2AXGA

The immunogenicity of a viral cytotoxic t cell epitope is controlled by its mhc-bound conformation
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
276
structure length
276
Chain Sequence
GSHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRTEPRAPWIEQEGPEYWDRNTQIFKTNTQTYRESLRNLRGYYNQSEAGSHIIQRMYGCDLGPDGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGLCVEWLRRYLENGKETLQRADPPKTHVTHHPVSDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The immunogenicity of a viral cytotoxic T cell epitope is controlled by its MHC-bound conformation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system/gene regulation
molecule keywords HLA class I histocompatibility antigen, B*3501 heavy chain
total genus 77
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 2005-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2axgA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 2axgA01
1DEDA 5JUEH 3LKSB 4Y19B 4HC1H 2CIKB 5IP4A 5I1LA 4OM1H 1NMBL 3QUYA 4PJDE 3WNPA 4PRPB 1RU9L 2H2PC 4QGTA 1LO0L 5IMOA 2J88L 3MLVL 5E6YA 3TN0C 4LSVH 3HFMH 3BW9A 3K4ZA 5C7XL 3OGCA 2YMXL 2GAZB 4TRPL 4QOKE 4NM8L 1JGVH 3B8YA 1LGVA 4JFXB 3VFUA 5ALBH 4O2CA 5DMIL 2CPCA 4OI7A 4J3VA 5EO0B 4QLRA 2H8PB 3C8DA 4XNQA 5D1QC 2ZUWA 1B0RB 5B21A 1J0YA 3TCLA 1TNNA 4Y5XA 1QUNA 3BPNB 5J89A 3BZFB 4OCSH 2AK4E 3CX5J 3ZDXF 1HKLL 4P57A 3OAZH 4JJ5A 4LGRB 2YPKA 3VG9C 5IM7A 1G6RL 4UNVA 4RSVA 5HVGB 1RFDH 3WFEL 3AMKA 4QY8B 4R7DA 2BSTB 3O6FB 1II4E 3H9SD 4MDIB 5F9DC 4EEEA 3VGFA 1O0VA 1U8PA 5JQ6H 4ZUSA 3DXAA 3DV4A 4APQB 3FRUA 4U1MA 4J12A 3HCVA 1RUAH 2P5EA 2JJSC 2X4SB 4LOUD 3QNZA 5EUOB 1Q9KB 3BSZL 4R8WH 3E8UL 1QA9B 4U3XA 3RVXC 3B3IB 5EA0H 3GRWH 1KCVH 3ZSSA 4WO4B 5ID1A 1GC1L 3QEHB 3ZDZF 3NBNA 4Y16A 1RVFH 4HWNA 2C3VB 1QFUH 4RX4A 3VG0H 5HGHB 4JAMA 4X4YA 1TJGL 3NCFB 4PRNA 1UZ8A 3SE8L 1QPPA 5ANME 3W39A 4EDXA 3UZEA 4NM4L 1EO7A 5F3BA 3KG5A 3L5HA 4BZYA 3MRCA 1F4WH 3QIWC 4I2XB 4CKVX 2HP4A 1PD6A 2R4SH 3CDGB 5KSBA 2QQKH 4MDJA 4O58L 3SCMC 4CVXB 3S36H 5A2JH 5TJWK 1U8KB 1H3PH 3CVIH 5DXWA 5F7MC 1P53A 1YY9C 1Q9WB 2JCCE 5ERWA 6CGTA 12E8L 2AXGB 1KB9J 2MTPA 2VDLH 1J05B 3S5LG 4XVTL 5KS9B 3U9UA 3BDYL 2P5WA 4F8TA 2LV4A 4HPOL 1BM3L 3KPRD 1UT9A 1QP1A 2YD5A 2ESVE 5CD5D 5D70L 2X2YA 4XBEL 4ZAKD 5FYKD 1BD2B 1DQDH 2GCYB 4TOYL 5H37G 4HH9B 2EKSB 5HYSB 4MD0B 1DVFD 3MLZL 5BVJB 5GJTL 2GK0B 1YPZA 2B4CH 5DC4B 4CADB 4P2OD 1DLFL 3RKDD 3KYOB 3TM6A 1JIBA 1NCAH 3M45A 3V6OA 3MR9B 5I1IL 4OCLC 3GSVB 4LKCA 1V3MA 4QXUL 4BKLA 1FNSH 2HVKA 5AG8A 4TUJB 4LP4A 3CZFB 2NNAB 3RIAF 3HB3D 4HWBL 1I1AA 4PRPD 4PUBH 1C8PA 5JMOC 4PJDB 4WFHE 2C3GA 5GGTA 4PYGA 1DQTA 3N85H 3TFKA 5CGYC 3C60C 5IK3A 2FDBP 4AENB 5HBBA 1Z5LB 4K7FA 5I30L 2V5TA 3HNTL 1JGLL 2Q86B 1VPOH 2XI9A 1EJOH 4W68A 2G60H 5D7JA 1DUZB 4KGLA 2OI9A 4YLQT 4Y2OA 4S1RL 5BXFB 5CLWA 3KPNB 2PNDA 4NNXB 2I9LB 3I6LE 3L3KB 4O5LH 3TO4B 3U7YH 1OQXA 3TBWB 3VCLB 3MX0A 3SCMA 4FFZH 1I1YB 4UQ3A 4YHPA 5TE7H 1CE1H 1EXUA 4Z7OE 4M62H 3GMMA 4D9LL 5F7UA 2X09A 2QADC 3A6BL 5HDQH 3HI6L 1NAMH 3VXTB 4YBQC 2XZQH 4AEEA 5EZIL 4NZTH 1U8KA 5GRYA 3MRIB 3EYUL 4NN5C 1MHEB 1YPZE 3O6KL 1NUNB 1KPUA 1S7SB 3O2VL 4FXLA 3ARQA 5AUMB 4I2XA 4Z8FH 2VQTA 4O51A 3GJFH 4M61B 4Z7NE 4HBQA 2J8UA 4OJFH 1QQDB 5F3BB 2LU4A 1MCKA 2EDHA 5J56B 2IG2H 4QF1A 3MRLB 3ULUE 1MJUL 1OAKH 4GFTB 4PRNB 1ETZA 4PJFF 3OX8B 3ULVF 4WFGE 4Y8DC 1IMHC 1SQ2N 4ZSOE 1F8TL 2E9IA 4PRHA 5I1JH 1CBVL 3P9MB 3ULUC 1A0QL 2MFNA 3QEHA 1CFBA 3GJFK 2MQ3A 4R2GD 3B2VH 4EI6B 1ACYH 3T0EA 4ZAKC 2OL3B 5IFAL 4QTIH 5EO1B 1LDPH 4OCXH 2E9JA 3MCLL 3NZ8B 4H26B 4OQTL 1IGTB 3BKJL 3WIHL 3QNZB 2EEAA 1OOAA 3MJ9L 4PJCA 4F80A 2BC4A 1MAKA 2PTVA 2APBA 4NZTL 3H0TA 4ZUSB 4NFBA 4Y5YC 4YXKH 1WLHA 2BJML 3SDXB 3EO1B 3V4PH 5MEQB 3QUXB 3O2VH 4PJXA 3B2UC 5IESL 4GXVH 4G6KL 4D3CL 4WJ5B 2YPKB 5IM7B 3CFCL 2QADB 5C6WH 4JFEE 2C4FT 32C2B 2CSPA 3BGFB 2WUCL 3MLRL 3NIDF 3KDMA 4J8RA 2DQCH 5E95B 4HWBA 4RIRA 4UNTA 4TSBL 1Y6NR 5AWNL 3RVUD 3BXNA 4O2CB 4P4KC 2WBWB 4JFXA 3VFUB 1B6UA 4Y4KC 5D72L 3SDXA 5DRWB 1NMAL 5D7JD 1U8HA 1BIHA 4BUHA 4XCFH 1Y18B 4J3OC 4XVJL 4M02A 2PKDA 5CILH 3STZB 4ZUWA 4HXAH 1NCUA 1LE9B 2NX5E 3ARYA 4LOUC 1LQSR 4Y19A 2NTFA 3LD8B 5EZOH 1K8DB 5GHWL 5DD0L 1NCCH 4EI6A 3ARBA 4F33B 4FTVB 4M6OL 5E70A 3D48R 1S9KC 3BE1H 3RI5F 4U1NB 1MFAH 2ERJB 2OR9H 5MERA 1VHPA 5AZ2L 5D71H 2KBGA 4N0CA 4NZRH 3QISA 2EICA 4LAQH 1ACYL 2J8UB 3T0XA 1CTNA 4KY1L 4LARH 2LU3A 2ESVA 3N85L 3T3PE 4ODVL 4X7EC 2ZCHH 5ACZB 1MHEA 4JFDA 1RHHB 2FX7H 4P5KB 4M8QA 1BQSA 1WBZA 4EVNB 1AFVH 4P2YA 5IUSA 1ACZA 3X11B 3X17A 3Q0HA 1OAZL 1KPRA 1P9MC 1N7ML 3G5XB 1M71B 4FFWC 3PNWA 1BAFL 2NPLX 4L4VB 5EBMB 1RULL 1Y0LB 4BQ8A 2AEPH 3UAJD 3L7FB 3L5XL 4KRLB 1QSFD 3S34L 4KDWA 5LXGH 2AK1H 4UQ3B 2AAVA 3AC0A 1FBIH 3PGDA 2YEZB 3NCMA 5B3NA 1RPQA 2H9GB 1KTLA 5I15L 2RB8A 5D93C 3TO4A 5I1EL 4YGVB 1FSKC 1PG7L 3B8SA 3H3PH 4TYUA 4LSPL 1AR2A 4HK0B 4ZSOB 4ELKB 4B41A 5ESVB 1CXIA 1YMMB 4H8WH 1FIGH 1CD8A 5GJSL 1EBPA 1C5CH 4OLWH 1HE7A 1CE6A 3DSFH 5ENWB 5FO8B 3WJJA 4QT5A 4PJDA 4DGIL 1DEEA 1FFQA 3DVNB 3HR6A 5T3XH 2D4DA 4ODWA 2X4TA 1NC4B 3WD5H 4G3YL 2QQNH 3FQRB 4G8IA 2NY4D 3IAPA 4XT1C 4PLKC 2E8ZA 1CLYH 5E5RB 3KYNB 2FJGB 3BZ4A 1XMWA 1A7PL 5CAYB 4UOW1 5C0DA 2YD8A 4WV1A 3AMLA 2VLKD 4MA7L 1RK0A 5BVJA 3LKRA 4OZIF 4K7PH 3AM8A 3K8MA 4NO2B 4OCSL 3UTTE 4DZBA 2V7HA 4Z18A 3PWLB 3O3DB 3VH8B 1LO4L 1NBQA 4O2FA 4LSSH 2Y4SA 4X6EA 1J05A 1GGUA 3VMPA 1CD1A 4LSUL 2XG5A 5ERWB 1BWWA 4P2OC 1T0MB 1J12A 1BEYL 3OAZK 1W0YT 3MREA 1FP5A 3T3ME 2BY0A 2EYTB 3SE9H 1TJGH 1E0OB 4ZO6A 4MDJB 4LPCA 4RRPA 4F57H 4L8BA 2VDRL 3OXRB 4CW1B 3SE9L 2SEBB 1F11B 1QKZL 4WENB 3Q5YA 3PWPD 1X5YA 4NUGH 1QG3A 4EOWH 1JNNH 3BEWA 3QUYD 3VH8G 8CGTA 2WINA 2IAMA 4N90D 3VE0B 1UQSA 1A5FL 4EDXB 4I0PD 4KTEH 3RVTD 1ORSB 2YUXA 4R96B 1OQOA 1OD7A 4JAMB 2C3VA 1UM6L 2RAMA 2UY7A 3C6LD 3DX7A 5CSZA 2P24B 1X7QA 4JM4H 4MQTB 1BPVA 1OTTD 4L3EB 2A83A 3ARSA 3S88H 5IKCB 4I0PC 1NLBL 3UTSA 2Y07L 5ESAA 1A4KA 5DD6A 4GRLB 2ZCLH 4HPOH 4WWKA 3OJDA 4X98B 2P46B 1HNGA 4M7ZB 3HE7C 3RJQB 2C3WA 5JW4R 3VXRD 1J1PL 1I1RA 2F54E 4JPIA 3DYPA 4WFFD 1HZHL 5EPMA 3BJLA 4UIKL 2V5RA 5CJXA 3IDNB 5GGSA 3TBSA 5I76B 4R7DB 3H9HB 3PWNA 5AYUH 3QUKB 4FQXA 4OV5A 4JJ5B 4P57B 2FLRT 1T6WA 2ENSA 4DQOL 4OGZA 4HS3B 3BZFA 3EYVB 1TVHA 3BP5B 4I0KA 3O6MH 5DJ2A 1ODAA 2VDOH 1MCSA 2FEDD 3JTTA 4GG6F 5TDOA 3RL1B 3A67L 2CRYA 3AS2A 3AY4C 5DEZA 3TPKA 1JF6A 3QIUD 2GAZA 5F1KC 3SOBH 3FMGH 4MB5A 4G8GD 4D0DB 1A6WH 2VB5A 4YDLB 5I1HL 3OKEB 1I1AD 4PRPA 2F53B 4M6MH 5F8QC 1IGIL 3DX6B 3BKML 1N5AB 3WS6C 1LO5A 4UINL 1PY9A 1KB5H 5CZKA 5HD8C 2XRAH 1NGPL 4DN4L 5FF6B 1HQRA 3BUYA 2ZCKH 5DMJB 4TSAH 1AD9B 1WZMA 3G6JE 2WLZA 4P2OA 1JWSB 5D7LA 3TNMB 2PW2B 4I3SH 4HC1L 1D6VH 1W0WA 1X5KA 3D18A 1G6RB 3JZ7A 4M1GL 4FQQA 4IIQB 1P4BH 4P3CH 4NBYB 5DYOB 3KPRA 4AG4L 4IBLT 4IMLA 4EI5C 1EHXA 4XP6L 4MGXA 2DQGH 1B4JH 1A47A 1A1OA 3SE4C 2OK0H 2VLJE 1M7DA 2ZG2A 1ZLSH 3RY6A 2Z93A 3FO9B 1U8NB 1DQQB 2CDEA 2Y5TA 5AZEL 1OF2A 1BF2A 1KUMA 1AGDB 5FYLE 3W9EB 5B22A 4G6KH 4D3CH 3RVWC 1GHFH 3CVHH 4LLAA 4G43B 1ZGLA 1R3HB 1X5GA 1GXEA 4ZO9A 4WHCA 4NSKB 2EXYC 3ULVH 1VFBB 5DFVC 5JXAL 5I17B 5ICZB 2I07B 1I8IA 1A2YB 2X40A 3GSWB 4NHUA 4NQSB 2OCFD 1OCWH 4HS6A 3QEQB 2KQMA 5TE4L 3PJSA 1T6VN 4BSJA 2A9ML 4UILL 4YE4H 4B7IA 2W9EL 4ELMB 2B39A 5FA3A 4Y16D 2PCPA 3BZEB 1QLEH 4PG9A 3GSNB 5FO7A 1W72L 2OBGA 3ZT6A 1TVBB 3GI9H 3C5JA 3CFCH 3AS1A 4XPBL 4P2QB 2Q20A 3V95A 4OCWH 2P44B 4POZD 1HOCB 2E7LA 1S7UB 1KJ2B 4HKJA 1E6JH 2YC1A 3HHRB 4KWUA 3BWAB 5BRZE 2BSSA 2Z31D 4D0CB 4GBXD 5FM8A 1CFTA 3ZE2E 2FECI 43C9A 5ID0B 4MNHA 1JFQH 4H88H 1I3UA 3V6ZA 4KMTH 2DMBA 1I9RL 1SMOA 1H3XA 3MRMA 1JL8A 5D2LE 2E7HA 1FAIL 4QRUA 1TJHL 1U93B 1X5ZA 5D7KD 3BOVA 4MQSB 2DJUA 3IXTA 4NQCB 3E6FA 5F6HJ 2OZ4L 1QBLH 5HPOA 3TV3H 1I7ZA 2QBWA 1T20A 1RQ5A 4P46C 4XMPH 3UPRB 5B38B 5FUOL 1S5IH 3SDXE 5I9QC 5KW9H 1P2CA 4R6UA 1R3KB 2NTSP 4JHWL 5SWSD 4KRNA 5E9DB 1MHPL 3O11A 5L2JB 1U8JA 3FFDA 2NY2C 1JPFB 4RA0C 1JPSL 1A6AB 3LKQB 4P4RB 3HC3L 2C9AA 4LK4A 4OZHA 4CGTA 3L3HB 3HAEA 2ADGB 1I1CA 1T7VA 1RZFH 1CZ8L 5F8RC 4PJ7E 2XQBL 3D2UB 3G08B 5F7DA 1FC2D 1HH9A 1CI5A 5D71L 3TGXA 1RY7B 2DYPB 1XF2A 4LCIL 4G8FA 4R2GC 2DQFA 1MPAL 4P2CG 1I7UB 3BKCH 3OKOB 2VE6A 3U48A 1M1SA 5I73B 1NQBA 1NFDE 1FG2A 5C0RH 1PAMA 3ARGC 4MQ7A 5T1LA 2NZ9C 3T1FA 1F3JA 4XNMA 1GYAA 2FX9H 1P7KA 1V7ML 1DL7H 3BPOC 3HMXA 5DJZB 5TGBB 1QBAA 1GGIH 1FAKT 3IDUA 2FH8A 1SJXA 1R3LA 3FTGA 3SHSA 3EDDA 4NGHL 5INCA 5JZ7C 5KZCD 3ARFA 1FPTH 4MB4A 3MMEB 4LRNL 2UY6A 3B9EA 3IU4H 3LHPL 4Z0BH 1HWHB 2ILLA 5FCUH 5C0GA 4N9GA 3M17B 4KH2A 5CKAA 3GNML 4M8VA 1W72A 2UWEA 2VERN 4YBQD 2JCCF 2IALB 2EDDA 2XQYK 3HG1D 3IAQA 1IM9D 4U6HB 4YGAB 3IVKA 4FQ2L 5J1TC 1XIWA 4N5ED 3OGOE 2HFEA 5CP3H 4DJMA 1TPXB 1X6LA 3BGAA 5B8CC 4U0RB 3RY6C 2CR3A 4DAGL 3T1WA 3DV6B 3TBTB 1MF2L 2BY1A 1S9XB 4LSSL 3ZKNC 2D31A 1PKQB 1VB9A 4OQTH 2VXSL 1WIUA 5IQ7H 2X1WL 2Z4QA 4JPKH 3MRKB 2AJUH 2RBLA 1JPGA 1LEGB 4YXKL 5JNYA 3DRTA 5BMFL 4NWTL 3ARED 5HHOE 3B5GA 2FBJL 3F7YB 4QRSA 4WU7A 4BK4A 5JHDA 4LLMB 1KCGC 5D7LD 2VITB 3ZYIA 4WHTA 3GKWL 4RQQB 2BSRA 4U1HA 1CGWA 1RZJC 2Q6WB 4Z7UE 1YNLL 1YEJL 2X5PA 3V8OA 1QSEB 1RZJL 2X1OA 4XI5C 2EDFA 2K3TA 3L3JB 3AROA 3PABB 2HH0H 3VXUA 5GZNC 1UCBL 4GBXB 3OG6B 3V0WL 1OAXH 4GO6B 4DGVL 2B1AL 3FOMB 3K2MC 3ROOB 5GZOD 5TFSH 1YEEH 1KJVB 2LQRA 4OSUL 4PGDA 4ODSL 3KXFD 1GPOL 3W0WB 3ZL4H 4F7CB 1XGQB 1N4XL 1IGYB 4EIGB 2J2ZA 5EN2B 3HMWL 2VAAA 4JO1H 2R29L 4PRHE 4NRXB 4NO3A 4QGYA 2AEIT 2HJLB 5DEFA 4PJ7F 5FXCH 4ODXA 1FV1B 1HZHH 1EX0A 1KJ3L 1U3HD 1YY9D 2IH1B 2VDKL 4PJ9B 1MCFA 3DROB 3F58L 3GMQA 5H94B 3EIFA 5F9WB 4G7VH 3QCVL 4NKQB 5HHNA 3LKNA 4NPYA 3TO2A 3QZWG 1ZE3C 5DJDA 3VFMB 3HFML 5FA4B 3HUJE 2PO6C 5EOCJ 3CK0H 4FQHB 2J7LA 4EN3D 3P30H 3IDGA 3QI9A 3LKNB 3VD5A 1YNKH 1T03L 1YEDA 3WN5A 3UROR 5J6HA 2E9WA 1YEFL 4JFEB 4RGMB 3K8LA 4WWKD 4OCMC 2F8XC 3I6KA 1F6AA 3GMQB 1QPXA 1JHTB 1YN6A 4PGCA 4PB0L 2IH1A 4A6YL 1OY3B 5DZNA 1FYTB 4BH8A 5DEFB 5CWSA 2W07A 2P8LA 4NRXA 2LFGA 3BH9B 5F7WC 2N7AA 5LVEA 1LHZA 3VD3A 1XGTA 1M7IA 1IGYA 3B9KD 2NW2B 3IDIB 3QIBC 4LASH 3QPQC 3VFOB 1AJ7L 3V6FA 3UJJL 2B1HL 2B7DT 4P2QD 3PHOB 1X5IA 3FOMA 5K9QI 3SE4A 4NJAL 1WBXA 3FKUS 3S7GA 3DIFB 4PGBA 3P4NB 2AK4B 1PQZB 1VACB 5EOQL 3KLAA 1MCPL 1G9EA 1XGPB 1A1MA 4C56A 3BDYH 1NGXA 1FO0L 1T22A 5IMKA 1T03H 4JRXB 4EI5A 5J6GA 2VITA 4AQ1B 5FGSA 4N0YH 4MX7B 1J5OL 1WIOA 4GJTB 1N59B 2H32A 4X4ME 2LTQB 1T2QL 5DJCA 1DBML 1ZA3B 4JM2B 5JW4Q 4PJGF 4F2MA 1MCWM 5JW3L 4JFQA 3F7RA 5FAAA 1FGVH 5IHUH 3FB6A 4FZ8H 3KPTA 2Z91A 3WLWD 5IW1B 4G7VL 4UDUB 4NUJA 1MUJA 3TC9A 3TN0D 2X9WA 2H2PD 1NGQH 3O2WH 5E2WL 2XA8L 1PKQA 4XPTH 5CIPB 3V5HA 4AG4H 4MAYC 3VXSD 3CPLB 5DJXA 5DZLA 4M48H 3O9WA 3WV0A 5DD3H 5GGVH 2HA1A 3T77B 1L4IA 3TBTA 5IEKA 2VLME 5CHNA 2EE2A 4YHML 5FM5O 5KVGH 2NY3B 4LCWB 5MEOB 3RU8H 5J12C 4OCRH 3FQUB 3GJFB 4RFNC 1I7TA 2Z92A 1I7RB 3NMEA 5I2IB 1WUNT 5E56A 2X4RA 5JHLH 5C0GB 4X8JA 3UZQA 1ZT7A 3BRFA 3MRNA 1U6AH 3QQ9C 3N1GC 1J9CT 4FQXC 2EE9A 4G6JH 3ARTA 1R3LB 4L3ED 1U8QB 1XF3A 4UIKH 3IGAA 4XAWL 4X83A 2RR3A 3MLSH 4HH8A 2P48B 3MA7B 1U3YA 3ARDD 2HVJB 4JY4A 4Q9QL 5HGBB 2DIBA 1A1NA 1INQA 1S9VB 5DUPH 4KJPD 3C5SA 1M6OA 3IJSB 4FQIH 4UT6L 2HRPH 2DQFB 1TCRA 1TPXC 5I66A 2EXWC 4OIIH 1LO2L 1O5DT 3LRGA 4X6DE 3V4VH 5SX5K 4ZFZB 2ZOKB 2GW5A 4PLJD 1Q9LB 1I8KA 2LABA 4OZHB 1KLUA 2FBOJ 4KI5E 5A2IH 4IM8A 4P9HL 2ARWA 3L5IA 1MJJB 4NZUH 3W9DB 3WDIA 5FKAA 3D0VB 4NP4H 4RMUA 1PG7H 3H3PL 4BQ6A 3QWRA 7FABL 2CK2A 1CICD 3X13A 1KB5B 1FYTE 5MI0C 4DTGH 1WF5A 4XC3L 2RGSA 1VSCA 3K2UH 3QPXL 3VDAA 4JM4L 1N8ZB 5DRZA 5JW4N 1X44A 2EDKA 1P4LB 3HE6C 4BYHA 3MLVH 3C6SA 4KTYA 3SDXF 3VGAB 4GQPH 1A4JB 1IRAY 4PJ8A 4NQDB 2VWEC 5EBLB 3HLAB 4P4KA 4D0CA 3CNKA 4G59A 3JV4A 4WW2C 1DLHB 5DA4A 4WY7L 5JIPA 1IGCH 2PTTB 1BVKB 1I4FA 1XT5A 5FB8B 2XACC 3F7QA 5E94B 2BCKA 5CJQH 4YIQB 1G7LA 4PJBF 4GMTH 4JM2D 3B2VL 3JWDC 5CSBA 1CL7L 1IKNA 1IQDB 1CVRA 1CS6A 3PGCA 2QSTA 3GHEL 1GC1C 3DTXA 4JY6A 3SKNA 3WFDH 3V9FA 1OGAE 5FO7B 3WJLA 1MLBB 4ONHB 4FA8A 1U3JA 5L7XL 4DVBA 2PCPB 5L2KD 4Y1AB 4ELMA 2CJUH 3SDDC 2EYRB 3CLFH 3HZYA 3ES6B 4P99A 1IT9L 2F54B 2FECL 1SYVB 1A14H 3RWJB 3VXSB 4ZXBA 5E8EB 1JWMB 1U95A 4WI9A 3VFTA 1S7XB 1YEGH 2AQ3A 3P77B 3F7VA 4B0MM 3ALXA 3QJFA 3WEXB 3L3GA 2D4FA 1QNZL 3DBXB 1RUML 3ILPB 4YZFF 4PY8I 5DRNA 4YR6B 5GSRB 1Q38A 4AMKL 1NCDH 5FGCB 3FO9A 3JBG7 3L7EB 4Z9KB 3O0RH 4L29B 1IKNC 3LZFL 4JHBA 2VLRA 3EYOB 4HCRL 5IB1B 1MCBA 4ZFOB 1MRDL 3KPMA 1UM5H 4P5TA 2UYLB 5SWSE 3ROLB 4FQ2H 4F9PA 4MZ2A 2AJVH 2VZVA 4FNLH 3BRDA 4RGND 2KUTA 1PX3A 3KHQA 2NY2B 1B2WL 1IL1B 2X4OB 1C1EL 1N6VA 5EFIA 2D03L 4UV4L 1XGRA 2JB5H 3TNMA 1AI1H 3GKZA 3L95A 1YEEL 3OKDB 5D7LB 4RGOH 4PP1C 4HAGA 1WV7T 1EEUA 4JO2H 2P42B 3ARZA 3L5XH 1OWRM 4PR5A 2CRZA 3GBMH 3I02B 1EHNA 1BFOB 1KACB 2ITDA 4Z78B 4JHWH 3LN5A 2ZUVA 4X5XB 3VI4F 1DN0B 3TYFA 4IRSA 5J06A 4P3WA 4WFED 2XKNA 1MCJA 1NAMB 4UOW0 4ZAKB 3HN3A 1V05A 5BJTB 4NQDD 5IHBA 1JNJA 2PYED 2VKWA 2AGJL 4JVUA 1XR8A 2FJFA 5I71B 5A2LH 1FCGA 1S9YB 4QRRD 4NQXA 1YNLH 3IFNL 3CXDL 3P4LA 1DN2A 1OAYL 1NL0L 3RL1A 3ARGA 2HFGH 2P7TA 2IJ0C 5I75C 4DKFH 5D72H 1EEZB 4LU5H 5K9OA 3DNKA 3BP5A 4PJ8D 4DEPC 4Y2DB 2A6KB 4L3CA 4LSTL 1JHLH 3BPCA 4RGOL 3D3VE 1E4XL 4FQXB 3V0AC 4OV5B 5I16B 2WW8A 1NSNL 3FONA 4MHHI 1S5IL 4RBPH 2VISA 3IDNA 3KLHC 4U3HA 4EKXA 3C87A 3ALPA 3MQIA 2GI7A 4HGWB 4LVNC 3IJHA 3VRLF 1BFVL 4LL9A 3IU4L 4JFED 1A21A 1U8MB 4U7SA 4WWKB 1WCBA 1CWVA 4P5MB 1ADQA 3NFSL 2X4NB 1ORQA 4KDTA 2D7MA 2HLFC 2P24A 1JGLH 2O61A 1A14L 4E42A 2VDNL 3S3SA 3EOYG 4JGUA 3FQNB 1CIDA 1OAQH 3OXSB 3T0WA 4DKFL 5FGBC 4HX1A 1PJ9A 3MBEA 5JLZB 4CUCA 3GIZH 2Q76A 3VE0A 2IAMB 5HY9B 3S35L 4EN3B 1KELH 3BEWB 1RZIB 4GKZB 2B0SH 1ZWIA 4PRBA 5EU7C 1NC2A 1FNEB 2WNGA 4CW1A 4KRMB 2XRAL 4GLRH 3B2UD 1FNGB 5CJ8A 4JZOB 1KEML 3ARVA 4XPHL 4HGMA 4MNQE 1CG9A 4M6NL 3C08L 3QDHA 3VFWB 3ARFD 4PLOB 1CD1B 2MWCA 4IJ3B 3G6DH 3U0WL 5DI8A 4Y2DD 1X4YA 4LSQL 3H7BB 2VXUH 5JXED 4MD4A 3QUZA 1RIUH 2R1XA 2BVUA 2NY5H 4ZMAT 4Y4FD 3H42H 4N8VB 3LKRB 3LV3B 4XGZB 5C0DB 4KVCL 2G9HA 1ONQA 2CGRL 4U1JB 3VWJA 3WNOA 3S4SG 2EDJA 1N6QH 3U30C 4ZUTA 1VKXB 4GG6B 5CJ5A 4QHUA 1HXYA 1S7RA 5DD3L 5IFJB 4M43H 5ADPH 1GL4B 1NFDB 4UI2A 4PV9B 4FQIL 3DVNA 3REWA 3C60A 4O4YH 1AO7E 1BQHG 5FO8A 2P47B 3M07A 2VLJB 5SWSA 4NQCD 5CSGA 4RFEA 5E1HB 3P9WB 1AGBA 2CDFA 5C2BL 3VXOB 3RNQA 5CEZL 1JFMA 4GW1B 3NIGE 4M1DH 1KG0B 1OL0A 1KTLB 4JDVB 4HIXH 1ADQH 3D0LB 3IFOA 4KXZI 2YEZA 4PD4K 4O5LL 1W8NA 2FIKA 5TQ0H 3VFPB 3ZHKA 1ADQL 4R4BB 3BGMB 2A1WL 5B39A 4N0FB 1T1ZB 1VPOL 2X4QA 5E6IA 5J13C 5KVMC 3T4AB 5I8KL 4M7ZC 3V6OC 5LBSL 3UO1L 4ZOAA 5FUCC 3CDFA 3O4OB 4PJIA 4E41A 4HFUH 3X11A 2WIIB 2BXYA 2YUZA 1K3IA 4HFUL 2DQTL 1ZHKA 2BVPB 3KPQB 2N4IA 4YDKL 4P5KA 2JB6B 3E3QE 5CIPH 4JFDB 3ULUL 4NRYB 2G5BA 2W9DH 4BH7A 3K4DA 4GRLD 4HJGB 3RGVB 1CTOA 3CFKB 5T3XL 4YDVA 3EAKA 5DQDH 3HUJF 2BMKB 4Y1AE 3OHXB 4MXQA 4AEIH 3WD5L 1ZK9A 4KI5F 2XNAB 4H1LA 1LP9A 5MERB 4ZDHB 5AZEH 1HSBB 5DD1H 4ZS7L 2A0LC 1FZMA 3IKCA 3Q5OA 4PJDF 3VU2A 2GJ6E 4HT1L 1FO0H 1UWXH 4E5XA 4ZNEA 3CFDA 3E1F1 3MZTA 4V1DE 3PWJB 4XC1L 4MXVE 4Z7UA 1QLFB 1IGCL 3NACH 3TT1H 1F58H 3QQ3A 2NTFB 4JFZL 5IQ9B 4PRIB 1IM9B 5TF1H 3FAWA 1B6DA 3L6FA 3QBTB 2WM0A 2P8PA 4LASL 4G3YH 3ECBB 2GUOA 3O4LB 2Q8AL 2AI0L 2HKFL 1FJ1A 4Y5VA 3SGDI 4LRIA 1HQ4B 5FV1L 1J0IA 2NY7H 2ZUSA 4JRYB 4PJFE 2YWYA 5DSCA 5GRUH 4LCYA 5GSVB 4HJ0C 1DQLH 3UTZB 1RIUL 3WMSA 4OFPA 3V52H 4PS4L 1HEZB 3A6OA 1BLNA 1S5HA 2VIRA 4J8RB 5GPRA 1QKZH 1OW0C 3WO3B 1ZXQA 4P46B 2NY0B 4FABH 1CDBA 5DMGD 1A6VL 3O6FD 1YQ2A 3QUXA 5MEQA 4UTAH 2AJZA 3WFBH 3DJ9A 3BPOB 5FM5M 4TNVK 3QUXD 4LCWD 1MCIA 2EC9T 3EFFB 5IR1B 3UJJH 1INDH 4R7NA 4H5SB 2RJMA 3QO1B 5IMMB 4GS7B 3EDJA 1V3LA 5IWLC 3RUGB 1MRFL 2DWEB 5JQ6L 1LO4H 4YHIA 3FT4B 1U58A 1T5WA 4K8RD 2DQIL 3NZ8A 3I3BA 1G7IA 2HT4C 4QRPE 3OV6A 3TN0B 3NIFF 3C9NB 1H8SA 3HZVA 3KWWB 4X4XA 5L88L 3ARXA 2VYRE 3SKOB 1MRCL 1EEYA 3Q6FB 3DMMD 3W0WD 4HEPG 4GRWH 5CILL 4FQJH 5H35A 3RDTD 3PV6B 5HYJD 1FL5B 3PWUA 2FR4A 1F2QA 3LEYL 2F8OA 2RFXB 3QDME 1SEQH 3VFSB 5EU6A 4OF3A 3T8XB 1QQDA 2X9YA 2NR6C 3ARDB 5LWYH 4WV1C 2YA0A 4M61A 4HKZB 3TLRA 4D8PB 4U6YB 4PJCE 2IPTL 4P2QE 2EO1A 3HI1A 3IFPA 1MFBH 4JEGB 1MPAH 4JZNA 3AXLB 2BNUB 3GMNB 4YX2H 4ZUVA 5GGQH 3FT3A 4HXAL 2CQVA 4RX4D 3WHE1 2DYPD 4LARL 3QQNA 1D6EA 3M1BA 5FYKH 1LO3H 4IRJD 2A73B 3T0EC 5ECJE 4PJBA 1UCTA 2FRGP 4Y4HD 1MIEL 3V0VB 1MCOL 2HWZL 3KR3H 5M94B 5TE6H 1CU4L 1RJYA 4NKIL 5T1LD 3QCTL 5D7SH 3AAZA 5GGRA 1ZHNA 3PL6D 3VRJB 4M6OH 3RP1A 3TBWA 3DHMA 3MRRA 3QH3A 1NUFA 4L5FH 3NN8B 4H0HB 4XC1H 1R0AL 4JFFB 4KC3B 4BSWA 1N7MH 3U4BH 3QNYB 3HNSL 1IM3B 1OTSC 1GCFA 3GHBL 4PJEA 1K6QL 4PTTA 4POYA 4K7FB 4M1CD 3VD4A 1CD0A 4LNRA 2IQAA 1XFPA 1RMFL 5MEND 1A22B 1CDGA 4U49A 2XN9D 3OSKA 5E6ID 2GFBA 2B2XL 5HYFA 4HWUA 3T2PA 2G75B 3MUGA 1UH2A 3QHFH 4LAQL 4G6FD 4XP4L 3WUWB 4KMTL 3S5LA 5IW3A 3RVVC 4K94L 4TUJA 3BD5A 1A9BA 2OM5A 2PXYB 5I8EB 2YD3A 4YUEL 3AU1B 4BUGA 3GM0A 3O6LL 4P59H 2PYFA 5IVXB 5C0IA 3MODL 2AXFB 2HKHL 2AS5M 5HHQB 5HDBF 2EKSA 3IF1B 3ULVD 4TNVF 4PJ5A 4POUB 5HVFB 4TVPE 3X12A 2DIAA 3GSQA 4HUWB 2QV2A 1KFAL 2XT1B 1JGDB 2XN9A 3QG6A 4FFZL 3F58H 5D6CA 3HKFA 3OKMA 2CUMA 1KENH 5C09A 1BHGA 4HIJA 2NW3A 5L2KE 4K8RH 3QXDB 1HSAB 5K9JH 2VLKA 5SV3A 5FM4A 4QWWD 4ODBD 5DVNA 4WI4A 3GMPA 1DUYB 4X7FC 5CCKL 5DMKB 4XNZC 3ULSA 4KTDH 1QSED 1CXLA 4RWHA 4YZFE 2GY7B 3FFCD 4OZ4A 5C09E 4ZUUB 5EO9B 1IAIH 3QFDA 3GSXB 4OSUH 2BVQB 3MV8B 3QUZD 5C9JB 1ZT1A 5F1SA 3VXNB 3H8NA 5H2BB 3BO8A 4WFGD 4Y4HA 5B8CB 2R2EB 4JCMA 4PP2B 3O6LH 4P59L 4UAOB 3RTQA 2E9BA 3FQWB 5IG7B 5I6XC 2VXUL 3LB6C 1UWXK 5HGAB 2FO1A 4G9FA 1UZ8B 4LFHD 2P49B 2BJMH 1EV2E 5JXAH 5F1NB 1AGFB 4YK4C 2B4CL 4Y16B 5D5MA 1YA5A 3TO4D 5KN5B 5I1JL 1KCSH 3C08H 4JB9H 1ZA6A 3IXAB 2VLLA 2A9MH 3GHEH 1PEWA 1NC4D 5ILTL 3PWVA 3DETC 3RHWK 3SBWC 2IF7A 3RA7L 3TBYB 3O45B 2IADA 4MJIA 3MLWL 3U82B 4OZIB 3MCLH 1BZQK 1PLGL 3VGEA 3FRUB 3A0OA 4U1MB 3MGOB 4L8SB 1SM3L 4KJWD 3GO1H 3MBED 4KTDL 2OMBA 3N1QC 1U2CA 3GB7A 3MACH 2WP3O 5FHBL 2AJVL 3QIWA 4YHZH 1F90L 3JWOC 4LDEB 1EAPA 3O8XD 1QEWA 4PJGA 4ELME 2EDRA 4PJAA 1OB1A 4JFDD 4YFLI 4JZJB 3O8XB 4D2NA 2V6HA 3V6BR 4OCWL 4OJFL 4DOHE 2GYSA 1DFBL 3LQMA 4X6BB 4R97C 4XXDB 3TCLB 2DQJL 5FK9B 1B0RA 3HNVH 4FQPA 5C0FA 1BD2D 1RZGB 1OGAB 1C16B 2R9HC 1FLRH 5HI4D 3VGAC 4YHYB 4BQCA 3B4NA 3MNZB 1DSFH 3OAUL 1YQVL 2ATKA 3DHJA 4LHUB 5CP3A 5DO2D 2VR4A 4H25B 2Z9TA 4XP5H 1LK3L 5I1KH 3F6LA 1FVEB 3QXVA 3QUYB 3W82A 2CIKA 4ODTL 1MHPH 5TQ2L 4HPYH 1H8NA 4YAQB 5IB3B 1NDGB 1F4YH 5DK2A 4YBLC 1A3QA 2HMID 2YRLA 5I30H 4WW1A 3TPUA 4QXTA 4JJHA 1WFUA 3U30B 1J1PH 4DQOH 1NDGA 2X05A 1CFQA 4TNWF 4YFLF 4YDJA 4YAQA 5DEGA 4NWUL 3SJVA 1KSRA 3TWCH 4ODHH 4PTUA 4HFWB 4LCUA 4ORZC 3EHBC 4LPVA 2FL5B 4Y89A 3P4OA 4WO4D 1GJIA 4I1NB 1E27A 1HDMA 4Z6AT 1TNMA 4WRLA 3X14B 2CMRH 1NL0H 1PFCA 5KSAD 5D1QB 5I1AA 2LVCA 4AL8L 2JCCA 3E8UH 3BQUA 3H9SE 3MACL 12E8H 1FZKA 5EWIH 2YUWA 5E00A 1R5IB 4MXQD 4W4OC 1T7XA 5IGXL 3V4UH 4AM0A 1U8OA 1JUFB 5JW5B 1G1CA 4LLQA 4XP9L 4ZNCD 1GOHA 1XIWC 1NCDL 4TTDD 1DVFB 4N9OB 3VFRA 1EFXA 4DWHA 3K4AA 2FATH 2Y5EA 1MRDH 4KK5C 1WFTA 2J1KA 1VEOA 3NIFE 1F58L 3HRZA 1JPST 3OKNB 1S9WA 3HZMB 4J3TA 1FIEA 3O45A 4MJIB 3PXJA 2D7TL 4FG6C 3FT2B 2XWJB 1J8HA 3WXWH 2VLLB 4O9HL 1ZA6B 1OARH 5HPMA 5HDOA 4Z7VF 1J7VR 4QHLB 1UH4A 1F4AA 3TIDA 5CZVL 3BQUD 4MCZA 1N2RB 4IS6A 1X6NA 4Q2ZB 2OQJA 3WIFB 4XCYA 4KJYA 5JOPD 1GGCH 4G9FB 1EVUA 4CRPA 4P9HH 4KHXH 2VUOA 3FB8B 3IU3A 4RZCB 2XTLA 3MV7D 2A6DB 3QP3A 2Y6SD 3MO1A 4AEHL 2J5LB 4YWGH 2R2EA 3VGGA 3S97C 4FABL 1XGUA 1MQKH 3OMZA 2G2RA 1VFAB 1ZT1B 1XAUA 3WFHA 2VLJD 4JFFE 4ZUUA 2VABA 2X6MA 5DK3A 3SKMB 4EDWH 4UTAL 2GTZB 3UJIH 4K71C 3U7AA 5ICYA 2IPTH 4JANB 4D9QD 1W72H 3U6RB 4KKLC 4OFIA 3MLXL 5FYLD 3TCXA 4O02L 3WDHA 1YMHB 4UB0H 4BM7A 1L6ZA 1QBBA 4ODUA 5IEHB 3BI9X 2BOCB 2LTQC 3BPLC 3MRQB 4ORGB 4G42A 2JJTC 4LCCC 3NCYP 2XTJB 5EU6E 1UACH 4MXQC 1CN4A 5DJ0A 4JO3L 1IC7L 3DURA 4ZYKA 1J0HA 5E08H 5DD1L 1U6AL 1EMTL 1HHKB 4F37K 2IBZY 3VFVA 4Z0XA 3WS3B 5I8EA 3V8CA 1CVSC 1LO0H 4OGXH 4PB9H 4X5WB 1CDYA 4JY5L 1UM6H 1IC5H 4X4ZA 4M4RA 4S2SA 1U91A 4OM1L 2MMXA 1YEFH 1ZT4A 3KR3L 3UYOD 3D69A 5C8JB 4AH2A 3S6CA 1DR9A 3E2HC 3G6JA 5CEZE 4J2XA 4L8SC 5I75B 4PJEB 5DK0A 5F7KC 2AEPL 5ALCL 3OR7B 2Q8BH 1KBGH 1BOGB 3MJ6A 3BH8B 5KJRL 2DWDB 2OTWB 1UENA 2NY7L 1I8MB 4LKXA 1FE8L 5E7BA 1NMCC 4OGAD 4R4ND 2QQQA 2B4CC 1YNTB 2PR4H 2HFFB 3BFOA 1S7WA 3AS3A 4U4BA 5E2TH 2VSCA 1D6EB 4OIAA 5TF1L 4URTB 5DJ8B 2ORBL 2VDQL 2OYPA 2HFTA 3U1SL 3O2DL 4ZUVB 3MOAL 2XFXB 3AXLA 5AAMA 1MCPH 1ULVA 3ZO0A 1TMCB 3MPCA 2R1WA 3D39B 4MJ6B 1IAII 1OLLA 2V2TB 4HW6A 3MJGX 1T4KA 4AT6B 4U6YA 3PDOB 4Y19D 2KL6A 5T1MB 4G6AC 3LKOA 4G8EB 3WIIH 4M5YL 4HKZA 4TRPH 1CLYL 2V2XB 2DQIH 3VFSA 2A77H 5E2UL 1TZHA 4OI8A 1BGXH 2FSEA 3NFPA 2FR4B 3MNVA 2VN7A 4KZDH 1RULH 3ERYA 1G9NL 5BO1L 1UXWA 1FHGA 1UM4H 5AYUL 1NJ9B 4QRTB 3BVNB 1N3NB 4Q7DA 4R4FL 3LH2L 1EMTH 2EE3A 1ZANL 1KJMA 1KIPA 5HHOA 3TN0A 4HUXA 3D85A 5DVKA 1HHIA 2J6EL 1OHQA 1NCNA 5EIVA 4IRSD 4Z95L 1U58B 1WEJL 3JWNC 4OKVA 3ZKMC 1G0XA 5HVHB 25C8L 2P8MB 3LN4B 4XMLL 1WEJH 4ZFGH 5TDPA 3UBXB 4B53A 2OX5A 3FN3A 3PQYD 5F96H 1MCLA 2RIKA 5GGVL 3MLWH 3CVHA 3QDAA 2I5YL 1SVCP 4K94C 3RDTB 2B20A 5IB5B 5C0AD 3W11C 3TVMC 1HH6B 1CT8A 2MKWA 4ZQKA 1J8HD 1FZOB 1UACL 3QRGH 4K3DH 2A77L 2CUHA 4GAJH 3MYJA 1D5XB 1MFNA 3QEUB 1I9JH 3OJMB 1MEXL 2EDEA 3K1DA 2R1YA 4CVWA 4Z7VA 2F19L 4HS8H 3QDGA 4ZO8A 1MHHA 1EFXD 4KY1H 4MWFA 2GUOB 3O4LA 2J4WH 5HHVH 4DGVH 1G9MH 4RAVA 3WNKA 1T1XB 1BIIA 2ZSVA 1WC7B 1SYSA 5KAQG 1KN4H 1F4XH 2FZ3B 4PRIA 2D7OA 2OI9C 1UJ3A 3TH3T 2ICEB 4UU9A 3V5DB 3RZCD 3O3AA 4PJHE 5CEZH 5FHBH 2RHEA 3QXTA 3TFKC 5BW7A 5CEYB 5JIIA 3KHOA 3EO0A 5B38G 1Q72H 3UX9B 1C7SA 2GHWB 1HIML 3AUVA 4CN1A 4KJQD 5L2KA 4YHNB 1EDQA 2Y06H 4PJ7A 2P1YA 1HHGA 1NGWB 2JIXA 2BMKA 4GUPA 4XHJC 1ZSDA 3CLEL 4G6FB 4GKNA 1JYVA 3TA3C 1YPZF 3MLTA 2AKRB 3OR6B 5FFLA 3TESA 3BP7B 1CIUA 3U0PB 1CDCA 4X9FA 1JF1B 4HEME 1TZGH 4NQED 5F89A 4K55A 2B2XH 2WIIA 3U36B 4TPRL 2QQLH 5JPMB 3EDEA 1WWAX 3RAJL 3TA3A 3DUSA 1T1ZA 2CLVA 3HPLA 1Y6MR 4F7TB 3AGVA 2MQ0A 5F7YC 4GMTL 4ZOBA 4DOHB 1HYSC 4JKLA 3AY4A 3CMGA 1HI6A 3D0LA 2ZP0T 4JDVA 4OFYA 1YYML 2JJUA 3HC3H 5D7IF 3R06B 4Y5YB 3RWDA 4JPWH 4GW1A 4APQD 1OAKL 3WUZA 1Z3GL 1CICA 5F3HB 1IGFL 2H32H 4M3JA 3ZDYE 5J12B 4HLJA 1HHHA 2E7LE 4ERSH 1IFHL 1HNFA 1WAAF 3TNNB 5HI3D 2XXCB 3QFJD 4OT1H 4PV9A 2BHZA 2VQ1B 4N8VG 4HKBA 3HE6A 2C1PB 1HXYB 2W0LA 3FN0L 5C0JB 1MWAA 4OT1L 2CKBB 2BDNL 4Q6IC 5BS0A 3VFGL 3L5WB 2AJXL 3QUMA 1FYHB 5JR1L 5HYJB 2YA1A 4MNQB 3P4MB 1S3KL 4X0KA 5J3HD 3GIVB 3VG0L 3OKLB 1KEGH 3E2HB 5IFHH 1FFOA 4Y4KB 4G80A 1MCNA 2VDLL 1KEGL 2F5AH 4QCIA 5DJAB 1JPSH 4AIZA 4LRNH 4M9PA 4RGNB 1BX2B 4GS7C 2QHRH 2NXZD 2BVOB 4PJ9D 2HN7B 4L8CA 3BN9D 3LN9A 3MLRH 4I13B 2PUQT 4GW4B 4JM2F 1UC6A 5FCSH 2QQKL 3ELAT 1MJ8L 4PRDA 1I3RB 4P0DA 1S8DA 1F4WL 4DK3A 1DLFH 2RCSL 4QOKD 3QUXC 4GAYA 5FOBB 1DSFL 3OAUH 2DKUA 2YD2A 1C08A 3RA7H 1AP2A 1EUUA 1SY6A 2IANA 3RTQD 2ZUQC 4PJAE 2Q7YB 4UIMA 1WFOA 3QHZL 4XWGH 3V2AR 1FNEA 1NC2B 4HSQA 1VEPA 2GTWB 1D5BA 4D0BB 3BEVA 1WK0A 2P5ED 1AO7B 1WZLA 1YDPB 2I9TB 4XVTH 1F42A 3T09A 1ZGLM 3EJZD 3MBEB 4Q9RH 3PE9A 2BOBA 5GJTH 3FO2A 1RMFH 3VXRE 3LIZH 3RRQA 3CSBA 3CMOH 4WI7A 2MHAB 1JMZA 1FN4A 1WZ1L 4LSVL 5LAXB 4CL7A 4HZLB 1BQHA 4YNYA 4P2RE 5MEPB 4MJIE 3S36L 3CC5A 4PRPE 4C54A 4Y88A 5C07E 3V5KA 2DQEH 3CFJA 4RMVA 3EOBB 1U8MA 4OLZL 5AYQA 2WIMA 5ALBL 5HI5D 5TE4H 4Z7WF 1C5DA 2AXHA 2W9EH 4NN7B 4YH6A 5EU4B 3FMGL 2QEJA 2VSDA 1NCBH 1MVFA 4U1LB 1EJOL 4BFIA 5EZIH 1P7HL 1E4JA 4CMMA 1AIFB 1UA6L 5FUOH 2X9XA 5T3XE 2X70B 5I16A 1J86A 2IQ9H 2NY1C 3QDJB 2ED7A 2R2CA 1KPVA 1MWAH 3GSUB 5CUSL 1RZ7L 4PRAA 1R5VB 1FVCB 3EJYD 3LQZA 5F7EL 2D3VA 1ZTXH 1EHLH 2DKSA 1EEZA 5EBWA 2FX8L 3VWJD 1D6VL 3QUML 3CFIC 4KROD 5D9SA 3ARGB 5FECA 4JFYB 1CGYA 1EAJA 3MV11 5CMAB 4OFDA 1VGKB 4I0CC 3R0NA 2EE6A 4KI5D 4QRPA 1CFVL 5D2NA 2WWKT 5KOVC 3IDXL 1NBVH 2GITA 4NQVA 4S1SH 5I18H 4R3SB 1MRCH 2J6EA 1DN0A 3HA0A 5C0EB 4DKEH 4IRJA 1FYTD 2VXTH 1RJCA 1JV5B 1EO5A 3QJHA 1H3GA 3MFFA 4M7LL 4NO0B 2EH7H 4MVBD 3CH1B 1LEKB 4PJ5E 4MYWB 2A74B 1PSKH 3LH2H 3O4LE 3C6LB 1YMMD 5I19H 4LHUG 2R23A 4CNIA 1GHFL 3CVHL 4DVRL 3OKDA 3HC0A 2JK5B 2R2BB 5EC1A 4XNYL 5ACMA 1G9NH 1HKLH 5SX4H 1RZ7H 4FXKB 3QSKB 1C5CL 4OLWL 4HUVB 1JVKA 1NC2D 2NY0C 3SDDA 5BRZA 3VRIA 3L3IB 5EULV 3KLSA 2R2BA 4HG4J 5CBEB 2N7BA 4PGEA 2NXYD 3CK0L 4DFIA 1PBYA 1ZOXA 4LDOB 4RAUA 1H3WM 4MA3B 3TIEB 4IOFC 3I50H 3DMMA 2Z31B 4L4TD 4EQ2A 1JWUA 4M48L 1KXVC 1IGJA 3TJHD 5ISZB 4OUOA 3CH1A 5D1XD 2W60B 4MA1B 3QRGL 1WBYB 3DLQR 3KXFA 4XMKH 4KRPB 5C0EA 2WBJD 1IAOB 4TQEH 1NFIA 4HK3N 1J8KA 2IH3A 3L3GB 3ARPA 4FOMA 5E2UH 5K9KA 1OVZA 3P77A 5FOJA 1K8IB 4LGPB 1G7QA 4Z77A 4QRPB 5DQJB 5I74B 1JWMA 1U95B 4MA7H 1QBMH 1X5AA 3MRPA 3HZYB 5EUKA 4JN2B 1SJEB 5IOPA 4KQ3H 3KVQA 5HYQA 4W70A 1A64A 3LQZB 1G84A 4OUUB 2HJFA 3VDCA 1U8LB 3GSUA 2VZ3A 4PJIF 1BBJA 1KN2H 4G8GA 3RWCB 3RGVC 4WHYG 1DQJB 3WNMA 4AEIL 4NKDB 4ENED 4L4TA 4O02H 4F15B 1NCCL 4MS8D 1PW3A 1JMXA 3KJ6H 2PTTA 2EH7L 4KVNL 4U1LA 4PREB 4OIIL 2F58L 4K71B 2WBKA 1YY8B 5BW7C 3JV4B 4JLRB 4LLYA 4JVWA 5TH2B 5C08B 3QXUA 2Q8BL 2XKSA 5EBLA 3EOBA 5C0CA 3V5KB 1FFPB 4N5EA 1HXMB 4NQDA 3NAAL 3H9ZA 3C8KA 3RWHA 4LVNB 4W4OA 1T5XB 3K80A 1AHWA 1P4LA 2XA8H 1G7MA 4Q6IA 4P9MH 2NMSA 1MVUA 1WCQA 2A6IB 2OR9L 5EUOF 5ITFB 4KK9C 3BQUC 4HJJH 3MRGB 1OGTB 3M8OL 1XF5B 5E2TL 2ZCLL 2V7NB 3INUH 4YDKH 3FO2B 1S7TA 1T1WA 2DM7A 4PB9L 3W5NA 1NBVL 4ZTOL 4KZEL 5FKPB 2COQA 5FHAL 1AO7A 3KLHD 5IQ7L 1L0YA 3I75A 1D5BB 1MJJA 4CMHB 4Z7QF 4ZFFA 1N0XL 3G5YB 5EIQA 4YPGA 4U7KA 3E6HA 5J57B 4P5TD 5D7SL 1GRWA 5HYJE 1E4XH 1NPUA 5FKPA 1F00I 1XZ0B 1NGQL 2K1MA 1E4KC 1A02N 3QIUB 4XPTL 1I85A 1YYMH 3NACL 4LNVA 3BMVA 4WUUD 4OD3L 4GW5A 2OR8A 2IAMD 1OGTA 4JY5H 1OD9A 1Q1JH 1M6OB 3IJSA 3GMLB 4S1QL 3O9WC 3QAZB 3HAEH 4Q6IB 3AVEA 4G7YL 3PWPA 3C5ZC 3WIHA 4DGIH 1OARL 4X7TB 5HTSA 1QFPA 3GSNL 5DJAA 2FX7L 5IHZA 3LPWA 3SO5A 1T3FB 2EH8H 3MA7A 3WIIL 3MLPA 5C0AA 3DI3B 3G5VB 4H8WL 3LSOA 1U8QA 1XF3B 5A40E 3S8WA 4HHAA 1N4XH 4J1UB 3GIVA 4HDIB 1IAMA 1E28A 3ET9F 5CZXD 3GSRB 5E9DD 1URLA 4GQ9H 1ZT7B 5BS0B 3RWIA 5JPNB 5D7IE 2CKBA 4KQ4H 3JWDL 4JQXA 3VI3F 5C0JA 1AHWC 2J8OA 4K7PL 2NY5L 5IBTL 4NKDA 5LXGL 4KRPD 4LHJB 4ZS6D 5EB9A 3UDWC 1A7PH 3GJFA 4WI6A 1YEHH 4GRWF 5SWZB 3D6GA 1FGVL 3DVFA 3EDKA 4G6ML 1UKQA 1RIVL 5CHNB 5KSAB 1S78C 3QULB 3T77A 5I8OL 3EUUA 3MRDB 4XVSH 3Q5TA 4M6NH 4RNRA 2ZOLB 3LRSB 5INDB 1FG9C 2ADJA 2VKXA 2AV7B 2PO6A 4ERSL 3F5WB 1MUJB 5TQ2H 8FABB 4Q9CA 4P2RB 2Q7NA 4CU6A 2ITCB 4XH2B 1KTDB 4F7TA 5K9KB 3P3YA 3TA3B 1NFIB 4LPWA 5KANI 2HG5A 2M2DA 1BJ8A 2H32B 3KXFB 5GGUB 4FTVE 4ZXBC 1UB5B 1ZHLA 5IB4B 4KU1A 4NJ9L 2APVA 1JF1A 1XGPA 3PP4L 3SDAC 4QRQA 1DE4B 4P9HC 3U0PA 4U1SA 3MA9H 1JNHA 4D9LH 1I9JL 3KYMB 5DT1H 2J8UE 4LVOC 4NRZA 1AE6L 3SGKA 2EIDA 4X99A 5BZDB 5KVDL 4HKXA 3ZT7A 1KIRB 2CJUL 4TVPL 3V6FB 3VXUE 5KTEL 3GK8L 4JKWA 1FRGL 1M7IB 2JK5A 4OLZH 2CD0A 3TT3L 4CVZB 1F6LL 4WFFE 3K0WA 2V2WA 4OD1H 1LD9A 3NOIA 3GZKA 1QSEE 4MMZC 2A9NL 1NBYA 5FUCE 1JV5A 2GY5A 1UB6A 2Y06L 5CGTA 3RAJH 4X6CF 3RWEB 4LSTH 3GI8L 1G7PB 4JFEA 1K4CA 2DB8A 4MAUL 4BSVA 3IDGB 3I85A 3W11D 3O0RL 2Z35A 1H0DB 4FFYH 5LGKA 2OXHA 1VGKA 3WJLC 5CMAA 5FA4A 5E8NB 1E4XI 3BP6A 5DQ9B 4Z7VB 1QLRB 2WBJB 3R4DA 4GAFB 2CDGA 1FVCA 3MCKB 4N1HB 4NN6B 3K7UA 3SKJL 2UVFA 3MBXH 4UT7L 5H94A 1L7IL 2JB5L 2CRMA 4L5FL 4QYOB 2AEWA 3TF7A 1AXTL 3T65A 4KV5F 4XP6H 4LLVA 2LE9A 4CMMB 5LGJA 5L8KB 1NSNH 3HUJB 3LS5L 1ZANH 5IIEB 4KAQL 3W81A 1Q9OA 5DHYA 4ETQB 3FO0H 2OSLB 3UTTD 4TVPD 2FATL 3G6AA 2LAGB 4L8DB 4S1QH 4F7CA 5HHMA 4NHCL 4PGDB 2PYEA 4I3SL 5E9DE 1T21B 3ROOA 3CGTA 2JIXD 2OXGA 4WW2A 2BFVL 3ARBC 4X9BA 2ZJSL 1NCWH 1GH7A 4NN7C 1E6OL 1LK2A 3SDCB 3IFNH 3GGWB 3BVNA 1A7RL 4UT9H 1AQKL 4PBXA 1D9KC 2BSRB 4U1HB 2Q6WA 1KB9K 5IJVA 1C12A 2QTEA 2DLEA 5ITBH 2CO6B 2X4UB 3BKYL 4WU5A 3RZCA 3WHE0 1NBZA 1QSZA 4K3DL 4X7CC 5DUBB 5DZOA 1V7MH 1LNUA 2ARJB 5GIRB 1RUMH 4G8EA 4GKSA 2NY3C 1MFEL 3RGVD 4AT6A 3KPPB 2BNRD 4NC0B 3DGCR 3GI8H 1ND0B 4H20L 1OSZB 5D7IA 3WXVL 2BNRB 3O3BA 1CD9B 5JOFB 1CLZH 1A7OH 1CFNB 1C08B 5ANMA 3O3BB 3HZKA 1IVLA 2EC9U 4U3CA 1AY1H 2JKXA 3MCG1 2YD1A 4JPVL 3D39E 2ICWA 3WKNA 4ZS6C 1S8DB 3CXDH 5DUPL 1MY7A 5IVOA 2ATPB 4APQC 4GKSB 4Y4HC 5C08D 3DX8A 2Y07H 3DOSA 3L3DA 1J1XH 2JELL 5DUBA 3GK8H 2HN7A 5JIHA 1MIEH 2VDPH 1H3PL 3CVIL 1EO8L 2UWEB 1UXSA 4WVRA 2JE8A 1C12B 4CU8A 3N0PB 3OR7A 3RY5A 1MH5B 4GSDL 3SPVA 1K4DB 4NKOB 1FFOB 3GBML 3P9LA 1LK2B 3TV3L 4OGYH 2EKJA 2R15A 3C5ZD 4WUKL 4AH2B 2W1NA 3I3DA 3TJHC 1QYGL 1LQVA 3L5WA 4IOFD 4EOWL 2OLDA 2IAMC 1U91B 1CDIA 2C1PA 1E4WL 5ETUA 5HGDB 1TZIA 4XCNA 1LP9F 3TNNA 5LWYL 4KTEL 4X5WA 4ZPTB 1QBML 2XTJE 3WS3A 5LGJB 3R0MA 1I7UA 1JK8A 3EYQC 1DJSA 2AJ3A 1D5ZB 1LO3L 3RQ3A 2XZQL 4OB5L 3D2UA 2F5BH 3NA9H 4PJXF 3R06A 5I1HH 4LHUD 3MLXH 3TFKD 4O2EB 1RZ8A 5E2VL 2ZUXA 4NZUL 4P4RA 1A6AA 3LKQA 3TYGH 1QLRA 2QSQA 4MAYA 2F53E 2YKLL 2UZYB 4Q0XH 5C0ND 5K93A 3DUSB 1DQML 5IROA 1JZ8A 4J3SA 1H0DA 4WWKC 1IBGL 2EZ0C 4MLSA 1KTKE 4OD3H 2VMFA 3U36A 3DUUA 4LLDA 4NOBA 3V6OE 4X6DB 3MV9D 2E7CA 4OLEA 5E8DL 5JHDD 2C4XA 5TDNA 4YJZL 1G7PA 3VMNA 4BQBA 3O2DH 4NJAH 3NAAH 4X80L 4UUJA 5D93B 1MAML 2DQTH 4DCQB 5CBAB 5EORH 3VWJC 4OBSA 2AGJH 1SMAA 1XGUB 4NO5B 2Y1VA 1B3JA 1JGVL 3ZE0F 1F3RB 4GKNB 3KJ4C 4MQXD 4ONOA 3PQYE 2WY3A 1BD2E 4GUPB 3OL2A 3IU3B 4RZCA 1NGWA 4I48B 4CVZA 4N0YL 1J5OH 2BSSB 4YHOL 2NY1D 3QDGE 4KJYB 2DD8H 4XCYB 1U3HC 4KZEH 3BMWA 4K3JL 2YC1B 5AAWA 4HKJB 4MXWL 3U46A 1J8HB 1XIWD 4KKBC 4LHQB 1LE5A 3HG1A 3O2WL 5E2WH 3HMXH 4L9DA 2FZ3A 4XZUA 4OTXL 2VJXA 3KXFE 2FX8H 4Z95H 3BZEA 1T1XA 5DDHA 1NFKA 2UUDK 1P9MA 4O9HH 2HG5B 5C2UB 3S88L 4RISL 4D9RE 1EFXB 2EYSA 3U7WH 1QD0A 2I07A 2ITCA 4PBVC 1VFBA 1T0NB 5DQDL 3BIAX 4Q97A 3QNXA 2ZOLA 3LRSA 3BIKB 3UYPA 4C59B 4M5YH 4ZPVA 2XYCA 1T2XA 1FZKB 2NY4B 3UJTH 4N0CC 2VWEE 1DQQA 4WNQA 5HHPB 3LMJL 4HF5L 1AKJA 3BT2H 4Y0GA 5IV2B 4OF5A 3ZHLA 3PIQA 3D25B 4AIOA 2E8YA 1EERB 2YZ8A 3P4OB 3KPRB 5DYOA 3X3FL 4F9LC 3LKPA 3HS0B 2DM4A 3SJVB 3G6JF 3GSRA 1F4XL 1KN2L 2AV1A 2EDXA 2VN4A 1HHIB 2OMNA 3T2QA 4HUXB 5GRZA 3CFEA 1UFUA 4LVHB 1JWSA 3EYQD 1N3NA 3TPUB 3G5VA 1Z0NA 4U2ZA 1HQRB 5FDWB 5J4MA 4FXGA 3P30L 4N8PA 3GIZL 3H9YA 3HE7B 1HKFA 5JZ7D 4V2CB 5BQ7A 1JZ2A 3A6CL 3PF2A 3QA3A 1HK6A 3OKEA 4WEMB 1FLRL 3LRHA 4GW5B 3KJ6L 3PDOA 2X7LA 1IC7H 1JYNA 1XZ0A 5HI3C 1OT1A 3B9KA 3O8XC 5I1EH 1A7QH 2HFGL 5E03A 2JJSA 1JHKH 4LGSB 1H8OA 1J18A 5HGGS 5C0RL 3PP3K 1C16A 4KV5E 3SY0B 5LCVL 3MV7E 1RZGA 5GJSH 2H2SC 1S7WB 2ZUQB 3RKPA 1KNOB 5LQBL 1YNTA 4NCDA 3OKYA 2DIJA 3T0VA 1JZ5A 4RWYH 2GK2A 4UDTB 4LKXB 5E5MA 5T33H 4P23D 4QOKA 3QIWB 1XF5A 1B88A 4OAWB 5CEZD 1SJHA 5ITFA 3VXRB 5TQ0L 1G7MB 4L4JA 5BO1H 1INEH 1QHPA 2FWOB 4L8SA 3VXQB 3RWHB 2CGRH 1MAMH 2FNBA 2PW1B 2R0ZL 4JGJA 1P4IH 4WUUE 3LB6D 2YOCA 3WL9B 3OJDB 1HXMA 2YN3A 2B8OT 4WIQA 5C0CB 3WSQH 1NANH 5F1OB 2NX5B 3SJVD 4JLRA 4LLYB 5IKCA 5EU6D 1U3HA 4HBCH 5KN5A 4OZIE 3EYUH 2R56H 4X6FB 2LVEA 1TJHH 2UZXB 1AGFA 4XHJD 3LCYA 4L4TB 1E6OH 3TZVA 1JPTH 1IEAB 3RWCA 3S3JA 3EOTH 2MQCA 3T0DA 1ZGLP 5DJ0B 5CCKH 3QEGL 2JJWA 3FQWA 3RTQC 4Z7WE 3O41A 4K3GA 3MNWB 2WWMD 1VFOA 4JQVA 1PDKA 2WUCH 3E3QA 5HYQB 5EUKB 3JSSA 5EO9A 3FB5B 1N26A 4OLVL 3OF6A 4OF0A 5IESH 1QACA 2EYTA 1AGCA 1FQ9C 1DUYA 1I1FA 3ULSB 3UMTA 1KOAA 3MREB 1GZPB 3CMOL 1FSKB 1HILB 4KQ3L 5GS0D 1MQ8A 4I77H 3LEVH 1A6UL 1BQLL 1HILA 1U36A 3SO3B 1DBAL 1OAXL 2IH3B 5GISL 3MJ9H 3OKMB 5DF0A 4O2FB 4B7LA 4BZ2L 4IOSD 3FQXB 1ZMYA 1NCWL 4U2YA 3L1OL 15C8L 2V9RA 3NH7L 4PJ5B 2XWBA 4PJGE 3VFNA 4NO2A 4PV8B 2VDPL 5BZWA 2HTLD 4WV1B 3BP4B 1FFNA 4NDMA 4OFKA 3TZVD 1RAMA 3H2WA 2AJXH 5A16B 1T2QH 5DHXB 4Q6YA 3BZ4B 5BRZB 4JRWA 5I1GH 4P23C 3KNBB 4G9DA 4MLIA 5K9QG 3WUWA 1NC4A 1RJZA 4Y8AA 3O3EB 3HC0B 1GAFL 2GFBB 5E4IA 2QHRL 4FQCL 4C4KT 3H6JA 1KV3A 1TDQA 2NXYB 2CR6A 2IQAB 4IRJC 2A74A 3WL9A 5ILTH 4PP1D 4J3UA 2NXYC 2I5YH 1YMMA 1EEQA 4PTTB 4NO0A 4HK0A 3BIBX 4ZSOA 5GS2D 4ELKA 1EH9A 4UV4H 5DGRA 1IM3A 5D1XB 2N56A 3QNYA 3VXRA 4BSWB 2D2OA 5LQBH 2WSKA 4RGNC 4YC2C 5E5MB 3MRRB 1VA9A 2NCMA 5GHWH 3WS6A 4BFEA 4DEPB 3PGDB 5GGRB 4OQ1A 4H1LG 4LLQB 3GI9L 1KNOA 5IJKC 4NQUA 1XF1A 3FFCA 3SDAD 1CK0H 4WW2F 3GM8A 2FYYA 4JFYA 3MLYL 3G5XA 4DW2H 2VZSA 2D7PA 2CK0H 3T3PF 2G60L 3GMNA 5L6YH 2CLRB 4P48A 4S1RH 1IBGH 4JZNB 1M7XA 3BE1L 3MJ8A 5DFTA 3DWTA 1RHHA 3X14A 3K2UL 3QPXH 3HI1B 2VR9A 3RJDA 1J1OH 2J3SA 3FQTB 1DBBL 4D8PA 2CKBH 2R56L 4M4PA 1HCVA 1BQUA 4PG2C 2P43B 1OP3H 1EGJH 4NKMA 1CLOH 1RD6A 4LCUB 3P0YL 2FHBA 3LEXA 4JR9L 4B50A 5DEGB 1Q72L 2CRIA 1RUKL 2HLAB 4OB5H 5HVWA 1WJ3A 5EU4A 4TPRH 3EJYC 5H35B 1EEYB 3Q6FA 2JTDA 4F33A 2IPKA 2HKHH 3CC5B 3QCTH 5MEPA 5DK2B 4LEOB 2PR4L 4KJWC 4TUOB 4L3EE 1FN4B 4RFOH 2MHAA 5A3ID 1P84J 4YHIB 1MHCB 2EIZB 2PETA 1LE9A 1FVEA 4Z76B 3BYTA 5MENA 4ZUWB 3QO1A 3CXHJ 5CZXC 5IMMA 4R7NB 3WFCH 3OBAA 3A67H 3NZHL 1Y18A 3PUCA 3RNKB 5IR1A 1N5YL 4DUWA 2B5IC 4W81A 4QHNB 4E9LA 3D25A 1DBKL 3MNZA 1DQLL 4U1GC 3X3GL 3D3VA 5HHPA 3MLUL 1W8OA 5E4EB 5C07D 4UIMB 3TVMD 1OW0A 1XCQB 4M6ML 1KCRH 2QSCL 2Y23A 1T7YA 3BIKA 3GBNL 2E27H 2VIRB 1X5FA 3QNXB 4F9PC 4ZFOL 1NUGA 3QUYC 4GAYB 5KVEH 3HNTH 5KSUA 4LF3B 2E3VA 3S4SB 5GSVA 1VGEH 4PRDB 2VOTA 3LEVL 4NM4H 1XCTA 3FB7A 4WI2A 1P7QA 1CR9H 1AGEA 3FAXA 4AZ8A 1MCWW 5IHUL 3P0VH 4I2XE 4XCEA 4Z7VE 4QXUH 1H5BC 4UBDD 1ZVYA 4LVHC 5IQ9A 4LDLB 3BDXA 1LE5B 4MQXC 3BHBA 2DQHL 3JV6A 4GRLC 2BZDA 3QQ4B 5HYJA 2ZNXA 1JNLH 3VXPA 1RUAL 2Y6SC 1XF4B 5D5MB 1DTUA 1MWAB 4PRHB 3MV7B 4HKBB 5BS0D 1BM3H 1FCCA 3OX8A 3BAEL 4LMQI 4I48A 4QF1B 4QKXB 3QZWA 2VZOA 2F15A 3RUGE 5IROC 2X89A 3ARUA 4IJ3C 4O51B 2QJDA 1TXKA 3RBSA 5F3HA 5C0BD 1KPUB 4S11A 4W4NA 2YRPA 5CBAA 1JHKL 2JB6A 3THML 2K7PA 4JKMA 3QR2A 1J11A 3MRIA 3GMPB 4V2BA 1A5FH 2EDQA 4JN1L 2VLKB 4BFGA 2ZKHH 1T83A 3WLBB 5C0CE 3QDMB 3T4AA 3DRQB 2L7JA 5E6IB 3WLBA 3QG6B 5DLML 1KTRL 5GS1A 2HRPL 3CUPA 4TN9A 1JGDA 4MXVF 5JPMA 1Y6KR 5TF0A 1I1YA 2K9UA 2A2QT 4KRPC 3VFPA 1P6AB 2FGWL 4X4MA 3QWOA 4HUWA 3VCLA 4O2EA 3B6SA 2EDOA 5F6IB 4C58B 2I9LA 2BNRE 3IF1A 1WAAA 1KB5L 3JWDH 2H2SD 2R4RL 5HHQA 2R29H 3MLTB 2AXFA 3OR6A 1A3LH 2E6JA 5C0IB 2VLJA 4YPJA 2JIXB 2WBJC 5F71A 1ITCA 4TVSa 5C6TH 3JXAA 3C2AH 2GKIA 4QTHA 4JFPB 4DN4H 1TZIB 4XCNB 2KZ1B 2EIBA 1RJLB 4EBQL 3MV7A 3P40A 4U6VH 4QHUB 4C55A 4GG6A 4WWID 3QCVH 3U0TA 3NPSC 4BKLB 4LKCB 4MB3A 3VXPB 4U1JA 3VWJB 4HUNB 3C09C 3E0GA 1KLFA 3RU8L 3KYOA 2N1KA 1OWWA 3P9LB 4CADA 5E8OA 3JV6B 1YPZB 4UAOC 3BHBB 1AXSA 3LQAC 1UJ3B 3SPVB 5EA0L 2KPNA 5I6XB 4JFFA 3NTCH 4XRCA 1AQDA 1WWWX 2R1XB 1BIIB 2ZSVB 1UXSB 2CO7B 3FZUC 5BV7C 4PY8J 3UTSE 2R0KL 3TT1L 1RJYB 1AGEB 2C7UB 4U33A 3WFBL 3GMRA 4F7PB 5D2NE 2P5WB 3FB7B 4WDIB 2VLRD 4FZEH 2DJSA 4HT1H 3M1BB 4MD5B 2Q1EA 5E2JA 4EDWL 5D2NC 4JREC 3RZCC 1MJ8H 3NCYS 2B0SL 2R1YB 1TETH 4PRHD 3S4SA 5KSUB 2BVEA 1MF2H 3HZKB 4HCRA 4G8GE 2AW2A 4Y4KD 1CDUA 4KK9D 1L6XA 5JOFA 2BNRA 4CVXA 5D7IB 2PF6A 5JORA 5KSBB 1XCQA 3U0WH 1CT8B 4XP5L 3CJJA 4HLZG 4CJ1A 3NCJH 3REVA 5B39G 2Q8AH 4OZHF 5EZLA 4NC1E 5EU6B 3KPSA 4YEFA 1KJ2L 4F7MA 3PDDA 4LLWA 3LN4A 5D6DA 5EU7E 3V4UL 3PQYA 1V3JA 4HMDA 4Z76A 5ISZD 4MS8C 3FQNA 3DO7B 2O61B 3ZMRA 4WO4A 1FDLL 3SDCA 3UYRL 3HZVB 5F44A 1ZEAH 2ADFH 2X4NA 2IPKB 1R24A 3TF7C 2YSSA 3D85D 4P5MA 1FORH 5GS2H 1MQKL 4KUZL 5EUOA 4HUKB 1QR1B 3PQYB 1OGAD 5HHMB 4PJIE 4LLWB 4E41E 5MP6L 4F7MB 4HGWA 3DV4B 3DXAB 4TTDC 4RMQA 35C8L 1TZHB 5AWNH 1U0QA 2V2XA 5EZLB 5DLMH 1JN6B 4XMKL 1NKRA 4QY8A 3FONB 3TYGL 4O4YL 4XTRC 3FQTA 2FD6L 1VERA 1SY6H 2BSED 4Y2DA 1JJUA 2AJSL 4E0RA 2IANE 1HEZA 5K9OB 2XFXA 1F4HA 5FGRA 3EZJB 3V7AG 5DQ9A 1U2HA 1Z9MA 5DC9B 4WDIA 3FFCB 1PZUB 1CGUA 1S9YA 3SEPA 2VR5A 3GMRB 2VDQH 4M5ZL 4F7PA 2X1PA 5DVOA 2Z35B 2C7UA 2IEPA 1MFAL 2P8PB 4OIBA 4ODVH 2EZ0D 1LDPL 4OCXL 4ZAKA 5LG1A 3BH8A 3OB0K 2V5YA 5F70A 1GPOH 4NCC2 4LPYA 3WNNA 4IMKC 1OAQL 5C0NC 3WE6B 2ITDB 4Z78A 3OAYH 1AXSB 1LMKA 1NBYB 3LKSA 4Z7OF 2VXTL 1R5WA 5BV7H 3NA9L 5C8JA 2OZ4H 3CFDB 2V2WB 2R0LL 3U0TB 2BY3A 3GMOA 3U9PH 1XGRB 2HYMA 5KW9L 5D6DC 4MJID 4OLYH 5DD0H 3KNBA 3ZHDA 2Z8SA 4CVUA 4YDVB 4NRZB 5BZDA 2DQUH 2DF3A 4HLZH 1GGTA 2UYLA 4N0CD 1E4WH 3UC0L 4ZFOA 4NDMB 1FFNB 2G5BB 4BH7B 3EYOA 3ME0A 3DURB 5IB1A 4BZ1H 2FIRT 4OLUH 4U1SB 1CFVH 3EBAA 5FDYA 3SDYH 4M00A 1ZHKB 2BVPA 3SGEH 1CQYA 2AI0H 3QWOB 5GSRA 4ORGA 5GGUA 3RKDC 4WGVB 4RAHA 1UWEL 1S78D 3CUPB 4P3DB 3DUHA 4FS0A 3DRQA 2YRZA 2APWA 2XZCL 2Y25A 4XH2A 1Q94A 4DKDC 4NUGL 5BMFH 2E5EA 3NCEB 1GZPA 4HIHB 4MXWH 1AXTH 2ADJB 1BAFH 1X5LA 4RNRB 3OG4B 2MJWA 4S0UC 1CXFA 3FB5A 2FB4L 2VABB 3O4OC 5IFAH 1A7OL 2CDFB 5FYJL 1AGBB 5I71C 1C5BH 2G2RB 4DVBB 3MNWA 1K5NB 5CKGA 3DTXB 4JY6B 4WEBH 2PYEE 4U05A 2VQUA 5IBLC 1N0LA 2XTJD 4K8RL 4M1GH 4NZDA 3TZVC 4X9GA 5IFJA 5FO9A 3TZVB 1IQWH 3C5ZA 3VRLE 5KZCB 3ZDYF 1FNAA 3NH7H 5FB8A 2IGFH 4QO1A 4ZUTB 1VKXA 1XF4A 3X3GH 4C56D 1LO2H 5HPMB 5JA8B 1AQKH 5J7CC 4HDIA 3ZE0E 1QFWH 2DQCL 4F37F 5FYKL 5T1KA 2ICCA 2BNQA 3J8F7 2WQRA 5ABDE 5TPWL 3VW3H 4X7TA 1DCLA 2PW1A 2Z31C 4MD4B 4Q58C 5I1CL 3H7BA 1REIA 4P49A 5I73C 3WNLA 4Z7WA 3GMLA 2UWEE 5I1IH 1P7QB 5DI8B 5EIIA 1A8JH 4QOKB 1XCTB 4W6XB 4A2LA 1Q0YH 4UDTA 4DN3H 3THMH 4HULB 1JZ7A 2EXWD 2R39A 3CD4A 3Q48A 3D0VA 4UBDC 4Y16C 2NXZB 2YUVA 3TEUA 4ZFFB 1YEKL 2YPLA 3MBXL 5HSFA 4UT7H 3VFGH 3D3VB 1JHLL 2NZIA 1RZIA 4GKZA 5D1QA 4EN3A 2DS4A 3B9KB 1MJ7L 5JLZA 3DYOA 2X7LB 3T0AA 3RPIB 4XNUH 1T1WB 1T2JA 1S7TB 1MLCB 4HX1B 4FFYL 3WO4C 4B5EA 1MHCA 1RI8A 1AC0A 2W91A 3QA3B 4IMKA 4LCWE 4LBEA 5GXBB 1H3UA 2ZG3A 4M1CC 4N5UA 1T5XA 3HE7A 4WFEE 4FXGB 4HV8B 3PHSA 2F19H 1NUDA 1CFQB 1CCZA 3MROA 3UPAA 1K6QH 4QXTB 1FFPA 1LDSA 3NCBB 3O6ML 1FAIH 1RZFL 4IHOB 1F3DH 1WISA 3G6DL 2J4WL 5HHVL 2UVEA 2HLAA 4U0QB 3HI6H 1B4JL 4KFZC 2AV1B 4PREA 2ZSWB 3HS0A 1F97A 3LEXB 5DJ6A 5A3IC 1MCOH 2X4RB 5A43C 4IIQC 4MJ2A 4F3FA 2QSCH 4RGNE 1I7TB 1CK0L 2Z92B 3ABZA 3ZE2F 1RUKH 1PVHA 4RDQG 3MJ8B 2HJFB 2ZCKL 3EOAA 2BVTA 4WNQB 1NFDF 2I60H 3ZKSD 4EBQH 4G5ZH 5C0FB 2VAJA 3RL2A 4FP8L 1A7RH 3V5HB 4XXDA 3LZFH 1L8JA 5F7FA 5DQJA 1T0NA 1KIQB 2OJZH 4ZFGL 5KVGL 1OP5H 4XWOC 4GKOA 5L9DH 2QHLA 1EAPB 3QIUC 5BJTA 2IGFL 2VRAA 4F2MB 4JVPA 3WDJA 1PKOA 1MNUL 4FQJL 2IBZX 2DRUA 1RUPH 3GB7B 5D1XA 4ACPA 1HN1A 4JG0L 2EO9A 4MX7A 2HT4D 3DVIA 5DDHB 4XB7A 5C70A 1NGXB 5IMKB 4XZUB 4MA3A 1UJTA 1LILA 4PS4H 4WUUB 3IFLH 4GAJL 2UUDH 3KLAB 3V4PL 1MCHA 2AQ1A 3QCUH 1DBJH 3SDDD 1RJZB 2AK4A 4C83B 3N06B 2XWTA 1U92B 4XNYH 2DBLL 3CX5K 1P5UA 3U46B 1QRKA 1QSVA 35C8H 4TSCH 4WEUD 4L4TE 3ROLA 1IGML 5A16A 4RMTA 3BP4A 5HGAA 4WTZA 5BZWB 3S36X 4NYLB 2F74B 4L29A 3VFNB 3ZDZE 1OAYH 4PP2A 3DETD 1FO0B 4NO5A 1MI5A 5SV4A 1FYTA 4NNPH 5DVMA 4EUPA 3O81A 1OTTC 5C9JA 4DCQA 2YXFA 1JHTA 1ZHBB 4HIXL 3QFDB 4IRJB 3FQXA 4UUJB 1GGBL 3ILPA 1ZLUK 3TO4C 1X4ZA 1CF8L 3U4BL 3VXMB 3RWFA 3WEXA 2YA2A 1IE5A 1ZAGA 4GXUM 3WN5B 4XPGH 2AABL 4N0UA 1OSPL 3RVTC 1KIUA 2YBRB 4XBPA 2GJ6D 4M93B 2HTLC 5D2NB 2J8UF 2R0ZH 3O9WD 3Q6GL 3GSOA 4XPGL 1LVEA 1AGCB 1I1FB 3VXSA 4KPHL 3L3OA 4Q9BA 4MAYB 1FH5H 5DJDB 5C09D 5EBWB 1H15B 2JELH 2XV6B 2ADFL 2ZCHL 1Z9OA 1OPGH 4JDTH 3W5MA 1MLBA 4PRAB 5KSBE 5T1DL 2XIDA 1SJVA 4QXGL 5DHVH 1EHAA 4CDHA 1QRNA 2AP2A 2X70A 4U6VL 1IEAA 3D9AH 2QQLL 4YIQA 3STLA 4U1KB 5E94A 1JK8B 3B9VA 3U9PL 4NO3B 1J0ZA 2OJEA 1I4FB 3DARA 2HJKB 4ZPTA 1A9BB 5E1AA 4GOSA 3TBVA 4JG1L 4ODTH 1JI2A 5I19L 5ADOH 1A6VH 1FNHA 4PJ8B 1BQHB 4HZLA 4YNYB 1F5WA 3QXWA 4Y7MA 2HRLA 1K4DA 4NKOA 1MH5A 1JE6A 1WTLA 2IFFH 1T0PB 1SJHB 3QWQB 1JRHL 4FHBD 1LWRA 5F7LB 3WHXB 3WCYA 5DS8A 5C6TL 1UWGL 3R1GL 4XB8A 4WU7B 3AAZB 5E2VH 3U1SH 1ZVSB 4N68A 3JWOH 3X13B 1GZQA 1UKTA 1CDHA 1RZKH 5ALCH 5F6HI 4LPUA 3DX8B 4L9LA 5JNYB 4YO0B 4PJFA 1RZKL 1MI5D 1AO7D 3SY0A 3FZUD 5FV2A 2V5MA 2IANB 4A2MA 1Q9LA 5KG9B 1R3IL 5FOBA 1OSZA 4J4PA 2ZOKA 4D9QE 4ZFZA 5LJYH 1TTFA 5J3HC 4YHYC 3LOWA 3NFSH 3BZDA 1NKOA 1FH5L 2Z0BA 3C2AL 2ARJA 4PYHA 1IZJA 4GW4A 1N6UA 1NBZB 3QO0B 4HIEA 4K9EL 3STBA 5IBUB 5BQ7B 2RFXA 3CH8A 5SX5H 2BVOA 3NGBB 2WLYA 2ID5A 5HGBA 1JTTA 4FZ8L 2BHUA 3M17A 4QCIB 4YHOH 4ZD3L 2CMRL 2DQDH 2D0HA 1Z6JT 2V5SA 2MNUA 4NCC1 1QR4A 4JRYD 3DSFL 4MS8A 4PP8C 2D7QA 2ICWJ 3KWWA 4K23H 3IB4A 4U1GB 5SX4I 3BDBA 4R2GB 4WW2B 1A7NL 3FTGB 5EUOE 4LSQH 1I9IL 2HAZA 3LMJH 4GXVL 4HF5H 5CP7B 4HQQH 2NLJA 1MY5A 3LKPB 1JTOA 2Y72A 4WI5A 2ZWLT 4XNMB 4JPKL 4XP9H 1TJIH 1H3VA 3UYRH 5A2KH 3IDYB 2OSLA 3EFFA 1FG2B 5IBUG 1A6TA 2NY0D 3PIQB 1HHHB 4NWTH 4LCWA 3HR5B 3SGDH 4GMSH 4DVRH 5MEOA 1AKJB 2YD7A 4K3EL 5F7DB 5MENE 4YWGL 4QTIL 3M8OH 3B83A 2ADGA 1B2WH 1KLGA 3MCKA 4KK6D 3QHTC 1CGSH 3P11H 9CGTA 1CF8H 3T0BA 4JR9H 5IW1A 1JPFA 2A6JA 5F9OH 2WBJA 1KF9B 5D7JC 3TA3D 4D94A 1MFCH 1NAKH 4OM0L 3JUYA 4L3AA 4KI1A 2EYSB 5KSVB 4XCFL 1EIBA 1YEKH 1P2CB 1VFMA 5DJCB 3ECBA 5K33A 3UPRA 1GGCL 5ADOL 5GRWA 5F89B 1NDMA 4EI5B 2W59A 4Z0BL 5J11C 3BP7A 3HG1B 3K81A 1UB6B 4QHKI 1VACA 4KROC 4RCAA 1ZTXL 4HJ0D 3P4NA 4PGBB 1LD9B 1WBXB 2H45A 3V6ZB 1QLFA 3LPGA 1ZSDB 3PWJA 3UPCA 3FCTB 4K9EC 2X4PA 3MJ7A 3VD9A 5L8LB 4UMGA 3K1KC 3PHOA 4ENEC 1FZMB 3IKCB 4PY7B 1M05B 1W0VB 2AEQH 3VFOA 4X80H 3F7PC 5CGMA 1PLGH 4LVEA 4NC1C 2VXQH 3IDXH 1LP9B 4PLNC 2XOTA 3I50L 2X4PB 3MJ7B 2P8LB 3FCTA 4PUBL 1NLDH 5BS0E 5CWSB 5E24E 4KKBD 3KYMA 5DFVD 3O3AB 4KQ4L 1HWGB 4NRYA 3QFJB 3GEWB 1RIHH 1F6AB 5EC2A 1EHLL 1S7QB 3ULUD 1OAUH 3FJTA 4QRPD 5GS1C 5SWZE 5TDNB 5EOCH 1ZHLB 1UB5A 1NDMB 2FEEI 5IB4A 5J6HB 2WUBH 1H9VA 1YEDB 5IVZB 1KELL 2O26U 2EDBA 5JIKA 3QYCA 3BKCL 1MHHB 4HS6B 5EORL 5KSVA 2EEDA 2XICA 3HMXL 5B39B 5E8DH 1V3KA 5D1XC 8FABA 2BVYA 1Q1JL 2FIKB 3HAEG 3QEUA 4H0IA 3F5WA 2PO6B 5GRXG 4YC2B 1IILE 4R90H 1KG0A 4YQXL 5HHXL 1AGDA 5DURB 3W9EA 1HCFX 3RNQB 4R90L 3VXOA 1N64H 3QULA 3BAEH 5IB5A 5JHDE 1D5ZA 2HJLA 2H26A 4JFDE 4XPAH 2IPUG 3REWB 5ITBL 4Z5RB 1NFDA 2HT2C 3TP4A 5TDPB 5ETUB 4IMLB 2R8SH 2P8MA 4GRMB 4N1EA 3AFLA 1MJUH 4OKVB 3H3BC 2WUBL