EFXA 3UTTA 4N5EA 5DS8A 3DX9A 1ZE3C 5F89B 3VRLE 3PWVA 3S5LA 3SGDH 2CLZA 5GISH 3RHWK 1S7UB 4TUKH 4EDXB 4YQXH 1MVFA 4ZUTA 3JWOL 4BH8B 1XR9B 3FB6A 1U0QA 4M7JH 2AERT 2ZUUA 2FD6H 3RZCD 4WWKB 4Z77B 4PRHD 3MRIB 5E8EB 4XCCH 3RVXD 2Y7QB 4MQXC 2X1OA 1T2XA 3QCUL 1S9VB 3GHBH 4NN7B 1T7WA 2DIAA 4HJJL 4OCYH 4ZYKA 4G9DB 2VDQH 3KYOA 2P8LA 4WU5B 1NLBH 3CSPA 5F1SA 5L8JB 4X0KA 1WCBA 2X9WA 1HHHA 2AGJL 4Z95H 4YXKH 5HDBE 4BSWA 3FQTA 5D5MA 1A3RL 4OSUH 3GRWL 4C4KO 4Q9RL 4S1SH 4WFGD 4YWGH 3I3EA 5FCUH 3U79A 5BS0E 4U6HB 3VWKA 4NUJB 1EXUA 4KAQH 2YR3A 3P4MB 1VA9A 5D7IB 1PFCA 3GEWB 3U0PB 1OW0A 2CLVB 3TVMD 4L9LB 2GYSA 3UC0H 3QUKA 3QB7C 4LEOA 1BD2B 4EZMA 3G9VA 4KROD 1EVTC 4TQEH 3WN5C 3RVUD 4WV1B 4OIIH 3THML 1JI2A 5HHPB 4XNYL 3S3JA 3VI4E 1NLBL 2JIXB 3I6KA 1V3JA 2DQGH 2QQNH 2P24B 5A2FA 3ARFC 4L4JA 4S0UC 4LL9A 4TNVF 3V0VB 4MZ2A 5F7HA 4XMKL 3P9LB 3LS4H 3UCRA 3MV9D 1FVDA 4ENEC 1IEBB 1G6RA 2D0HA 5D7IA 1SEQL 1YMME 3KPRE 3NCCB 2UV3A 4R4BA 3QQ3B 3W39A 3QT2A 2C4FT 1MJ8H 5CKAA 2BY2A 5C0CA 2Q3ZA 5D2LA 5DQDL 5E8DH 3GKZA 3C5JA 4GW5A 3QJHA 5EB9A 3TN0D 4XCYA 4MJ4A 5C8JB 1AY1H 1ZLVK 5ISZA 1PX3A 1EO8L 4F7MB 4ZFZB 4HGWB 1CXKA 2VSDA 4PJ9C 1ONQB 1FAIL 1SY6H 2FX8L 1BWWA 3H8NA 3UAJC 3KDMA 2ED9A 4NQCA 4TOYL 2VSCA 4LVHB 1UEYA 2A6KB 5JNYA 2EC8A 4JANB 3WDIA 1QEWB 1DEEA 1A6VH 3ILQC 4RAVA 5D7LB 3NACL 4QRRA 1VGEL 4KROC 3IDNB 1U8PB 3MLUH 4MNQE 4RNRA 4XVSH 4QF1B 1GPOH 5IQ9B 4JDVA 3E2HA 1U58B 4WV1C 1UB6A 3Q1SL 1MFDH 4PRIB 15C8H 4GW1A 1TENA 1N59B 4P2CG 3G6DH 4U4BA 2ADIB 4LNRA 3RWIA 4RQQB 4O2EA 4MXVF 1KELL 4ZPTA 4Y2OA 5IHUL 1HSBB 3QDJB 5I17B 3FQTB 5CBEB 4WI3A 3RVWD 3WV0A 3DWTA 2QR0A 5CSZA 1BPVA 2FJHB 5HI4C 1ZT1B 3S97C 4FABL 4JGJA 5D2NC 2UZYB 3VFPB 2A77H 3DX7A 4Y5VA 2X7LB 4G8FB 4LLVB 2R23B 4JFFE 2XOTA 3LN4B 1MI5B 5DDHB 1N4XL 4PGBB 4YE4H 4LOUC 4JN1H 4JG0L 2F58H 3SDCA 3HPLB 4HF5H 1MFDL 4DZ8A 2CH8A 3TCLB 4EDXA 3ROOA 5C09E 5DFWH 3EJJX 1LEKB 1ITBB 1VPOL 3BP7B 3BIBX 4PLNC 3DXAA 3T1WA 1T66C 3KYMB 3BGMA 3T09A 1VGEH 1TNMA 4IOSD 1MREL 3FB7B 1MCBA 3TWCH 3STZB 1A6VL 5DUML 1QBLL 2D7PA 3MUHL 4I5BA 5DQDH 3RBGA 3GSUB 5CP7B 1GGYA 1T1YA 1A14L 3GBNH 4HXAL 4I4WA 2VB5A 2LU4A 1T4KB 2KQNA 4RMVA 3S9DB 1OGAB 2FCBA 1T2JA 4JN2B 4GH7B 1U92B 3EYSH 1SJHA 4OLYL 4XCFH 1G9ML 4KUZL 4OCLC 2R0KL 2DQGL 2C3GA 5C07E 5GRXG 4N8VA 4TRPL 3GSXB 4L5FL 2A6DB 3ERYA 2V7NA 5KSBE 1S7RA 4Z7VF 4XP9H 4NFBA 5DK2B 4XP5L 4WW1B 2UVFA 1FRGH 1U8IA 1YZZA 1VEMA 3DBXA 4ZUUA 5EBGA 3T2QA 1QRNA 4GAJL 3ZTNL 4UDUB 3VGFA 3IU4H 4HIHB 1SYVB 5B21A 3RU8L 3QDGA 1AXTL 3JTTB 4JVWA 4JQXC 5GRYA 3HAEG 5FCUL 2A6DA 3FN0L 1OVZA 2VLJB 2GK2A 4HMCA 5L2KA 4LSUL 3GRWH 1I9JH 4WWKC 3CX2A 1R3KB 1FL3B 3CUPB 5D4QA 4RFEB 1IZJA 1ETZA 1SBSL 1J11A 3H2WA 1N64L 3E0GA 2DBJA 3UC0L 4HJJH 2RQ8A 4PRPD 3SO5A 1ZHKA 1P9MC 4PREA 4UAOB 4Z6AT 4I4WB 1DANT 2HWZL 1DBJH 4PJIB 1I1AA 2YRLA 5T1DL 2EIZB 3GMMA 1T6VN 3KPSA 3IJHA 3KXFB 5EU6E 4LQFH 1LEIA 1T5WB 1JV5B 1PD6A 2A6JA 2H8PA 2I9TB 5DLMH 1NGPL 1R5VB 4P2RA 4P5TA 2JLLA 4J3UA 1JL8A 4K07A 2CO6B 4UUJB 4OV6F 5DJ2A 4DKFL 5C7XH 1UWEH 2PO6D 4JO4H 1CU4H 1U8IB 3O45A 2O5YL 2PW2A 4ZUUB 4B7IA 5C70A 4CGTA 5SX5K 4XCCL 2GFBB 1FFOB 1KEML 3FFCA 3NAAH 1A1MA 3JV0A 4JKWA 1H3XA 4BFIB 4H8WL 1KEGL 2VLKE 1BF8A 2XPGA 2RIKA 3CX5K 4OD3H 5T1LD 4JFDB 3QUZA 3LN5A 3WDJA 4KRNA 4E0RA 4P49A 2XKUA 2FZ3B 2GAZB 1G1CA 3LKOB 2JKXA 3U9UB 1SHMA 2XWTA 3MRCA 3UZEA 4HWBA 2DQFA 5FGBA 2Q8AL 4PTTA 3B9KC 2QQQA 3CLEL 1T1YB 4BA8A 4NJ9L 4Y4HD 1OP3H 3IETB 3CUPA 5C0BA 1AY1L 4YHKH 3IDIB 3MRPB 2XKNA 3G5VA 3O6MH 4XBGB 3VMOA 2PYEE 4N5UA 5BMFH 3WIHL 2VQUA 1U8NA 4ZNCD 4BFIA 3BKMH 4Z7UA 5DVMA 3LPFA 5EUOF 3IT8D 1DN0B 5H37G 3QCTL 3MBXL 2F54B 4HIJA 5EU6B 1KT2A 4WDIB 5L2JB 5C0CE 4OZHA 1SEBB 3M1BA 1GC1C 3CSBA 3LKNB 1SY6A 5D7LA 1T20A 2NZIA 2ICEA 1FSKB 3NH7H 3E3QA 4ZS7L 3TH4T 1NGYB 3SPVB 1FG2A 5DO2C 3U46A 4G6MH 4P5KB 3AVEA 5I8KH 1F58L 4G5ZH 2JJSC 1U8HA 3IKKA 4NO0A 2WINB 2VE6A 1U91A 2X4QA 5KAQF 1HINL 2LTQC 3HZVB 4KK5D 3G5XB 1I3VA 2KUTA 4ZSOA 4LKXB 3JTSA 4AMKH 1FFNA 4KY1H 4PJDA 4QRRE 4L8DA 4JY5H 1I1YA 4OD1L 4LVNB 2VAAA 4G43A 3UTSB 5EZIH 4F7TA 1R3HB 4HF5L 3VWJB 5I1IL 5SWSA 4O9HH 1IAMA 1HCVA 1SYVA 4O51B 2BNRE 2DMBA 4QRUB 5D7IE 4OD2B 2OP4L 2IQAA 5DR5L 1K85A 4TSBH 4MYWB 4S1RL 4KJPC 3AREB 1WBZA 1YC8A 4R0LC 4FFVD 2NY7H 4UZGA 4LCUB 4Y4KA 1KB5L 4M61A 2AEWA 5TFSL 5ACMA 2CSPA 1J1PL 1M1SA 4NQCE 1B9ZA 4TUOB 1OD7A 3FONA 1RUPL 2ZUQC 5D1ZC 5E6IA 3VXMA 3ULVE 3U4BL 1RVFH 1I8IB 5KS9B 4PJ7A 1ROWA 4M9PA 5MP6H 3TYFB 4PJEF 2GK0B 2EYTA 3QWOB 3BPNB 4XHQA 5A16B 3PHSA 2BJML 3FJTA 1JWUB 4KVNL 2DLIA 1I1AC 2MTPA 1YPZA 3BDYH 3GSVB 2H2PC 5DSCB 3KPLB 4XVJH 3O4LA 1U8KA 1JTOA 5E9DE 3LDBB 1IAKB 3CFJB 3V4VL 3F58L 4KXZH 4ZFOL 4KROB 3GNML 4NO3A 1BD2E 2EDBA 4L9LA 4HG4K 3VRJA 4C55A 3I9GL 4JAMB 4HX1B 4ERSL 2J8UB 3MRBA 1WGOA 2YD5A 1W0WB 2AEQH 2FB4L 3BAEL 4LU5L 1I85C 1UVQB 1E4XL 1WITA 5BOZG 3DURA 5HHOA 2VZ3A 1UM4H 4R8WL 5KSAD 2H32A 3WNMA 4UINL 2XQYK 4MQXD 1QHOA 1R24B 1JPGA 1BECA 5E03A 3BDXA 3D69B 3PWPE 4Q6IC 3VH8A 1NANI 4NHCH 1EH9A 3EJZD 3QH3A 4BZYA 1I1AD 3BPOB 1MJJA 3Q5OA 4XNUL 2VLKD 4F57L 1T2QL 3BYYA 5HHVL 3TH3T 5GGSB 2VZ1A 1S7UA 4PRHB 1AHWB 5B39G 3MXVH 4S1DD 1YNTB 3DX9B 4PJAA 3I85A 3SKMA 3KGRA 1TJGH 5D1XA 1A47A 5C0IA 5L9DL 1MPAL 4PJ8A 3MRKB 1YEKH 3FQWB 3O8XD 2RAMA 1OOAA 3KLSA 3TT1H 2YXMA 1Z5LA 3WYRA 1A3RH 4G6ML 2LTQB 1WTLA 3IU3B 3PV7A 5GIRB 2UYLB 1H3UA 5IIEA 4L9LC 2SEBA 3G5XA 4LPCA 3PHOA 5J11C 2ZKHL 4GW5B 1ZA3A 3HB3C 5D5MB 4J2XA 5E94B 1MWAB 3MGTA 4I18A 4P0DA 4G6FD 4JDTL 3RKDD 1KCLA 1DLHB 4M8QA 4KJWC 3SKNB 1T03H 4PB0L 5E8EA 3QUYB 1I3RB 3OX8B 4U7MA 3D39A 2CRIA 2DN7A 1CDBA 3CZJA 3PABB 3MLRL 1CU4L 4PJGB 4P99A 2JIXA 4ZOCA 3LKNA 2OMBA 3OAUL 1WZ1L 3OR6A 2O5XL 3ILQD 2VR5A 3HUJE 3MNZA 5AD0B 5GZOD 2HTLD 3FKUS 2EEAA 4HUXB 6FABH 1OM3L 1JVKA 5ICYA 2A83B 4OCXL 3VXSB 3HZYB 4PRNB 1QHPA 4YE4L 5IMKB 1Y18A 3MRPA 3GSNL 2E7BA 5GZNC 2J8UF 4LNVA 4L4VD 1MHPL 5FUZH 1G6VK 3MUGB 2HG5B 1YEEH 4KI5E 5TDNA 5EA0H 1E27B 3G08A 3T0DA 4NKMA 4YDJA 2XQBL 3V6BR 3CNKA 1JGLL 4YC2C 4K7PY 1QFHA 1HQ4A 4X6CE 2IGFL 3MA9H 4RGOH 4H88L 1ZT4A 4AM0A 4HBQA 2W9EH 1EFQA 2V2XA 2CXGA 3Q6GL 5GS0D 5FKPB 4YDKL 4P2QB 2YWZA 3BUYB 1LO4L 3QI9A 5FYKH 1MY7A 3TBTB 3UPRA 3P77B 4XVSL 3CSGA 4O5LL 4BK4A 4KKCC 2XTJB 2ATPA 1PW3A 4P5TB 1G7LA 2AXGA 5SWQB 4L8BB 4HUMB 3QNZA 4JY4A 3GB7B 1P7QB 1J0KA 3JV5A 5K9JH 1CGSH 1J0ZA 5HHOB 3FRPA 1LO3L 4NNXA 2AEPH 4R4FH 5K93A 5IKCA 3JV4A 4UT9H 5GS0H 1N0XL 1VFUA 1XGPA 1PDKA 1ZSDA 4PJ5B 2VKXA 2GW5A 4GRLC 2XWJB 3ULUD 2Q6WA 1FRGL 2HTKC 5CCKL 1KENH 3MYJA 3RVWC 3LSOB 4QNPE 1FL3A 3N9GL 3LQMA 1A6UL 1QG3A 1J18A 4UIMA 3W0WE 2ZUWA 3PIQA 4QY8A 5F3HB 3HCVA 3QUMH 3RZCC 1HH9B 2X1XR 5DF0A 3VDCA 3ARDC 2BMKB 43CAA 4F7EB 2NY4D 4N0FB 1F97A 2CDEA 4MNQD 4R90H 3KXFA 1RSFA 3UTSD 5HGBB 5KBNC 3EZ8A 3U7WL 3G5VB 3C5ZD 5EIVA 4TPRH 4KJQD 5E2UH 5KVDH 3MV9E 3OKOA 4PJDB 4R26L 4MS8C 1F3DJ 1XF4A 4ZNEE 1U8OA 2F19H 4MAYA 2DL9A 4Z7WF 5J0BA 2BC4A 2CKBH 2V2TB 3IF1A 3M45A 2OTUB 2HFFB 3FO9A 5JZ7D 5ITBL 2L0DA 4XGZA 2YPLA 4PJAE 3BW9A 1QR1B 3X12B 1E6JL 1I8KB 4CW1B 3ZHDA 4OIAA 4D0DB 4KAQL 5HDBF 1J87A 1D5IH 3ABZA 4KK8C 2QADD 4K9EC 4HPOH 3WSQH 2AXJA 3X13A 1Q0XL 2ZCLH 5F1OB 4PJ5E 2EZ0D 3FO0H 2XA8L 2WBKA 1T1XA 2HLFD 2ZCHL 2E3VA 2DAVA 2QV2A 4MJ6B 2CRYA 2VIRA 5EA0L 3C08H 1MHHB 4LRNL 2L4OA 3HFML 3P30H 5TQ0H 4ZUSA 4Q2ZB 1NANH 3I02B 5ITFA 5LJYH 4WW2F 4F58H 4WI5A 5HI5D 2XACC 1WBYA 4LLMA 3RZCB 4F80A 3IDIA 1VGKB 3F7QA 2GKIA 4QHMB 4MLSA 3BH9B 5HGAA 2BK8A 1WVZA 1I9IH 5F7MC 1FIGH 1XF2B 1CK0L 4U1GC 3TCXA 2AJYH 1SYSB 4LCYA 5E6IC 1IC7L 2CK0L 3S37L 3ARBA 1YEGH 5KVGL 4Z7VA 1J5OL 5DEGB 1MCEA 5CBEA 1EO8H 1QSFA 5GRVK 5J1SC 4ELKB 3X11A 1IAIL 1GHFH 3L95A 1CFVH 3PQYD 4R7NA 3ZDXF 3ESUF 1MRCH 4GG8A 5A43C 1WEJL 4UAOC 3SDAC 3L3OB 4W4NA 4HKXB 3R0MA 2X4OA 3CCHA 1T7VA 3HMWL 1BD2D 3P11H 4S0TD 4EI6B 1JPFA 1AP2B 1CLYL 2ZSVA 4X5WB 3TBTA 3HI6L 4PBXA 4WI8A 4XCEA 4ELMB 5C2BL 2A2QT 5HHMD 1LE9B 3RWGA 3PWUB 4Q2ZA 2A0LC 2WIIB 4NZUL 1CLOH 2B0SL 1ADQL 3WE6A 4HJGA 1G0YR 2YPLD 2GY7B 1I9RL 2BNQE 5BCAA 2D7TL 5LWYL 2APTA 4HHAB 3WFDH 5E2VL 4LP4A 1HHIB 2JIXD 5D9SB 1LHZA 5HPMA 1ZA6A 3CVHB 5CJBA 1P7KB 1LWRA 4E0RB 1W72L 5JW4Q 4Q9QH 3B2UD 1XCTA 2KPNA 3TBYB 4DJMA 3RA7H 3R1GH 1JZ7A 1DBKH 4PTUB 5GGRA 4WI6A 3NMEA 1OCWH 5AZ2H 4OKVB 3KYMA 1V3LA 1G7HB 3QNXA 4WRLA 4NFCA 2P5WD 3SQBA 4OF7A 4OB5L 3D6GA 4HWNA 1UH2A 1XAUA 3GIVA 1WC7A 1J1XH 1XGUA 1KJ3H 2H26B 2GCYA 5K9OB 2X9YA 1FYTA 2FYYA 5FFLA 2V2XB 1KJMB 4NQCB 4NRYB 3SE4C 3FAXA 3U9PH 4UB0H 1ZHLB 4J3SA 1TMCB 3DVFA 3BXNA 1EEZB 4OLUL 5IG7B 3G08B 1INEH 2Z4QB 4CVXA 4BKLA 2HKHL 4GO6B 4J3OC 5DA0B 5DD6A 5FGCE 3MUGA 3PV6B 2YKLL 3MLVL 2VNCA 1FNEA 1M6OB 4OF0A 2K7PA 3V79C 2VJXA 2XWBA 1JYVA 5EOCJ 5KW9L 1YYLH 1L0YA 3TN0C 5J3HD 2NCMA 3MNWB 4JO2H 3VWKB 3PXHA 4OQTA 2NY6C 1TVBA 2MJWA 1UB6B 3BWUC 3O2DL 5C09B 5HY9B 2AJSH 4MS8D 2Y4SA 3MGOB 4M48H 4NQEE 1IM9B 3HS0A 4XWOC 4F9PC 3WFHA 1G7LB 1EDQA 1U3HC 4NFDA 4H1LH 1GCFA 3MUJA 4PP2A 1RUPH 1HKFA 3BP6B 43CAB 4APQD 3DI3B 3DNKA 2HYMA 3UJTH 5MHSE 2MKLC 4MQTB 4OGAC 4GRWH 1UM6H 3ZE1F 1NCWH 2VUOA 3KDMB 2HLAA 3T77A 5CUSH 4P46A 3ARDA 4J3XA 2XZQL 4LSSL 2EDQA 1CS6A 3MMEB 3OKNA 3SQOH 4M7LL 3IFOA 3STBA 2HTKD 3FQUB 3MYJB 2VWEC 1FG9C 1IFHH 5EZOH 3VI4F 4IRSC 1KACB 1KPVB 1HNGA 3R06B 5L7XL 4LAQL 3SCMC 5GRJH 3U83A 1A9BB 3LKPB 1Z3GL 1DTUA 4OTXL 5KSAB 2FBOJ 2HFEB 4PLOB 1H3PL 1EEYB 1I7TA 5GS3A 35C8H 4F2MB 3T8XA 4GAFB 1U58A 4WI9A 1UQSA 1EGJL 4NQED 1WZLA 1Z9LA 3IJYB 2CMRL 2ZJSL 4JRYD 3VXMD 1KPUB 5EU3B 1YQ2A 5BOPA 2OJZL 1JNJA 3ARQA 4XWGL 1QSEB 3OV6A 4LF3A 5KVFL 1HH6A 1HSAB 4R4ND 1HQ4B 4M4PA 5DJ6A 1UXWA 4M8QB 2B39A 2AVGA 1D5MB 3O3BB 3B4NA 3LQAL 1GSMA 3IXTA 1A7NH 2GT9B 4FQ1L 1V5JA 4NWUH 1IQWH 3QXDB 1A9EA 4XH2A 3HAEB 3GSQA 5D6DC 2D2OA 1MAKA 5D1ZB 1QLFB 4U3HA 5KANG 4JHAH 1KG0A 1PQZB 2P7TA 5T3XD 2MQ3A 3DVIA 2GJ6B 2Y06H 5EZJA 4NO2B 3QEGH 3O2VH 4L8CA 1AKJA 2AJ3B 2OR9H 2LFGA 5FYLL 1V7MH 2AQ1A 3MTRA 4Y4KC 2V5RA 4P9MH 3V0VA 1TPXB 1LE5B 1RZKL 1FVEA 4XMPL 5EU4B 5BMFL 3P9MB 1MEXL 1OAUH 5I18H 5EU7E 2P24A 1X4XA 3OF6A 2H3NA 3EOBA 5I1KL 3JTCA 2A9NL 3MV9A 2E9WA 5HVHC 4P59H 2LABA 1XF5B 1HQRA 3BIAX 5ABDE 3NA9H 4JFYB 4JM2A 8CGTA 2H1PL 3BISA 4PS4L 3V5KB 3ZHKA 1Q9LA 2R0WH 4NQSB 3BZFA 3S35H 1LP9E 2DQIL 3SDCC 3VCLA 4M93C 3VFNB 4PY7B 2ZSWB 1WICA 3UTSA 4L8CB 2YK1H 5EU7C 2YPLE 5IR1A 3L9RB 2CRMA 3UYRH 3VWJD 3O8XA 4W81A 3VD7A 1XMWA 1CLZH 4MJ5B 5AWNH 4FZ8H 4Y5YB 2UWEA 3QFJA 5C08D 1Q8MA 5IUSA 4I18C 3EO9L 4XP6H 2XA3A 1CZ8L 1IKFH 3T4AB 1UXSB 3P4LA 1OAZL 2AJUH 1OGAE 1P2CA 5BZWB 5CJXA 5ESQA 1HXYA 4M5ZH 2R2BA 5CEYA 3QWQB 4JFED 1A4KA 4LPUA 4PY7A 1XIWD 4HV8A 3BT2H 3KPMB 2APBA 4JM2B 1VFMA 1NGYA 3SPVA 2CIIB 3FCTA 4AIOA 3ELAT 3PL6D 4IM8A 5CEXB 2FR4A 4AEIL 3ARFD 2OCFD 1PEWA 8FABA 3GMOA 2JB5L 1JZ6A 1MCRA 4UQ2A 3V6ZA 3OKDB 3E2HC 5HPOA 1WC7B 3GJFH 4QKXB 3NIGE 2E6PA 4EN3C 4OZIB 5I8CB 4NQVA 4HC1L 1S9XB 3QJFA 2QQLH 5DXWA 3OKLB 5GSVB 4B5EA 3MLZH 4OGZA 4KI5F 1CIUA 1MCWM 3QUXB 4ETQA 3PDOA 4OCRH 3TBYA 4DGIH 4S2SB 2YOCA 5I8EA 4BFBD 3FT3B 1LO5A 5EDXA 1GIGH 1VCAA 1LP9B 3VMNA 1RU9H 3QEHA 4WHYH 2EIDA 2W0FA 4KU1A 4HUUB 4QRPD 2H2SC 2R15A 1I3UA 4PLKD 1NEZG 1UT9A 5E0QA 4XAKE 1AD9B 4X7SL 5JXEA 3FT4A 3DV6B 5HVWA 1NBQA 3MV01 4OCSH 4Z7UF 4NZRH 4F9PA 3VE0A 3MLTB 4HWBL 3QA3B 1UACL 4EVNB 2WP3O 3LAFA 4WO4B 1GGIL 3K2UL 1M7XA 3HC0B 3H9SB 4XCFL 4Z7WA 2ZCKH 2OSLB 4L4VB 2B2XL 1S7TB 2Q86A 5F89A 3VFWB 2WSKA 4MDJA 3TN0A 5JPMB 3ES6A 4NN5B 1N26A 1ZHNB 4O2FA 2K9UA 5H2BA 2N56A 2WZPD 5F6IB 5I71B 4QTIH 3DMMD 1RJCA 2DTMH 3DX6B 3VXNB 2VLKB 2EDEA 5FOBA 5F9DC 5ENWA 1KXTB 1F8TL 3KXFD 1JGDB 4PRBB 4CVZB 1WLHA 1MFBH 5MEQA 2WWKT 2MPAL 2GITA 1JHKH 1AGFA 2GAZA 3D0VB 1NUNB 3WIHA 1FLRL 2XICA 3E1F1 5DC9B 3SBWA 5I1DB 1D5ZA 1JRHH 2VITB 3E6HA 1KCKA 4FP8H 3A6CH 4DEPC 3QDGB 1KJMA 1FNGA 1VADA 2MQ0A 3K0WA 3N85H 4K23L 1UG9A 3CH8A 2FO4A 1PSKL 2HT3C 1KSRA 5DJ2B 3O2WL 2HJKA 3VFGL 5I1LB 1MFCL 4ACPA 4K8RD 2AQ2A 1IC4L 1RJZB 5KJRH 2DWDA 2IBZY 1CLCA 5C0GB 3DGCR 3L6FB 3RDTB 3REVA 5D1XC 3IDGA 5F1KC 4MA8H 3PP4L 3EYUH 4RGNC 4D9LH 1J1OL 1R6VA 4LHUA 1LDPL 3V6OE 5BRZE 1BQSA 3PWPB 2W9DL 2VXQL 3O0RL 2UZIH 4FRWA 2EC9U 5DVLA 5JDJA 4S1DC 2DYPD 1L9MA 2CMRH 2ZJSH 2AV1B 3MRCB 5B3JE 2PXYA 1T22A 2JCCF 2BCKB 5BS0D 4C57C 35C8L 4AZ8A 3SGKA 3U48A 3QIUB 2VDPH 1O7VA 1VACA 5FGCB 4PJHE 5GXBB 3BO8B 3IDGB 2ORBL 1F3JA 1OAKL 4J7RA 5EUOB 2FX8H 2VLMD 1DBMH 4IEFB 1K3ZA 1A6TA 2C1OB 1I1CA 1EA9C 3SDDD 3RUGE 2PW2B 3KLAB 2CIKA 4WUUB 4LGRB 1EAPA 1UWGH 1HHJB 3Q6FB 5I75B 1AQDA 5E00A 4RX4D 4JKPH 4X6DA 1MRDH 1Q9KA 4HT1H 5I0ZA 5E2TH 1I8KA 1S5HA 3BMWA 3JV4B 3CFCH 5E2WH 5C0BB 3VMPA 3TBVB 3ARRA 5AAWA 2HFFA 2B5IC 3FO9B 3SGKC 3IVKA 4CN4A 3OXRA 1RFDH 1MQKL 1OSPL 5I76A 2BHYA 2NY2B 4LARH 1HHIA 3D25B 2D4DA 3IS0X 5EBMB 1FZMB 1ZVYA 4O02H 3EDEA 4RBPK 3KPPA 4POYA 3O3EA 4GSDL 4G80A 4K3JH 2GSIB 3GBLA 2LU3A 1JHLH 5GGUB 4ZTPH 4ZD3H 3DXAB 2Y72A 3L1OL 1I8MB 1U3ZA 1FFOA 4RMUA 5IWLA 3B9EA 2DDQH 5GGSY 3PNWB 1Q72H 5E56A 3TGXA 1CD1B 4M6NL 2ZSVB 1AXIB 5BVPH 3OAYH 4YAQB 1MFEH 4D9RE 1KCVH 3O3EB 2RBLA 4DVRL 4Y16B 5IW6A 5JOFA 5CGMA 2Q8BL 4DGYH 4YXKL 3GJEB 5DVNA 4MWFB 4ZS6D 4EOWH 5ANMA 3GDBA 4NP4H 2VXSH 1RUML 4HXBL 4KRPC 3ZE0E 2R4SL 4HQQH 4CU8A 3MLXL 4MNQB 3DSFL 4MCYB 3ZHLA 5JW3L 1MFAH 2HT4C 5F71A 2Z8SA 3KYAA 2R8SL 5A3ID 3KWWA 2P5EB 4YO0A 4NQUA 2I24N 5D2NA 3U4EA 4HD9A 3MRDA 5GISL 4PRIA 3M8OL 4KHXL 2EO9A 4LARL 2H41A 5HDQH 4X98A 5MHSD 3UPRB 2CJUL 3ET9F 1HQRB 5CEZL 2K7QA 2GSGA 4Z0XB 3MA7A 1IGML 3BO8A 3Q48A 5ESVB 3I6LE 3H9SA 3RIAF 5HHPA 1K5NA 2DLGA 2EDDA 4EKXA 4BH7B 4WENB 5HI3C 4OI7A 4YDJB 5DEZA 5EO9B 5FYJH 1NCCL 5M94B 2FJFA 5FYJE 3DUUB 3RWHB 4KV5E 3SCMA 4FQQB 3MRHA 4DQOH 1PY4A 4P5TD 3C60B 3RWEB 3BVNB 3QZWB 1LO0L 4F15C 1P2CB 5BZWA 2IQ9H 4PJ8C 5D1QB 3DXAD 4R7DA 4YHZL 2B4CH 2IAMB 1BGXH 3L5XL 3U6RA 2N1KA 4D9RD 3VXSA 4J8RB 4LCCB 4Z7WE 3TBSB 4X7CC 1UKQA 3LEVH 1BFVL 4RMQA 3RJDA 4FNLH 3VRIA 3GMLB 3SJVD 1C5BH 1IQDA 1JGEA 5DVKA 4D0CB 2HP4A 3HZMA 1E28B 1N5AB 5D7JB 2Y7QA 3EO1A 4CU7A 4O2FB 5H2BB 1WWWX 4ALAL 1T04A 5I8OH 1I3RA 3T2OA 4MXWH 4N90E 1OTTD 2P5ED 2AAVA 3HI5L 4G9FE 3NGBC 2DQDH 2AXHA 1F4YH 3KPOA 1GGCH 3B5HA 3SDAA 3MSPA 1FGVL 4JZJC 1NFDA 5F8RC 4JFPA 5ILTH 1BJ1J 1BQHB 1LD9B 3S5LG 1MFCH 4GBXB 5SX4I 2EDOA 4L8SB 3UPCA 4PJ5D 1X4ZA 5J8OA 3BP5B 5E08H 2ZG3A 1QLEL 2W9DH 4KQ3L 4NUJA 2FLRT 3SE3C 4P5TC 1G9NL 1Y18B 4NC0B 3BX7C 2DJ4A 2VAJA 2M1KA 1S8DA 1A9EB 5F6HJ 4IRSD 3A6BH 2P5WA 3RWCA 5DI8A 5I1JL 4X0KB 5F72S 1TZHB 2ZSWA 3QIBD 4Z7WB 3H3KA 5B8CB 5HYSB 2HT2D 4HWZB 1JF1B 1NCUA 1EGJA 1E4WH 3IYLW 2WW8A 5GRZA 4JM2C 3B9KA 1PZUB 3CK0L 4TPRL 2ICCA 1YC7A 5FK9B 4EI5B 4HBCH 3EFFA 2NX5E 1KB9J 5FHBH 4IJ3C 3QXTA 4UBDC 2XTJE 5BQ7B 3RUGF 2YUVA 4JRYB 2KL6A 2WAHA 2MPAH 4G6JH 4WWKD 4Y8AA 4LSPH 3TT3H 5IWLC 1WCQA 5FF6A 4HCRH 1OD9A 2Z31C 1R5WA 1YNKL 3DTXA 3HZKA 2C4XA 5IHZA 3JWOC 1LK3H 5CWSA 2P4AB 3G6JA 1QLFA 5CCKH 1HI6A 2G5RA 3DUUA 3GI9H 1NH6A 2J8HA 5EBWA 5GGQH 1TDQA 2MMXA 5D72L 3H7BA 5D6DA 1IGFH 5JPNA 4PGDA 4WU5A 3IGAA 2QHLA 4GT7A 3SDXF 5C08A 3EFFB 5FV1L 1NMAH 4PR5B 5KSUB 1H8OA 5EFIA 1H3WM 3WBDA 3TESA 1TPXC 1R3LB 1K4DA 4Y4HA 2WUBL 5IM7B 4RFOH 1G7MA 3MCG1 3FB5A 5K9JL 1S7SB 4U1LA 4O4YH 3VWJA 3VI3E 5BJTA 3NCYP 1FYHB 2LV4A 4WW2C 5B8CA 4HZAA 4F7TB 4KTEH 1RZ8B 2BNUB 2DQJL 4TTDC 4WNQA 3QZWG 3IGAB 1NGXA 1F3DH 4IRSB 3O81A 3RWJA 2QTEA 4K71C 1X5KA 2A9MH 2CUIA 2YHGA 4XPFL 2OZ4L 1E4KC 2HH0H 2J4WH 3BPCB 3O9WD 4G3YL 3DTXB 5J12C 3AB0C 1RULL 5GGVH 2ITCA 4XTRD 3CMOL 4I0PD 3GUTA 1FH5L 3B2VL 3V5HA 1MHPH 1MJ7H 4PJBE 2PCPA 4HUKB 2X05A 3IFOB 1NMBL 3PL6B 4L1HA 1BM3H 2VYRE 5CINL 3KPRB 4TVSa 4BSVA 3NOIA 3BH8B 3QI9C 3U2SA 5K33A 2D7NA 5F97E 2FGWH 3H42H 1F6LL 3HKFA 2G2RB 1NDGA 2ATKA 2V2WB 4MXQD 5F93C 3SGEI 4J4PC 4P2OC 1X5IA 3SGEH 3B9AA 3MCLL 5FGBC 4HMEA 4X99B 3SE8L 4AG4H 1IGMH 1R24A 4LLDB 1U3HA 3LQZA 4WGVB 1ND0B 3D48R 1JK8B 3T8XB 4WY7L 3FB8B 4J12A 1CLZL 5I1HH 4JO1L 4W4OC 3V9FA 5A1AA 3QUZB 3IDJB 2GY5A 1QFWL 3VG0H 3JV6B 1QACA 3M07A 3VG0L 5IFAH 1J8HB 3ARGA 5C0JB 4XZUA 5A2KH 2J88H 1QQDB 1UACH 5CHNB 3T77B 1DLFL 4PJBB 2YPKA 5EU6A 1BFTA 4KMTH 5HD8C 4ZFFA 5CAYB 4JRXA 1EJOH 3I02A 4P9ML 4QRPB 1ZTXH 4F3FB 4WFHE 3V7AE 1P4IL 1D9KA 4XNQB 4ZOBA 1MCIA 3OGCB 4PV8B 4GUPA 4WEUD 3MRLA 1U95A 4TSAH 2WLYA 4MD0A 4MDIB 2B5IB 1ZAGA 3ZKMC 2OJEB 3WHXA 3VFTA 4DAGL 4NQDD 2JF1A 1BAFH 3NIFF 4XPFH 4PRHE 4ZD3L 3OJMB 1RZ7H 4HAGA 4PJFB 2FATH 2VOTA 5DQ9A 3F8UB 3OMZA 1HEZA 1HHKB 1MQ8A 3CFKA 3FMGH 4MJIA 3MRQA 4WFED 4DCQB 5E9DB 4X9BA 3DMMC 1EGJH 1F11B 3PGDB 5IHBA 1U3JA 3OGOE 3QEQB 3NPSC 3MLPA 5IG7A 2ILLA 2R39A 2PKDA 4MD0B 4L3CB 5E2TL 5C0AD 4ZO6A 2CDEB 4ALAH 3MQIA 3X14B 1HH9A 2J8OA 1DE4B 4X5XA 4XRCA 4ODVL 2NW3B 3UBXA 5SWSB 3MGOA 5F8QC 1Y0LA 3LRHA 2C7UA 4JZOB 4YHOH 4P3CH 3QYCA 4LRIA 3IFLH 3RGVC 4JPIB 2NXYC 3A67H 3VG9C 4G8IB 2GJ6E 3W2DH 3PGCA 5CMAA 3CH1B 3AS2A 1J05B 3PP3H 1KJ2L 4OZHF 3OJVC 3ULVD 5SWSD 1FNFA 2IQ9L 4GLRH 2QADB 4R97B 1G0XA 1EUTA 2HJFA 5AEAA 1IGYA 1QP1A 4OGYH 4AL8H 1AO7A 2VXVH 1S7XB 4C56E 3DIFA 2Q7YA 2DQIH 3CPLB 3HE6C 5EPMB 1H5BC 2AJZB 1FSKC 2R69H 4NBYB 4PJFA 1JZ4A 2IADB 1A6WL 3AUVA 4Q9CA 2V17H 1NC2B 3FMGL 4LLYA 3L3HA 4UNVA 2LAGB 5CIPH 3RWFA 5E8PB 4D9LL 2OSLA 4M3JA 3LRGA 2JJTC 2WIIA 4YHIB 4PUBL 5DK2A 4Q6YA 3PL6C 1NGWB 2AK4E 1R5IB 2VDMH 3KYKH 4XPTH 4PJBA 4ZQKA 4LLVA 2BNRD 4S1RH 4PJIE 4YPJA 2L7JA 5DD1L 3UX9B 2ZNXA 4LGSB 1MSPA 1A0QL 4F9LC 3SDDC 1PSKH 4F8QA 2XN9E 4ZODA 3SDAD 3ULSB 4FTVE 4NC1E 5FHAL 3MV8A 1QLEH 4L4TB 3X13B 4E41D 4V3DB 5HHME 2V9RA 3BOVA 4DAGH 3L95B 3S88L 3MOBH 3CXDH 3DOSA 2V7HB 1CGUA 1FV1A 4XXDA 3QG7H 5T3XH 3TV3L 2QLVB 5T1LB 2Q7YB 3MRQB 2D7OA 5TQ2H 3HR6A 4ZG1A 3RI5F 1EUUA 4OZIE 3HZYA 3RA7L 5C0BD 3SN6N 4WW2B 2Z9TA 3QG6A 5F7NC 1JWMA 5HGAB 3DYOA 2E27L 2RB8A 1YNLH 5DQJA 1XR8A 1IE5A 4K8RL 1NCBH 5T5FL 4LCWE 1BQLH 5DZNA 3GJFB 1CICA 3DPBA 5EO0B 5HYJE 4DFIA 5ADPH 4DZ8B 3IDYB 1W2KT 4JANA 5IEKA 5E2VH 1AXSB 3GMQB 1VEPA 5EORH 1KIUA 5CGYD 4P2QD 3OX8A 1NC2A 2G2RA 1TJHL 2FR4B 2EDHA 1BJ1H 3PUCA 4U1IB 1DSFH 5D8JH 4U1MA 4HS6B 1PEZA 3D18B 3P73B 5J6HB 5F3BA 2AK4B 3WEXB 4JJ5B 3RKDC 1KJ2H 3K4AA 12E8H 4G6KL 4HUUA 3H7BB 4JZJB 4E41E 2YZ8A 4QYOA 3BPLB 4UIKL 4QO1A 1HE7A 5L88L 3D3VE 4XBPB 2I5YL 3F7YB 3V95A 5HYJD 3CMOH 1P5UA 4BJLA 4YX2H 4M7KL 1WAAF 4NSKA 4G3YH 4Z5RA 4NJ9H 4JY6B 1RQ5A 1P7QA 4RDQG 3T0EB 3H3PH 3HPJB 3UTZA 1FO0H 1RJZA 4MDJB 1DE4A 1JE6A 3WXWL 2CUMA 4FA8A 3PHQA 5EOTA 1ZLSH 2ZG2A 4CNIB 1ERNA 1MCQA 3SEPA 1TZGH 3MACL 3HMWH 3P9MA 4L3EB 5DJYB 4N8VG 3RIFF 3GSWB 3MLTA 1MRCL 1D5BB 1IL1B 2PR4L 5C07A 1MFAL 1F90H 3ZKNC 1CE6B 2ICWA 4XBEH 1JTPA 5IVXB 3JV6A 2PYFB 1DBAH 1AJ7L 1RZ7L 3MRFA 1G9MC 1BAFL 1UWEL 5JDSB 4G8GD 1E4XI 3ULUC 4XT1C 3LHPH 1AGDB 4KHTL 3TF7C 1QRND 2DD8L 3JWNC 3PHOB 1LDPH 3QFJB 5I73B 5FAAA 3GKWL 3QDGE 4R0LA 3PP4H 2YD1A 3GI9L 1RK1B 5FOBB 1AGCB 1IKFL 1HWHB 3FQXA 4ZYKB 1T83A 2QSQA 1SM3H 1CQKA 2B20A 1OTSD 3UP1A 3RVXC 1A8JH 3SJVA 3FHAA 4PJAB 5DMYA 1JHLL 4CDGC 1T5XA 4OZFG 1IAIM 4Y89A 4ZFOA 4PRHA 3P4OA 4PJ9A 4ZUWA 1C08B 4K3JL 4JB9H 2BX5A 5J11B 1EFXB 3I6LD 4X9IA 3RY5A 1WQVT 3FN0H 4AM0B 4KRPB 3VE0B 1P4BH 2XNAA 3V5HB 3HRZB 4JCLA 3O4LD 3QCVL 3DV6A 2DIJA 2ARWA 2IBZX 3INUL 4TUJB 2QL1A 3QUMB 3T4YA 1F45A 2JCCB 4KKLD 4LCCA 4NM4H 5DFVC 4YDVA 5JOEA 3UTQB 4FN0A 1TVDA 4XVUD 1S7WB 1U36A 3QIBA 3MJ7A 2YA0A 4LLDA 5JDSA 3E3QC 4FFEX 2DLFL 1VERA 1NBVH 5C0AE 3EYVB 3GRWA 3U36A 4JB9L 1TETL 1RZ8A 2BNUA 3MMEA 4OLYH 3BP4A 1L8JA 5KZCD 1NAKL 5BV7B 3P77A 1LP9F 1RFDL 4PJEA 5CINH 3HRZA 2W65A 3BGAA 1W8NA 3FT2A 5FKPA 2NY5H 4LLUB 3O6KL 4NPYB 3TVMA 3KPOB 1K5NB 5KVEH 4JG1H 2NTSP 1WEJH 5DRZA 2I9LB 5IK3A 5BVJA 3PWVB 1UCTA 5GS1B 2QBWA 1UJ3A 1JYWA 5C0BE 5EU6D 3GMOB 3RPIB 2E9IA 4Y0GA 5I19L 4BZ1H 3QQ4B 2NW2B 5IM7A 1MCPH 1JF1A 1B2WL 3MROB 5C0EA 2H32H 5HHNA 4Z7UE 1AD0B 2DMCA 5IVZA 4OJFH 3I50L 4TULH 1BMGA 3L5WB 4P4KB 1X5FA 4NJAL 1FAKT 1OL0A 4OCMC 2AJYL 4UT6L 4CKVX 4JQVC 1KFAL 4HPYH 4H88H 4PJIF 1LO3H 2BOCB 1CE1H 4K94C 1KIPA 3VXOA 4BZ1L 1N4XH 3LEXA 1DQDL 4IDJH 3LDBC 1U91B 2X4QB 2F5BH 1RIVL 2JCCA 4XBEL 4C54A 1OLZA 4O4YL 1AI1H 4IDJL 5SX5H 1H3TA 3O4OC 4NCC1 5DZLA 2WK2A 1HHGA 3ALWA 5JW5A 1PZ5A 5IVZB 4I8DA 4PG2C 4UT6H 3RX8A 1BVKB 4FQXB 5CP3A 1UENA 3QXWA 3WXWH 5C0IB 5J7CC 1OAYH 2X4NB 4K2UH 4PGEB 4HUWB 2WBJC 5GGQL 2IQAB 1BFVH 3GJFA 2DS4A 4I1NB 3F6IA 1KT2B 1UJTA 5DJZA 2VC2L 1D6EA 4MMXC 2F9BT 2DWEB 3UXFA 4LSRH 1EHLL 1I8MA 1G7HA 1YEEL 3PE9A 5IB1B 4LVHC 2NXZB 1TTGA 2VRAA 1SQ2N 1AO7E 4C56A 1PKQB 1ZEAL 1IGCL 2A38A 3GMLA 2EH8H 4WHDA 4MVBC 4PBWD 4KMQA 3HZKB 3KWWB 4R0LB 1G6RH 1P7KA 4YBQD 4Y2DD 5IP4A 4TUOA 3O3AA 4KUCD 4K3EL 4TOYH 3UYRL 1BJ8A 1EHAA 1HDMB 1UC6A 5I1EH 1BIHA 4PJGE 3C6SA 3AMKA 3MRRA 5FA4B 1JUFA 2NXYD 3D2UA 3ARTA 4W6WB 4FQXC 2E9JA 5CLWA 2C3VB 2Q1EA 3ARVA 4APQB 3IS1X 1FG2B 3KPRD 5CJ5A 1TITA 1BQLL 5T5FH 2FIRT 4HULB 3VXRE 4PB0H 4H26B 5I1JH 3A6BL 2DTML 1V7NH 4LSVH 1JN6B 4AQ1B 1RZKH 4XMPH 2NYYD 2BY1A 4KI5D 3NN8A 2FNBA 2ZNWA 3EHBC