2AXVA

Structure of prgx y153c mutant
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
302
structure length
302
Chain Sequence
FKIGSVLKQIRQELNYHQIDLYSGIMSKSVYIKVEADSRPISVEELSKFSERLGVNFFEILNRAGMNTKSVNETGKEKLLISKIFTNPDLFDKNFQRIEPKRLTSLQYFSIYLGYISIAHHYNIEVPTFNKTITSDLKHLYDKRTTFFGIDCEIVSNLLNVLPYEEVSSIIKPMYPIVDSFGKDYDLTIQTVLKNALTISIMNRNLKEAQYYINQFEHLKTIKNISINGYYDLEINYLKQIYQFLTDKNIDSYLNAVNIINIFKIIGKEDIHRSLVEELTKISAKEKFTPPKEVTMYYENYV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of peptide sex pheromone receptor PrgX and PrgX/pheromone complexes and regulation of conjugation in Enterococcus faecalis.
pubmed doi rcsb
source organism Enterococcus faecalis
molecule tags Transcription
molecule keywords PrgX
total genus 118
structure length 302
sequence length 302
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01381 HTH_3 Helix-turn-helix
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 2axvA01
1.25.40.400 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2axvA02
1ZAYA 3R1FA 3UFDA 1PNRA 2MQKA 4F8DA 1JWLA 2L8NA 1QPZA 3O9XA 4MCXA 3DNVB 2JCGA 1DW9A 4FBIA 3QYXA 3PXPA 2PUAA 1WETA 1ZZCA 4O8BA 4X4CA 3B7HA 2LYQA 5K98B 1OCTC 4X4GA 1JH9A 2BJCA 1QQBA 3ZKCA 4X4HA 2XI8A 3RZZA 2PUDA 2ICTA 2MEZA 1E3OC 1BDHA 4I6TA 2A6CA 2BNMA 2LYSA 3FYAA 4OB4A 4Z59A 1PRAA 2XJ3A 2OR1L 1YSEA 4Z5CA 1ZZ6A 2PUCA 3G5GA 4IVZA 2O49A 1RZSA 2AXVA 2GZUA 2HSGA 3QWGA 1DWKA 4YG1A 3QF3A 3IVPA 3CECA 3EUSA 2KEJA 2XIUA 2EWTA 4J1WA 3TRBA 1WH6A 3F51A 2KEIA 1RIOA 1Y9QA 1IC8A 4X4DA 1BDIA 1JFTA 1ZVVA 1R69A 3OQOA 3MLFA 2BNOA 2KZ8A 1LCDA 2JVLA 4JCXA 4Z5DA 4X4FA 2LYRA 3KXAA 4PU3C 2BNNA 1S7EA 2D5VA 1ZZ8A 3SCGA 2PIJA 3OMTA 2IUOA 1HF0A 1B0NA 1NEQA 2AXZA 2KPJA 1ZZBA 3ZHMA 2IVGA 1XWRA 1X2LA 1LMB3 4PU7A 3SCFA 3D1NI 3HZIB 3GN5B 1LQCA 1ZPQA 2AUWA 1OSLA 1JFSA 1ZZ9A 4MCTA 4I6UA 1WIZA 1EFAA 2OFYA 1NERA 1Y7YA 1RZRD 1L1MA 4NDWA 2O38A 3QQ6A 4I6RA 3F6WA 4Z5HA 2EBYA 1ZUGA 2XCJA 2B5AA 4PU4C 3VK0A 2AWIA 2O4AA 3F52A 2L49A 3GBFA 3LISA 4PU8A 3L1PA 3JXCL 1AU7A 1PRUA 4Z58A 3JXBC 1RZRA 3KJXA 2EF8A 1ZZ7A 2WIUB 2CROA 2HINA 4YG4A 1CQTA 2LCVA 3CLCA 1UXDA 2LYKA 1QQAA 1RPEL 3S8QA 1ZS4A 3FMYA 1R63A 2IU7A 4X4IA 3JXDL 3OP9A 2GRMA 4GHJA 1GT0C 1UXCA 3LFPA 3G7DA 1WH8A 3ZHIA 4X4EA 1QP4A 4I8TA 1PRVA 3CROL 2IVBA 2H8RA 2PUEA 1O4XA 1LLIA 2LYLA 4GQMA 4YBAA 2R1JL 2PUFA 4IA8A 2AXUA 2FJRA 1LCCA 4JQDA 2WUSR 2AW6A 3KZ3A 2PUBA 3U3WA 3FYMA 3BDNA 1PERL 2LYPA 1CJGA 4YG7B 1X57A 2GRLA 4YARA 3OQNA 3GN5A 1POUA 4FN3A 3H5TA 2KEKA 2PUGA 4Y42A 3OQMA 3BS3A 2PPXA 4X4BA 2CSFA 2XSDC 4JCYA 2LYJA 1QP0A 1ADRA 3SCHA 2PE5A 4J1XA 3BD1A 5A7LA 2ICPA 4IWRA 1VPWA 1UTXA 1QP7A 2IV1A 2IVQA 1SQ8A 2R63A
chains in the Genus database with same CATH superfamily
4GA1A 4BY6A 1E8XA 4L9PA 1HO8A 5EDSA 4DUIA 4GYYA 4NQ0A 3TWSA 2BJCA 1QQBA 2WXFA 4UWLA 3TAXA 2XI8A 2DZNA 2QZAA 3IHVA 4LUNU 1TNOA 2WXOA 4MKTA 4EKGA 4PDXA 3V79K 4CDRA 2PUCA 1DCQA 3ASOE 3KSQA 2P2CP 2I6HA 1IC8A 4ER0A 2NC9A 3C72A 3ML9A 3DWLG 3VLEA 3G2WA 4X4FA 4WAFA 2LYRA 2IUOA 1U2VG 4J8FA 4HLLA 3GN5B 2AUWA 2J09A 2LNMA 2ODRD 5ENSD 4XI9A 3IHYA 1Z5SC 4I6RA 3F6WA 4PU4C 1NFIE 3O4ZA 4GA0A 3S2AA 3SBSA 4BT8A 1H2UA 5B3SE 2WXJA 4K5AB 4Q94A 2L1PA 3CLCA 1X5BA 1R63A 2ZIRA 3NXHA 4GHJA 3LJ3A 1OWOA 2PL2A 5FQ7A 3ZVVA 2NYJA 2JABA 4BWRA 2OEVA 5G04J 3U66A 3ASHA 3D9LA 3U3WA 3JYSA 3E4BA 3A9YA 4GTQA 2LLVA 1QYMA 3RRNB 1UJKA 4ILHB 4HFGA 3FTZA 1KZPA 3BS3A 3UT4A 1N54A 4I9EA 4ZFHA 2XQ0A 1ADRA 3AJIA 4IWRA 5T3RA 1UN8A 4G26A 4KZ0A 4J8EA 1PNRA 4YDWA 3HXFA 2XZDG 5CERB 5G05J 3SO8A 4GMLA 2UWJG 5FTPA 4ANVA 1UG3A 4N5CA 4Z59A 3WG7E 3MYVA 2L0IA 3DM5A 3D9JA 5KNGA 2HSGA 2R5SA 1TN7A 2BEDA 3TG5A 2LSUA 2B6CA 1LD7A 4A55A 1FCHA 3BQOA 2I1KA 4TUUA 3FH7A 4I6GA 3KEZA 2VGEA 5DBKA 4XI0A 3ZPXA 1OCRE 1MJ0A 3NZSA 3G2VA 3JXIA 1QBQA 4GTSA 3LKUA 2Y69E 4KYOB 3LS8A 2FO7A 3EU5A 1EDUA 2RG8A 3VTYA 1JWGA 1N4RA 2LUHA 1HX8A 5CRUA 3JUEA 1RZ4A 3DXMG 2WXPA 2LYKA 3TXMA 4D10C 4UI9K 1BPOA 3G7DA 3ZXSA 2NSZA 4XZ4A 3B7TA 4LNGA 3UXGA 4AV7A 4IA8A 2AXUA 4UWHA 2VSOE 4C0EA 2FO1E 3L82A 2ZGGA 2IU1A 3QNKA 1K8KG 4Q96A 3RU0A 1MHQA 1QP0A 2R02A 4I6JA 3E34A 2I2OA 3HDXA 1UTXA 2EINE 3MEKA 5T4YA 4FADA 2QFCA 3MX3A 2HCNA 2Y3AA 3FUFA 4X4GA 1JH9A 1YA0A 2XXPA 4AJWA 1E90A 2WXRA 3HXDA 3P2BA 3RJVA 4UI9C 4DE8A 4GYWA 3PH0C 1DCEA 3IEGA 3KL4A 2C0LA 4JZYA 1WY6A 4HBDA 4CDMA 1VDYA 4LNBA 3TGOA 1N94A 2XGSA 4IULA 5D0QD 4U07A 3SR4A 3CSTA 3OAWA 1B0NA 1FVFA 3MGBA 4FA6A 2ILRA 3D1NI 4L2YA 5D66A 3PE3A 3QAQA 2OFYA 1Y7YA 2J4BA 2CG2A 2R05A 3FUJA 3HHMA 2PXVA 2O4AA 5AQAA 3ZYLA 4C48B 2L49A 3LCAA 4OAUC 3Q79A 1ELRA 2QYUA 3PUKA 2PXKA 4CGVA 1FPPA 3S7JA 5HI7A 3CVYA 3UT7A 3TWQA 3ZPJA 5BV1A 1UXCA 2BF0X 3FP3A 5C2YA 3AU5A 2LYLA 2EILE 2XPZA 1BD8A 2LXMA 3DSUA 3FYMA 1S63A 3ZW3A 5ENNA 1KZOA 3GN5A 2Y0BG 1POUA 2KCVA 4FU3A 2WM9A 3KAEA 3V31A 3SGHA 4B8CB 1MYOA 4JB8P 1QP7A 5AJLA 3UX4A 2IVQA 2VSYA 1E96B 1PAQA 3OWQA 4F8DA 5A6CA 2PQRA 3FTSA 2JCGA 4LNUD 4EZLA 3VLDA 1WETA 4O8BA 4X4CA 5IY5E 3DXKG 4U96D 3ASDA 4IYPA 2GRRB 1LTXA 3TWWA 3LXUX 4OB4A 1H19A 3DPDA 4M7CA 2C2LA 1JCSA 3LYAA 3MKRA 3Q15A 3EHQA 2EWTA 4ABNA 2XZTG 3Q7FA 3TWUA 3UMVA 5ANLA 5KJMA 4L7TA 3PNLB 4JD2G 4XKCA 4CT4A 4IRUA 5GAGi 3L9TA 2IVGA 3ZIMA 4H7YA 4BT9A 1D8DA 2YHCA 3J5PA 3CVVA 3IXEA 3KJXA 5FQ6A 4UWKA 1S0PA 3NROA 4YDEA 4EKIA 1QQAA 5EX0A 4N3AA 4DPRA 4U0UA 3Q73A 1QB2A 3QFIA 3FTWA 3SFXA 2QYJA 5FZSA 4BSZB 1PC2A 2WMOA 5G55A 4AOFA 1H6OA 3UI2A 5JHAA 1CJGA 3PUJA 5JHBA 5A23A 4F1PA 2H6FA 3EHMA 2P9UG 3ASGA 3ABLE 2CSFA 2V4HC 3E30A 5KBAA 2ICPA 3Q9UC 2OV8A 3FTVA 3DSXA 3RAUA 2BKKB 3FUKA 3AS4A 2UY1A 4HRAA 2F8YA 1OCTC 1MQSA 2X6KA 1OWMA 3ZEFA 2M63A 3P1UA 4BEPA 5KJNA 1N4PA 1IXVA 5FIOA 1ZZ6A 2YHEA 3G5GA 4FHKA 2PM6A 4GCOA 5D0OD 2XIUA 4J1WA 4ER5A 4WVLA 1Y9QA 5BW8C 1H2TC 4N5QA 3SX0A 2CG3A 1JWFA 1G3NB 1LCDA 2RKKA 5AN8A 1RW2A 3Q5MA 5DT2A 3AG4E 5ENOD 1E8ZA 3R09A 3F6QA 1XGWA 3HZIB 4U8VD 2FULA 4I6UA 1RZRD 3EDTB 1L1MA 4UQZA 3V30A 4FULA 4N3BA 3FWVA 5G04C 2L9BA 3TELA 2XCJA 5ARGA 2AWIA 4YVQC 1RZRA 4YG4A 3VLFA 3R9AB 1TNBA 2F0YA 4HOUA 3EHNA 2X38A 2EIJE 4FHJA 3BG0B 2DYRE 3C98A 1HG5A 3Q9NC 2H6GA 4ER6A 2R1JL 4JQDA 1ELKA 2R2LA 4DX5D 4BTAA 4JC8A 3CKCA 3T8MA 1X57A 4GAAA 3HVEB 5DTMA 5BPPA 3OQMA 4X4BA 2YBDA 1NA3A 4GZ3A 2AJAA 4HVBA 3D9PA 1HG2A 3PRZA 4WWOA 4F53A 1EF1C 2R59A 5LFAA 3PZ2A 5CCLA 2L0TB 4RG6A 1DULA 4OAVB 2PXTA 3MV2B 1DW9A 5D2MC 4BSXA 1D8EA 4KBQA 3L6AA 1EYHA 5LP0A 4B94A 2MEZA 2MHKA 2MRIA 2CFZA 3T5VA 4OBMA 4U63A 3D9NA 4YG1A 4AY6A 3IVPA 3MZLB 1RIOA 4JA9A 3LVRE 1S70B 2J7WA 2XGOA 3PS6A 1MFQC 3CVPA 3FU0A 3S7FA 4DX7D 4G25A 4E6HA 1BLXB 4JVSA 4LERA 1O1TA 2WQ7A 3UM1A 3NZUA 5AIJA 4JPSA 1XWRA 1WM5A 3ZKJA 1OSLA 2V5QC 5JMND 3TWXA 4ANWA 2OCCE 3PE4A 4O1OA 4LCTA 4FC8A 3RRMB 4KT6B 4DRXE 3RO2A 1ZZ7A 3OTNA 2HINA 4HXIA 1CQTA 4PUCA 4EBAA 4UUCA 3OP9A 1IKND 4X4EA 4I8TA 3NOGD 4HS2A 3QK0A 4XKBA 1KPSB 2P9SG 1O5MA 4XX5A 2PUEA 4U0ZA 3LQXA 5ENRD 3FH8A 5CBOA 2DZOA 2HR2A 5CECB 1NZNA 3VWSA 5GAHi 2PUBA 3C3RA 2HE0A 3HRAA 3G2TA 3ONLA 1MX6A 3OQNA 1A5EA 3EJNA 2LYJA 2IO3C 4I9CA 2AVPA 3C5RA 4U8HA 5JA4D 2PQNA 1K3ZD 3UFDA 3PZDA 3ML8A 2KM4A 3QYXA 4BETA 3WXXA 3UQ3A 4O6FA 3KEAA 2WXMA 3AG3E 2KC7A 2IY0C 3ISMC 4U04A 2BUGA 1AWCB 4X8QA 2A6CA 1PRAA 3I4GA 1YSEA 4AY5A 2WXQA 3OXFA 2JEKA 1Q2ZA 2ETCA 2WXNA 2CHWA 2CHXA 2ETAA 1KT0A 2GRQB 1OCOE 4GZCA 2V8SE 3QC1A 4KXKB 1EPUA 1MZCA 4WUYA 3SFYA 1XNFA 3L08A 5FZRA 4FLHA 1OY3D 1JFSA 2ZGDA 2C0MA 5CEDB 1KT1A 3CK8A 3FUIA 2PXUA 3F52A 4PH4B 3JXBC 2PXPA 1SQMA 4G2VA 5EX3A 3EUVA 5DTQA 2WXGA 5BV0A 3OKZA 2RFAA 4I43A 2IU7A 4X4IA 4I1MA 1WH8A 3HXCA 5G2NA 4FJYA 4HNAD 3ZYKA 2IQCA 1O1RA 3X2QE 2KZTA 2WUSR 2AW6A 2KCKA 3TL5A 4U8YD 1PERL 1TN6A 4F6RD 4APFA 5CEAA 2J4DA 4EBAG 4LG6A 2YNQA 4J1XA 5B1BE 4L1BA 4WWPA 3FTYA 4A3TA 1O1SA 2J8SD 3UM0A 4FBIA 4HRLA 3Q78A 2LYQA 4FP7A 3FFLA 3APDA 4JHRA 2A4ZA 2PUDA 3T5XA 3LVQE 2J49A 4GTOA 3MKQB 3RIBA 3M9LA 2KEJA 1DNPA 3SFZA 3QWWA 3HVEA 5AQ7A 1R69A 2BNOA 3FUHA 1X81A 4ME2A 3PNTB 5EYLA 4U0SA 1QNFA 2PIJA 3AS5A 3EU9A 4DJAA 5HQ8A 3QWVA 2DCPA 3ZHEB 5CHEE 4BFRA 2BTDA 3ASNE 4NDWA 3EIQC 2EBYA 3NBNB 3W9GA 4K5CA 5AJDA 3JXCL 4J7WA 2WXHA 4EZIA 4HRMB 2F37A 4JEUA 4GPMA 3FTXA 2OOEA 1QP4A 1OWPA 1SA4A 3CQCB 2H8RA 3FH5A 4UQYA 4B0ZA 3GUUA 4R7LA 4WNDA 3I4RB 2HYZA 4JW1A 2PNNA 3MCXA 2WXIA 2XRYA 4AIFA 2KXPC 3QOUA 1N4SA 2R17C 2I9CA 4OYSA 2IOSA 1SZ9A 1OWNA 4RQIA 2ZISA 3O9XA 4MCXA 3APCA 4I2WA 4I2ZA 3PXPA 3UINC 4I6EA 3NF1A 3CEQA 1OT8A 2WQHA 3ZKCA 4Y6WA 4NIKA 1JCQA 4CCAA 2WQ6A 4EQFA 2XJ3A 4C0MA 1YMPA 3OXLA 3ESKA 4W9RA 4A1SA 1DWKA 2EIME 2J7UA 1SVXA 3QARA 3DPYA 3D9MA 4MBGA 1BI7B 4QFVA 1U2ZA 3CVWA 1KLXA 2QY7A 2JVLA 4LEUA 4XEIG 1OCCE 3KXAA 2D5VA 3SCGA 1JCRA 3B7RL 3J5QB 2UY1B 4ANXA 2P58C 3PDNA 4DX6D 3L22A 4J8SA 3U4TA 4Z5HA 4KZCA 3ZUVB 3VK0A 4PU8A 3Q4AB 1PRUA 1TNUA 2PXEA 2EIKE 2HO1A 2VSXE 4GB9A 3Q49B 4UQXA 3IKOB 3FEYA 3R9MA 1PRVA 2IVBA 5ENTD 3ZNGA 1UN9A 3Q75A 1SA5A 2XEHA 3D9HA 4I1AA 3SZ7A 3SQVA 2LYPA 2FI7A 2Q7FA 3L17A 4CZ2D 2PPXA 3JCKC 2V0PA 3ENEA 3PEUB 3R7RA 3B95A 2LSVA 2IV1A 4DE9A 1IHBA 4FLBA 4JXTA 2H6IA 2MQKA 5LX8A 1JWLA 3TWVA 4Y6CA 3B7HA 5BUZA 5K98B 3CHQA 4GYOA 5G05C 1PY1A 3UT8A 4TXPA 2IEJA 4KVOA 5HKPA 5KJKA 5CCMA 4BERA 2OR1L 4IN3B 3PEVB 5ANRA 3TXNA 3TRBA 3FTUA 4U7EB 3E32A 3HXBA 4GTRA 1JFTA 3SHFA 3VTXA 3EIJA 3ZHEA 2WPVA 1S64A 1S7EA 3BUAA 3PE5A 3QDNA 1ZZBA 3ZHMA 2XPIA 2EQXA 4V3IA 3GZ1A 4PU7A 4RG9A 5BNWA 2DYSE 5A7DB 4A63B 1NL4A 3G2SA 5C1DA 1ZUGA 2B5AA 1AU7A 2FFHA 2GRPB 3RO3A 5EN5D 2WIUB 4GZDA 4MRUA 4O1PA 4HI8A 3E37A 1E7VA 3ZYMA 4TRQA 3PZ4A 3NAWA 2GGFA 5ARFA 2V5FA 1QQEA 3URZA 4UWGA 1OXJA 4YNDA 2FJRA 4ATZD 3AAAC 3T9KA 3CHRA 3ABKE 4PS3A 2Y1LE 4YG7B 2MOWA 1DC2A 4CYMD 4RLYA 4GU5A 2KEKA 1DVPA 1UW4B 4GPKA 4TXQA 5FJYA 1E7UA 3Q47B 2J9QA 1VPWA 2QC9A 3APFA 2KATA 4HORA 3AU4A 2XPYA 4J8YA 3NB2A 3LJNA 1ZZCA 4U95D 4E85A 2PXDA 3NDBB 3GW4A 3GZDC 3ME5A 4APOA 3V2OA 3FY4A 5LCWC 2VYIA 1YYHA 4GTMA 2AXVA 4GMJA 5LCWJ 3SD5A 3EUSA 5JJTA 1BDIA 3AG1E 5FZQA 5B1AE 3CVUA 2P9LG 3CR3A 4Z5DA 5JJ6A 4GTPA 2HCSA 1ZZ8A 1UOHA 1NEQA 5EIDA 4MCTA 4HLEA 3FUEA 1NERA 4MS6A 1N52A 4HOQA 2X6IA 1N0RA 3G0TA 3JXDL 5LOZA 3GZDA 1GT0C 3UKUG 3W9FA 3LFPA 4DX1A 3ZHIA 1SZAA 1QZXA 3L54A 4DLQA 2LLWA 2Y4UA 3CKBA 5ENQD 4JA7A 3ZRHA 4AP2A 4GTVA 4RVBA 3BDNA 4XE0A 3ONKA 4A3VA 2GRLA 1U3CA 3L13A 4ACLA 4ER7A 1TJFA 3CQGB 4GTTA 1H2VC 3QWPA 4J8DA 4J0UA 2MYOA 2E2EA 3ZGQA 2PZIA 3A9ZA 4OVUA 1D9SA 1ZAYA 1TNYA 2PXFA 2XCCA 2RD0A 3UM2A 3TFLA 4YVOA 2PUAA 2ZXWE 4TXRA 4G8LA 2DWZA 5FWQA 3ZU7B 4X4HA 4GCNA 4ILIA 4ZHBA 1BDHA 4HOTA 5AQ9A 4I1OB 3CVLA 4G1TA 4N2SA 5AYWD 3QWGA 2XENA 1AP7A 4Z68A 3SF4A 2IONA 4CGWA 2VTBA 2GW1A 2R03A 3DEOA 2PXBA 3PZ3A 5BXUA 3OQOA 4EECA 2IJGX 4JCXA 4EPZA 3FUNA 4KMOA 2BNNA 3R7QA 1HF0A 2XEVA 2KPJA 1X2LA 3FUMA 3CLJA 4HRNA 2X6FA 4AXHA 4WNFA 5FT9A 1OCZE 1HZ4A 4WWNA 1NP7A 1V54E 1FT2A 4Z58A 5AARA 3FULA 4HI9A 3LY8A 2FEZA 1E8WA 3DSTA 5CBNA 3C3QA 3S8QA 3UKRG 1MX4A 3BG1B 4URKA 1Y8MA 1B89A 2VGXA 2YQ8A 1U3DA 3CROL 1HF8A 5EILA 2XRZA 1HFAA 4AM9A 4GQMA 3JUIA 4G23A 3D9IA 4ATGA 4HOSA 3KZ3A 4J6IA 1TN8A 2V4LA 2WXKA 3MV3B 3KD7A 3L16A 4FN3A 2L6BA 2P9IG 5AENA 1TJCA 2KZTB 4K03A 2PE5A 3BD1A 1HH8A 4XIFA 2X3MA 1IQRA 2R63A 4CDNA 1JPLA 3B13A 2IOLA 3GZSA 5FINA 4BESA 3ZN3A 4ILGA 3MJWA 4PS7A 5HS0A 1BU9A 1E3OC 2VQ2A 2BNMA 2HFZA 5BXOA 1TYQG 2Y4TA 3NQPA 1A17A 2O49A 1RZSA 3CIAA 4F1SA 1K1AA 3HG0D 1N0QA 1OWLA 4H7XA 4DK5A 3ULEG 5FQ4A 3FEXA 3ESLA 2E0IA 4L23A 2IFUA 2XEEA 2B0OE 3T8KA 4TUMA 3JXJA 1ELWA 1LF8A 4A1GA 4GZ6A 2AXZA 1Z6TA 2P9NG 1TR4A 2BKGA 1JUQA 4QQIA 3SCFA 2RFMA 3CK7A 2GROB 3CHMA 1MX2A 1WIZA 2P9KG 3UUXA 4DI3A 2XXQA 1BI8B 3QQ6A 1V55E 4GZ5A 3PZ1A 1NA0A 4O60A 3GBFA 3QB2A 3FU6A 3NOCD 4B89A 4JHJA 2M4HA 3CK9A 3TWRA 4N39A 5KJLA 3SY2A 3FU5A 1UJJA 4Q2JA 3LY7A 3UM3A 3G2UA 3ASFA 2WB2A 5E76A 4B8AA 1LLIA 1LCCA 3I5PA 4N3CA 4JHKA 3EHRA 4BX8A 3JQ0A 3TG4A 4EK9A 4YARA 3H5TA 4WNEA 4JCYA 3HXEA 4P29A 3AG2E 4EQZA 4FJZA 1N11A 5EYPF 1SQ8A 3R1FA 3DNVB 2VEOA 3LDZA 3QOWA 2PXQA 3FHEA 4HQDA 1HQ1A 5CMYA 2XCBA 1TEZA 1W3BA 4ANUA 3RSEG 2OEWA 3QF3A 2XS8A 3CECA 3SI5A 4K0RA 4X4DA 1IYGA 3TEPA 2PXLA 3U9WA 3QOXA 4PU3C 2A5UA 2LXLA 2LNIA 1N4QA 3ZYQA 3GZ2A 3ABME 5KWDA 1LQCA 3ZFWA 3SBTB 4DI4A 1EFAA 2WXLA 2O38A 3B7BA 5DRYA 3LISA 3E33A 3BEEA 3MKQA 3ULYA 3OXGA 2EF8A 2VGXB 4K5BA 3TWTA 1GW6A 3D9KA 3CVXA 3NZLA 4GMRA 4CEMA 1Y6IA 3UTMA 4N2QA 2FBNA 2LO6A 3DSSA 4C9BB 2GRNB 3FDHA 5HRYA 5EIBE 3MEJA 3N71A 2PUGA 3Q7AA 2XS1A 3CHPA 2XSDC 4G24A 2LAHA 3GYZA 4AVXA 4TV3A 3B7UX 1SW6A 2DVWA 2YINA 2V3CC 4YDOA 5CMWA 3U64A 3RRUA 4NURA 2H6HA 3LEWA 3CV0A 1QPZA 3S7BA 3A9XA 5JJ7A 3KSLA 5H7PA 5CRVA 3C3OA 2JQEA 2ONDA 4I6TA 2LYSA 3FYAA 2KCLA 4WNGA 3I3NA 3IV0A 1OUVA 4IVZA 5DTRA 3GZCA 2DIWA 3MA5A 1TNZA 1H0AA 1IQUA 2ETBA 3ULQA 1WH6A 3F51A 2KEIA 4MLPA 4M3OA 3ZXPA 1ZVVA 1Z3YA 2I1JA 4BTBA 4Q69A 2CHZA 4AEZC 1H6PA 1IHGA 1N95A 3OMTA 3D9OA 2VTBB 2LAIA 2NXPA 3DRAA 1LMB3 3HYMB 3RKVA 3PVLA 2VSNA 3TJPA 1YCSB 2CFUA 4JEHA 3KS2A 5BT1A 5DSXA 1QZ2A 1WDYA 4DLOA 4F7AA 3RK6A 4YDYA 2XXAA 1ZBPA 3UIPC 3IBEA 2LCVA 3O48A 1ZS4A 3FMYA 1L5JA 4UWFA 4B93B 3DSVA 2GRMA 3LPZA 2WMNA 5KCMA 2J07A 1ZU2A 3AS8A 1O4XA 2WVIA 3DBSA 4CT0A 4ER3A 2X6JA 4EHMA 4BX9A 3DEPA 3V2XA 3DSWA 2VJ8A 5AAOA 5A7LA 2DBAA 2XHEA 3CSFA 5ITZF 5M72A 4RSYA 4L2LA 5DRTA 1FT1A 4DX2A 3FUDA 4KVMA 2JLBA 1H6KA 2IO2C 3CHSA 4F3VA 2L8NA 5E75A 4NACA 2XGMA 1ZB1A 3HIZA 3RZZA 1WG0A 2HM8A 4GA2A 2ICTA 2VGYA 2OVFA 3PREA 4Z5CA 2IF4A 5FQ8A 2GZUA 3K9IA 4LSZE 5J90A 4EZJA 2F8XK 3QKYA 2A5EA 1HU3A 2OVBA 3MLFA 2KZ8A 2PM7A 5J08A 2KBXA 5JUWA 3SNXA 2X6HA 1WAO1 1K1BA 1ZPQA 1ZZ9A 2L6JA 3BU8A 4G8KA 1HE8A 5DIZA 4UI9J 4G11A 1Z3XA 3L1PA 2MXDA 3CGHA 1INZA 2ZU6B 1NI1A 2CROA 5KNHD 5T8IA 1UXDA 3CVNA 3LY9A 1RPEL 3UIOC 2J08A 1HXIA 3FU3A 4CRWA 3CHOA 5AQBA 3D3MA 4JL0A 5ENPD 1E8YA 1N9AA 1HS6A 4YBAA 2PUFA 3S7DA 4PS8A 3UWPA 2P9PG 2FF4A 4NRHB 5EKQD 1LD8A 4Y42A 4I17A 4LRZA 1P5QA 4ACKA 4EZKA 3B7SA 3UPVA 3JQ1A 3SCHA 4OVVA 3CVQA 3QJZA 4HB5A 1NW3A 1FVHA
chains in the Genus database with same CATH topology
1JPLA 3B13A 2IOLA 3FUKA 1SZ9A 4GA1A 4BY6A 3GZSA 1E8XA 1OWNA 3O9XA 4MCXA 3AS4A 1HO8A 3APCA 4I2WA 2UY1A 4I2ZA 3PXPA 5EDSA 4GYYA 4NQ0A 3ZN3A 1OCTC 4I6EA 4ILGA 3NF1A 3CEQA 3MJWA 1MQSA 2WQHA 2BJCA 1QQBA 2WXFA 4PS7A 4UWLA 3ZKCA 2X6KA 1OWMA 3TAXA 3ZEFA 2XI8A 2M63A 3IHVA 4LUNU 4Y6WA 1E3OC 2VQ2A 2WXOA 3P1UA 4MKTA 5KJNA 4PDXA 2BNMA 4CCAA 2WQ6A 2Y4TA 4EQFA 2XJ3A 4C0MA 3NQPA 1A17A 1ZZ6A 2YHEA 3OXLA 2PUCA 3G5GA 2O49A 2PM6A 1RZSA 3CIAA 3ESKA 4FHKA 4W9RA 4A1SA 4F1SA 1DWKA 4GCOA 3QARA 5D0OD 2XIUA 1IC8A 4J1WA 2I6HA 1OWLA 4H7XA 5BW8C 4DK5A 1Y9QA 2NC9A 3D9MA 1H2TC 3ML9A 4QFVA 5FQ4A 3FEXA 3ESLA 3CVWA 2CG3A 1KLXA 1JWFA 2E0IA 2QY7A 3VLEA 1LCDA 2JVLA 2IFUA 4LEUA 4L23A 3G2WA 4X4FA 4WAFA 2LYRA 3KXAA 1ELWA 2D5VA 3SCGA 1LF8A 3Q5MA 2IUOA 4A1GA 1E8ZA 3B7RL 4GZ6A 2AXZA 1Z6TA 4J8FA 2UY1B 1XGWA 1JUQA 3SCFA 3HZIB 4ANXA 3GN5B 3CHMA 3CK7A 2AUWA 2J09A 2P58C 2FULA 3PDNA 4I6UA 1WIZA 3UUXA 4DI3A 1RZRD 3EDTB 1L1MA 3L22A 4UQZA 4FULA 3IHYA 4N3BA 3FWVA 4XI9A 5G04C 3QQ6A 4I6RA 2L9BA 3F6WA 4Z5HA 2XCJA 4GZ5A 4J8SA 4KZCA 1NA0A 4PU4C 3VK0A 2AWIA 5ARGA 3GBFA 3O4ZA 4PU8A 4GA0A 3QB2A 3FU6A 1PRUA 3Q4AB 4YVQC 3S2AA 3SBSA 4BT8A 1H2UA 4B89A 4JHJA 1RZRA 4YG4A 2WXJA 3VLFA 3CK9A 2HO1A 4Q94A 2VSXE 4GB9A 3R9AB 4N39A 5KJLA 3CLCA 3FU5A 3Q49B 1X5BA 4UQXA 4HOUA 1UJJA 3IKOB 1R63A 3FEYA 3LY7A 3EHNA 2X38A 4FHJA 4GHJA 3BG0B 3G2UA 3LJ3A 3ASFA 1HG5A 1OWOA 2PL2A 3C98A 5FQ7A 2WB2A 3ZVVA 1PRVA 5E76A 2IVBA 4B8AA 4BWRA 5G04J 1LLIA 3U66A 1UN9A 2R1JL 4JQDA 1ELKA 1LCCA 3I5PA 4N3CA 3ASHA 4JHKA 3D9LA 4BX8A 3U3WA 4I1AA 3JYSA 4BTAA 3SZ7A 3JQ0A 2LYPA 3E4BA 2FI7A 3TG4A 2Q7FA 4JC8A 3CKCA 3L17A 3RRNB 3T8MA 1X57A 4YARA 1UJKA 4ILHB 4HFGA 4GAAA 3HVEB 5BPPA 3H5TA 3OQMA 3FTZA 3BS3A 2PPXA 4X4BA 4WNEA 3UT4A 1NA3A 4GZ3A 3JCKC 1N54A 4JCYA 2V0PA 3ENEA 3PEUB 4I9EA 2XQ0A 4P29A 3D9PA 1ADRA 1HG2A 3PRZA 4WWOA 4F53A 4FJZA 1EF1C 3R7RA 4IWRA 5T3RA 2LSVA 2R59A 1UN8A 2IV1A 4G26A 1SQ8A 5LFAA 4KZ0A 5CCLA 2L0TB 4RG6A 3R1FA 4J8EA 1PNRA 4FLBA 4JXTA 2MQKA 5LX8A 1JWLA 3DNVB 3MV2B 1DW9A 4Y6CA 5G05J 4BSXA 3B7HA 3LDZA 5BUZA 5K98B 3CHQA 4GYOA 4KBQA 3FHEA 3L6AA 4GMLA 5G05C 1PY1A 1EYHA 3UT8A 5LP0A 4B94A 2UWJG 5CMYA 2MEZA 2MHKA 2MRIA 5FTPA 4ANVA 2XCBA 4KVOA 5KJKA 1UG3A 4N5CA 4Z59A 5CCMA 2CFZA 3T5VA 3MYVA 1TEZA 2OR1L 2L0IA 1W3BA 4IN3B 4ANUA 3D9JA 2HSGA 2R5SA 3TG5A 4U63A 2LSUA 3D9NA 4YG1A 3PEVB 3QF3A 5ANRA 4AY6A 3IVPA 3TXNA 3CECA 3SI5A 4A55A 3MZLB 1FCHA 3TRBA 1RIOA 3FTUA 4K0RA 2I1KA 4JA9A 3LVRE 4TUUA 3FH7A 4X4DA 1JFTA 2XGOA 1IYGA 3SHFA 3VTXA 4I6GA 3PS6A 3EIJA 3U9WA 3CVPA 3FU0A 3S7FA 3ZHEA 3KEZA 5DBKA 2WPVA 4G25A 4XI0A 4E6HA 4PU3C 4JVSA 1S7EA 4LERA 2WQ7A 2A5UA 3NZUA 2LNIA 5AIJA 3NZSA 3QDNA 4JPSA 1ZZBA 3ZHMA 2XPIA 2EQXA 3G2VA 4V3IA 3ZYQA 1XWRA 3GZ1A 1WM5A 4PU7A 3GZ2A 4RG9A 1LQCA 5BNWA 1OSLA 3LKUA 5A7DB 3SBTB 3ZFWA 4DI4A 1EFAA 4KYOB 3LS8A 2FO7A 2WXLA 4ANWA 3G2SA 2O38A 3PE4A 4LCTA 1ZUGA 5C1DA 1EDUA 2B5AA 2RG8A 4FC8A 3LISA 1AU7A 1JWGA 3VTYA 3BEEA 3MKQA 3RRMB 3RO3A 1HX8A 3OXGA 4KT6B 3RO2A 2EF8A 1ZZ7A 2WIUB 2HINA 2VGXB 3OTNA 4GZDA 4HXIA 2WXPA 1CQTA 4MRUA 1GW6A 4PUCA 4EBAA 2LYKA 3D9KA 3CVXA 3OP9A 4CEMA 1E7VA 3TXMA 4TRQA 3ZYMA 4UI9K 1BPOA 4D10C 2GGFA 3G7DA 4X4EA 4I8TA 1Y6IA 4HS2A 3ZXSA 2NSZA 3QK0A 4XKBA 4N2QA 4XX5A 2PUEA 2V5FA 4U0ZA 5ARFA 4XZ4A 3FH8A 2FBNA 2HR2A 3B7TA 1QQEA 2LO6A 1NZNA 3URZA 4UWGA 4AV7A 4IA8A 2AXUA 2FJRA 2VSOE 4UWHA 4YNDA 4C0EA 4C9BB 2PUBA 3FDHA 3CHRA 4PS3A 3G2TA 4YG7B 2MOWA 3ONLA 3OQNA 2IU1A 3EJNA 3N71A 3QNKA 4GU5A 2KEKA 2PUGA 1DVPA 1UW4B 3CHPA 4Q96A 4GPKA 3RU0A 2XSDC 5FJYA 2LYJA 1MHQA 1E7UA 1QP0A 2LAHA 3GYZA 4G24A 4TV3A 3Q47B 4AVXA 4I6JA 3B7UX 4I9CA 2J9QA 2AVPA 2YINA 2I2OA 3HDXA 4U8HA 5CMWA 1VPWA 3APFA 1UTXA 3U64A 2KATA 4HORA 3RRUA 2PQNA 3MEKA 5T4YA 3AU4A 3UFDA 3PZDA 4NURA 4FADA 2QFCA 3LEWA 3MX3A 3CV0A 3ML8A 2KM4A 1QPZA 2XPYA 3QYXA 3S7BA 3WXXA 1ZZCA 2Y3AA 3UQ3A 4E85A 3FUFA 4O6FA 4X4GA 1JH9A 1YA0A 2WXMA 3GW4A 2KC7A 5JJ7A 4U04A 4APOA 2BUGA 2ONDA 4I6TA 2A6CA 2LYSA 3FYAA 2KCLA 3FY4A 4AJWA 4WNGA 5LCWC 1PRAA 2VYIA 3I4GA 1E90A 2WXRA 3I3NA 3IV0A 1YSEA 1OUVA 3P2BA 4IVZA 3MA5A 2AXVA 2DIWA 4GMJA 4AY5A 5LCWJ 2WXQA 3RJVA 4UI9C 3OXFA 2JEKA 3SD5A 1H0AA 4GYWA 1IQUA 2WXNA 3EUSA 3PH0C 3ULQA 1WH6A 3F51A 2KEIA 4MLPA 3IEGA 4M3OA 5JJTA 2CHWA 1BDIA 1ZVVA 2CHXA 1Z3YA 2I1JA 2C0LA 4JZYA 5FZQA 3CVUA 4BTBA 1WY6A 3CR3A 1KT0A 4CDMA 4Z5DA 4CDNA 4Q69A 1VDYA 5JJ6A 3TGOA 2CHZA 2XGSA 4GZCA 4AEZC 1ZZ8A 1IHGA 4IULA 3OMTA 5D0QD 2V8SE 3D9OA 3CSTA 3QC1A 3OAWA 4U07A 2LAIA 2VTBB 1B0NA 1NEQA 4KXKB 1EPUA 1FVFA 2NXPA 3MGBA 4WUYA 1XNFA 4FA6A 3L08A 1LMB3 2ILRA 3HYMB 3D1NI 4FLHA 5FZRA 3RKVA 4L2YA 3PVLA 1JFSA 2VSNA 4MCTA 3PE3A 2C0MA 3QAQA 4HLEA 3FUEA 2OFYA 1NERA 1Y7YA 2CFUA 4JEHA 3TJPA 1KT1A 2J4BA 2CG2A 3FUJA 3KS2A 3HHMA 3CK8A 3FUIA 5BT1A 2O4AA 3ZYLA 1QZ2A 3F52A 2L49A 3LCAA 4MS6A 4DLOA 4F7AA 4PH4B 3JXBC 1N52A 3RK6A 4HOQA 1SQMA 1ZBPA 1ELRA 2X6IA 4G2VA 3IBEA 5EX3A 2WXGA 3PUKA 5BV0A 2LCVA 3O48A 4CGVA 3S7JA 1ZS4A 5HI7A 3FMYA 3CVYA 4I43A 1L5JA 4UWFA 2IU7A 4X4IA 3JXDL 4I1MA 2GRMA 5LOZA 3UT7A 3LPZA 3ZPJA 1GT0C 5BV1A 1UXCA 2WMNA 3LFPA 5KCMA 2J07A 3ZHIA 1WH8A 1SZAA 5G2NA 4FJYA 1ZU2A 3L54A 3ZYKA 3AS8A 1O4XA 2BF0X 2IQCA 3FP3A 5C2YA 3AU5A 4DLQA 2LYLA 2KZTA 2XPZA 2Y4UA 3CKBA 2WUSR 2AW6A 4JA7A 3ZRHA 2KCKA 4AP2A 2WVIA 4RVBA 3TL5A 3DBSA 3FYMA 3BDNA 4XE0A 1PERL 3ONKA 3ZW3A 5ENNA 4A3VA 2GRLA 1U3CA 3L13A 4ACLA 4APFA 3GN5A 1TJFA 3CQGB 4CT0A 1POUA 2KCVA 4FU3A 2WM9A 2X6JA 3KAEA 1H2VC 2J4DA 3SGHA 4BX9A 3QWPA 4J8DA 4EBAG 4J0UA 2VJ8A 4B8CB 2E2EA 3ZGQA 2YNQA 4J1XA 5A7LA 2DBAA 2XHEA 3CSFA 4L1BA 5M72A 4RSYA 4L2LA 4WWPA 3FTYA 1QP7A 5AJLA 3UX4A 2PZIA 2IVQA 4A3TA 4CDRA 2VSYA 4OVUA 1E96B 1ZAYA 1PAQA 3FUDA 2JLBA 4KVMA 1H6KA 3CHSA 2XCCA 4F8DA 4F3VA 2RD0A 5A6CA 2L8NA 2PQRA 3FTSA 2JCGA 5E75A 4FBIA 4YVOA 2PUAA 3VLDA 1WETA 4EZLA 4O8BA 4X4CA 4NACA 2LYQA 4FP7A 2XGMA 3FTVA 3ASDA 3FFLA 5FWQA 4IYPA 3HIZA 4X4HA 3APDA 4JHRA 3RZZA 2A4ZA 2HM8A 4GA2A 2PUDA 2ICTA 3LXUX 4GCNA 4ILIA 1BDHA 2OVFA 2VGYA 4HOTA 3T5XA 4OB4A 3LVQE 1H19A 3PREA 4I1OB 3DPDA 3CVLA 4Z5CA 2IF4A 2J49A 3MKQB 2C2LA 4G1TA 4N2SA 5FQ8A 2GZUA 5AYWD 3QWGA 3K9IA 3LYAA 3MKRA 3Q15A 3RIBA 3SF4A 2KEJA 2IONA 2EWTA 1DNPA 3SFZA 4CGWA 2VTBA 2GW1A 3QWWA 4ABNA 3HVEA 5J90A 4EZJA 3UMVA 3QKYA 5ANLA 5KJMA 1R69A 3OQOA 1HU3A 3MLFA 2BNOA 2KZ8A 2OVBA 2PM7A 3FUHA 4L7TA 4EECA 5J08A 2IJGX 4JCXA 4ME2A 3PNTB 3PNLB 3SNXA 4EPZA 2X6HA 3FUNA 4KMOA 2BNNA 4U0SA 4XKCA 1QNFA 2PIJA 3AS5A 3R7QA 1HF0A 2XEVA 1WAO1 4DJAA 5HQ8A 3QWVA 2DCPA 4IRUA 4CT4A 2KPJA 3ZHEB 2IVGA 5CHEE 4H7YA 3ZIMA 1X2LA 4BT9A 3FUMA 3CLJA 4BFRA 1ZPQA 1ZZ9A 2L6JA 1HE8A 2BTDA 2X6FA 5DIZA 4AXHA 4NDWA 2YHCA 4UI9J 3EIQC 4WNFA 2EBYA 5FT9A 3CVVA 4G11A 1Z3XA 3L1PA 1HZ4A 5AJDA 3JXCL 4WWNA 1NP7A 2WXHA 4Z58A 3CGHA 1INZA 2ZU6B 3KJXA 5FQ6A 2CROA 3FULA 1S0PA 4UWKA 5T8IA 3LY8A 2FEZA 1E8WA 1UXDA 1QQAA 3CVNA 1RPEL 3LY9A 3S8QA 2J08A 4JEUA 4N3AA 4U0UA 5EX0A 1HXIA 3FU3A 4CRWA 3CHOA 3FTXA 4DPRA 3BG1B 2OOEA 3D3MA 1Y8MA 1B89A 4JL0A 4URKA 2VGXA 3FTWA 1QP4A 1OWPA 2YQ8A 4HVBA 1U3DA 3CROL 1HF8A 3CQCB 2H8RA 5FZSA 1E8YA 3FH5A 2XRZA 4UQYA 1HFAA 4B0ZA 1HS6A 4AM9A 4YBAA 1PC2A 4GQMA 4R7LA 2PUFA 2WMOA 3D9IA 3JUIA 4G23A 4WNDA 5G55A 4ATGA 4HOSA 3KZ3A 3I4RB 4J6IA 4PS8A 3S7DA 2V4LA 2WXKA 2HYZA 3MV3B 4JW1A 4AOFA 3KD7A 5JHAA 1CJGA 2FF4A 3PUJA 3U4TA 3L16A 4NRHB 5JHBA 3MCXA 5EKQD 5A23A 4FN3A 3EHMA 4Y42A 3ASGA 4I17A 5AENA 1TJCA 2KZTB 2CSFA 1P5QA 2WXIA 2XRYA 4LRZA 4ACKA 4AIFA 4EZKA 3B7SA 3UPVA 3JQ1A 3SCHA 4K03A 3QOUA 2PE5A 4OVVA 3BD1A 3CVQA 3QJZA 2ICPA 2R17C 2I9CA 1FVHA 1HH8A 4OYSA 2OV8A 4XIFA 2IOSA 2X3MA 1IQRA 2R63A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZAY A;  3R1F A;  3UFD A;  1PNR A;  2MQK A;  4F8D A;  1JWL A;  2L8N A;  1QPZ A;  3O9X A;  4MCX A;  3DNV B;  2JCG A;  1DW9 A;  4FBI A;  3QYX A;  3PXP A;  2PUA A;  1WET A;  1ZZC A;  4O8B A;  4X4C A;  3B7H A;  2LYQ A;  5K98 B;  1OCT C;  4X4G A;  1JH9 A;  2BJC A;  1QQB A;  3ZKC A;  4X4H A;  2XI8 A;  3RZZ A;  2PUD A;  2ICT A;  2MEZ A;  1E3O C;  1BDH A;  4I6T A;  2A6C A;  2BNM A;  2LYS A;  3FYA A;  4OB4 A;  4Z59 A;  1PRA A;  2XJ3 A;  2OR1 L;  1YSE A;  4Z5C A;  1ZZ6 A;  2PUC A;  3G5G A;  4IVZ A;  2O49 A;  1RZS A;  2AXV A;  2GZU A;  2HSG A;  3QWG A;  1DWK A;  4YG1 A;  3QF3 A;  3IVP A;  3CEC A;  3EUS A;  2KEJ A;  2XIU A;  2EWT A;  4J1W A;  3TRB A;  1WH6 A;  3F51 A;  2KEI A;  1RIO A;  1Y9Q A;  1IC8 A;  4X4D A;  1BDI A;  1JFT A;  1ZVV A;  1R69 A;  3OQO A;  3MLF A;  2BNO A;  2KZ8 A;  1LCD A;  2JVL A;  4JCX A;  4Z5D A;  4X4F A;  2LYR A;  3KXA A;  4PU3 C;  2BNN A;  1S7E A;  2D5V A;  1ZZ8 A;  3SCG A;  2PIJ A;  3OMT A;  2IUO A;  1HF0 A;  1B0N A;  1NEQ A;  2AXZ A;  2KPJ A;  1ZZB A;  3ZHM A;  2IVG A;  1XWR A;  1X2L A;  1LMB 3;  4PU7 A;  3SCF A;  3D1N I;  3HZI B;  3GN5 B;  1LQC A;  1ZPQ A;  2AUW A;  1OSL A;  1JFS A;  1ZZ9 A;  4MCT A;  4I6U A;  1WIZ A;  1EFA A;  2OFY A;  1NER A;  1Y7Y A;  1RZR D;  1L1M A;  4NDW A;  2O38 A;  3QQ6 A;  4I6R A;  3F6W A;  4Z5H A;  2EBY A;  1ZUG A;  2XCJ A;  2B5A A;  4PU4 C;  3VK0 A;  2AWI A;  2O4A A;  3F52 A;  2L49 A;  3GBF A;  3LIS A;  4PU8 A;  3L1P A;  3JXC L;  1AU7 A;  1PRU A;  4Z58 A;  3JXB C;  1RZR A;  3KJX A;  2EF8 A;  1ZZ7 A;  2WIU B;  2CRO A;  2HIN A;  4YG4 A;  1CQT A;  2LCV A;  3CLC A;  1UXD A;  2LYK A;  1QQA A;  1RPE L;  3S8Q A;  1ZS4 A;  3FMY A;  1R63 A;  2IU7 A;  4X4I A;  3JXD L;  3OP9 A;  2GRM A;  4GHJ A;  1GT0 C;  1UXC A;  3LFP A;  3G7D A;  1WH8 A;  3ZHI A;  4X4E A;  1QP4 A;  4I8T A;  1PRV A;  3CRO L;  2IVB A;  2H8R A;  2PUE A;  1O4X A;  1LLI A;  2LYL A;  4GQM A;  4YBA A;  2R1J L;  2PUF A;  4IA8 A;  2AXU A;  2FJR A;  1LCC A;  4JQD A;  2WUS R;  2AW6 A;  3KZ3 A;  2PUB A;  3U3W A;  3FYM A;  3BDN A;  1PER L;  2LYP A;  1CJG A;  4YG7 B;  1X57 A;  2GRL A;  4YAR A;  3OQN A;  3GN5 A;  1POU A;  4FN3 A;  3H5T A;  2KEK A;  2PUG A;  4Y42 A;  3OQM A;  3BS3 A;  2PPX A;  4X4B A;  2CSF A;  2XSD C;  4JCY A;  2LYJ A;  1QP0 A;  1ADR A;  3SCH A;  2PE5 A;  4J1X A;  3BD1 A;  5A7L A;  2ICP A;  4IWR A;  1VPW A;  1UTX A;  1QP7 A;  2IV1 A;  2IVQ A;  1SQ8 A;  2R63 A; 
#chains in the Genus database with same CATH topology
 4GA1 A;  4BY6 A;  1E8X A;  4L9P A;  1HO8 A;  5EDS A;  4DUI A;  4GYY A;  4NQ0 A;  3TWS A;  2BJC A;  1QQB A;  2WXF A;  4UWL A;  3TAX A;  2XI8 A;  2DZN A;  2QZA A;  3IHV A;  4LUN U;  1TNO A;  2WXO A;  4MKT A;  4EKG A;  4PDX A;  3V79 K;  4CDR A;  2PUC A;  1DCQ A;  3ASO E;  3KSQ A;  2P2C P;  2I6H A;  1IC8 A;  4ER0 A;  2NC9 A;  3C72 A;  3ML9 A;  3DWL G;  3VLE A;  3G2W A;  4X4F A;  4WAF A;  2LYR A;  2IUO A;  1U2V G;  4J8F A;  4HLL A;  3GN5 B;  2AUW A;  2J09 A;  2LNM A;  2ODR D;  5ENS D;  4XI9 A;  3IHY A;  1Z5S C;  4I6R A;  3F6W A;  4PU4 C;  1NFI E;  3O4Z A;  4GA0 A;  3S2A A;  3SBS A;  4BT8 A;  1H2U A;  5B3S E;  2WXJ A;  4K5A B;  4Q94 A;  2L1P A;  3CLC A;  1X5B A;  1R63 A;  2ZIR A;  3NXH A;  4GHJ A;  3LJ3 A;  1OWO A;  2PL2 A;  5FQ7 A;  3ZVV A;  2NYJ A;  2JAB A;  4BWR A;  2OEV A;  5G04 J;  3U66 A;  3ASH A;  3D9L A;  3U3W A;  3JYS A;  3E4B A;  3A9Y A;  4GTQ A;  2LLV A;  1QYM A;  3RRN B;  1UJK A;  4ILH B;  4HFG A;  3FTZ A;  1KZP A;  3BS3 A;  3UT4 A;  1N54 A;  4I9E A;  4ZFH A;  2XQ0 A;  1ADR A;  3AJI A;  4IWR A;  5T3R A;  1UN8 A;  4G26 A;  4KZ0 A;  4J8E A;  1PNR A;  4YDW A;  3HXF A;  2XZD G;  5CER B;  5G05 J;  3SO8 A;  4GML A;  2UWJ G;  5FTP A;  4ANV A;  1UG3 A;  4N5C A;  4Z59 A;  3WG7 E;  3MYV A;  2L0I A;  3DM5 A;  3D9J A;  5KNG A;  2HSG A;  2R5S A;  1TN7 A;  2BED A;  3TG5 A;  2LSU A;  2B6C A;  1LD7 A;  4A55 A;  1FCH A;  3BQO A;  2I1K A;  4TUU A;  3FH7 A;  4I6G A;  3KEZ A;  2VGE A;  5DBK A;  4XI0 A;  3ZPX A;  1OCR E;  1MJ0 A;  3NZS A;  3G2V A;  3JXI A;  1QBQ A;  4GTS A;  3LKU A;  2Y69 E;  4KYO B;  3LS8 A;  2FO7 A;  3EU5 A;  1EDU A;  2RG8 A;  3VTY A;  1JWG A;  1N4R A;  2LUH A;  1HX8 A;  5CRU A;  3JUE A;  1RZ4 A;  3DXM G;  2WXP A;  2LYK A;  3TXM A;  4D10 C;  4UI9 K;  1BPO A;  3G7D A;  3ZXS A;  2NSZ A;  4XZ4 A;  3B7T A;  4LNG A;  3UXG A;  4AV7 A;  4IA8 A;  2AXU A;  4UWH A;  2VSO E;  4C0E A;  2FO1 E;  3L82 A;  2ZGG A;  2IU1 A;  3QNK A;  1K8K G;  4Q96 A;  3RU0 A;  1MHQ A;  1QP0 A;  2R02 A;  4I6J A;  3E34 A;  2I2O A;  3HDX A;  1UTX A;  2EIN E;  3MEK A;  5T4Y A;  4FAD A;  2QFC A;  3MX3 A;  2HCN A;  2Y3A A;  3FUF A;  4X4G A;  1JH9 A;  1YA0 A;  2XXP A;  4AJW A;  1E90 A;  2WXR A;  3HXD A;  3P2B A;  3RJV A;  4UI9 C;  4DE8 A;  4GYW A;  3PH0 C;  1DCE A;  3IEG A;  3KL4 A;  2C0L A;  4JZY A;  1WY6 A;  4HBD A;  4CDM A;  1VDY A;  4LNB A;  3TGO A;  1N94 A;  2XGS A;  4IUL A;  5D0Q D;  4U07 A;  3SR4 A;  3CST A;  3OAW A;  1B0N A;  1FVF A;  3MGB A;  4FA6 A;  2ILR A;  3D1N I;  4L2Y A;  5D66 A;  3PE3 A;  3QAQ A;  2OFY A;  1Y7Y A;  2J4B A;  2CG2 A;  2R05 A;  3FUJ A;  3HHM A;  2PXV A;  2O4A A;  5AQA A;  3ZYL A;  4C48 B;  2L49 A;  3LCA A;  4OAU C;  3Q79 A;  1ELR A;  2QYU A;  3PUK A;  2PXK A;  4CGV A;  1FPP A;  3S7J A;  5HI7 A;  3CVY A;  3UT7 A;  3TWQ A;  3ZPJ A;  5BV1 A;  1UXC A;  2BF0 X;  3FP3 A;  5C2Y A;  3AU5 A;  2LYL A;  2EIL E;  2XPZ A;  1BD8 A;  2LXM A;  3DSU A;  3FYM A;  1S63 A;  3ZW3 A;  5ENN A;  1KZO A;  3GN5 A;  2Y0B G;  1POU A;  2KCV A;  4FU3 A;  2WM9 A;  3KAE A;  3V31 A;  3SGH A;  4B8C B;  1MYO A;  4JB8 P;  1QP7 A;  5AJL A;  3UX4 A;  2IVQ A;  2VSY A;  1E96 B;  1PAQ A;  3OWQ A;  4F8D A;  5A6C A;  2PQR A;  3FTS A;  2JCG A;  4LNU D;  4EZL A;  3VLD A;  1WET A;  4O8B A;  4X4C A;  5IY5 E;  3DXK G;  4U96 D;  3ASD A;  4IYP A;  2GRR B;  1LTX A;  3TWW A;  3LXU X;  4OB4 A;  1H19 A;  3DPD A;  4M7C A;  2C2L A;  1JCS A;  3LYA A;  3MKR A;  3Q15 A;  3EHQ A;  2EWT A;  4ABN A;  2XZT G;  3Q7F A;  3TWU A;  3UMV A;  5ANL A;  5KJM A;  4L7T A;  3PNL B;  4JD2 G;  4XKC A;  4CT4 A;  4IRU A;  5GAG i;  3L9T A;  2IVG A;  3ZIM A;  4H7Y A;  4BT9 A;  1D8D A;  2YHC A;  3J5P A;  3CVV A;  3IXE A;  3KJX A;  5FQ6 A;  4UWK A;  1S0P A;  3NRO A;  4YDE A;  4EKI A;  1QQA A;  5EX0 A;  4N3A A;  4DPR A;  4U0U A;  3Q73 A;  1QB2 A;  3QFI A;  3FTW A;  3SFX A;  2QYJ A;  5FZS A;  4BSZ B;  1PC2 A;  2WMO A;  5G55 A;  4AOF A;  1H6O A;  3UI2 A;  5JHA A;  1CJG A;  3PUJ A;  5JHB A;  5A23 A;  4F1P A;  2H6F A;  3EHM A;  2P9U G;  3ASG A;  3ABL E;  2CSF A;  2V4H C;  3E30 A;  5KBA A;  2ICP A;  3Q9U C;  2OV8 A;  3FTV A;  3DSX A;  3RAU A;  2BKK B;  3FUK A;  3AS4 A;  2UY1 A;  4HRA A;  2F8Y A;  1OCT C;  1MQS A;  2X6K A;  1OWM A;  3ZEF A;  2M63 A;  3P1U A;  4BEP A;  5KJN A;  1N4P A;  1IXV A;  5FIO A;  1ZZ6 A;  2YHE A;  3G5G A;  4FHK A;  2PM6 A;  4GCO A;  5D0O D;  2XIU A;  4J1W A;  4ER5 A;  4WVL A;  1Y9Q A;  5BW8 C;  1H2T C;  4N5Q A;  3SX0 A;  2CG3 A;  1JWF A;  1G3N B;  1LCD A;  2RKK A;  5AN8 A;  1RW2 A;  3Q5M A;  5DT2 A;  3AG4 E;  5ENO D;  1E8Z A;  3R09 A;  3F6Q A;  1XGW A;  3HZI B;  4U8V D;  2FUL A;  4I6U A;  1RZR D;  3EDT B;  1L1M A;  4UQZ A;  3V30 A;  4FUL A;  4N3B A;  3FWV A;  5G04 C;  2L9B A;  3TEL A;  2XCJ A;  5ARG A;  2AWI A;  4YVQ C;  1RZR A;  4YG4 A;  3VLF A;  3R9A B;  1TNB A;  2F0Y A;  4HOU A;  3EHN A;  2X38 A;  2EIJ E;  4FHJ A;  3BG0 B;  2DYR E;  3C98 A;  1HG5 A;  3Q9N C;  2H6G A;  4ER6 A;  2R1J L;  4JQD A;  1ELK A;  2R2L A;  4DX5 D;  4BTA A;  4JC8 A;  3CKC A;  3T8M A;  1X57 A;  4GAA A;  3HVE B;  5DTM A;  5BPP A;  3OQM A;  4X4B A;  2YBD A;  1NA3 A;  4GZ3 A;  2AJA A;  4HVB A;  3D9P A;  1HG2 A;  3PRZ A;  4WWO A;  4F53 A;  1EF1 C;  2R59 A;  5LFA A;  3PZ2 A;  5CCL A;  2L0T B;  4RG6 A;  1DUL A;  4OAV B;  2PXT A;  3MV2 B;  1DW9 A;  5D2M C;  4BSX A;  1D8E A;  4KBQ A;  3L6A A;  1EYH A;  5LP0 A;  4B94 A;  2MEZ A;  2MHK A;  2MRI A;  2CFZ A;  3T5V A;  4OBM A;  4U63 A;  3D9N A;  4YG1 A;  4AY6 A;  3IVP A;  3MZL B;  1RIO A;  4JA9 A;  3LVR E;  1S70 B;  2J7W A;  2XGO A;  3PS6 A;  1MFQ C;  3CVP A;  3FU0 A;  3S7F A;  4DX7 D;  4G25 A;  4E6H A;  1BLX B;  4JVS A;  4LER A;  1O1T A;  2WQ7 A;  3UM1 A;  3NZU A;  5AIJ A;  4JPS A;  1XWR A;  1WM5 A;  3ZKJ A;  1OSL A;  2V5Q C;  5JMN D;  3TWX A;  4ANW A;  2OCC E;  3PE4 A;  4O1O A;  4LCT A;  4FC8 A;  3RRM B;  4KT6 B;  4DRX E;  3RO2 A;  1ZZ7 A;  3OTN A;  2HIN A;  4HXI A;  1CQT A;  4PUC A;  4EBA A;  4UUC A;  3OP9 A;  1IKN D;  4X4E A;  4I8T A;  3NOG D;  4HS2 A;  3QK0 A;  4XKB A;  1KPS B;  2P9S G;  1O5M A;  4XX5 A;  2PUE A;  4U0Z A;  3LQX A;  5ENR D;  3FH8 A;  5CBO A;  2DZO A;  2HR2 A;  5CEC B;  1NZN A;  3VWS A;  5GAH i;  2PUB A;  3C3R A;  2HE0 A;  3HRA A;  3G2T A;  3ONL A;  1MX6 A;  3OQN A;  1A5E A;  3EJN A;  2LYJ A;  2IO3 C;  4I9C A;  2AVP A;  3C5R A;  4U8H A;  5JA4 D;  2PQN A;  1K3Z D;  3UFD A;  3PZD A;  3ML8 A;  2KM4 A;  3QYX A;  4BET A;  3WXX A;  3UQ3 A;  4O6F A;  3KEA A;  2WXM A;  3AG3 E;  2KC7 A;  2IY0 C;  3ISM C;  4U04 A;  2BUG A;  1AWC B;  4X8Q A;  2A6C A;  1PRA A;  3I4G A;  1YSE A;  4AY5 A;  2WXQ A;  3OXF A;  2JEK A;  1Q2Z A;  2ETC A;  2WXN A;  2CHW A;  2CHX A;  2ETA A;  1KT0 A;  2GRQ B;  1OCO E;  4GZC A;  2V8S E;  3QC1 A;  4KXK B;  1EPU A;  1MZC A;  4WUY A;  3SFY A;  1XNF A;  3L08 A;  5FZR A;  4FLH A;  1OY3 D;  1JFS A;  2ZGD A;  2C0M A;  5CED B;  1KT1 A;  3CK8 A;  3FUI A;  2PXU A;  3F52 A;  4PH4 B;  3JXB C;  2PXP A;  1SQM A;  4G2V A;  5EX3 A;  3EUV A;  5DTQ A;  2WXG A;  5BV0 A;  3OKZ A;  2RFA A;  4I43 A;  2IU7 A;  4X4I A;  4I1M A;  1WH8 A;  3HXC A;  5G2N A;  4FJY A;  4HNA D;  3ZYK A;  2IQC A;  1O1R A;  3X2Q E;  2KZT A;  2WUS R;  2AW6 A;  2KCK A;  3TL5 A;  4U8Y D;  1PER L;  1TN6 A;  4F6R D;  4APF A;  5CEA A;  2J4D A;  4EBA G;  4LG6 A;  2YNQ A;  4J1X A;  5B1B E;  4L1B A;  4WWP A;  3FTY A;  4A3T A;  1O1S A;  2J8S D;  3UM0 A;  4FBI A;  4HRL A;  3Q78 A;  2LYQ A;  4FP7 A;  3FFL A;  3APD A;  4JHR A;  2A4Z A;  2PUD A;  3T5X A;  3LVQ E;  2J49 A;  4GTO A;  3MKQ B;  3RIB A;  3M9L A;  2KEJ A;  1DNP A;  3SFZ A;  3QWW A;  3HVE A;  5AQ7 A;  1R69 A;  2BNO A;  3FUH A;  1X81 A;  4ME2 A;  3PNT B;  5EYL A;  4U0S A;  1QNF A;  2PIJ A;  3AS5 A;  3EU9 A;  4DJA A;  5HQ8 A;  3QWV A;  2DCP A;  3ZHE B;  5CHE E;  4BFR A;  2BTD A;  3ASN E;  4NDW A;  3EIQ C;  2EBY A;  3NBN B;  3W9G A;  4K5C A;  5AJD A;  3JXC L;  4J7W A;  2WXH A;  4EZI A;  4HRM B;  2F37 A;  4JEU A;  4GPM A;  3FTX A;  2OOE A;  1QP4 A;  1OWP A;  1SA4 A;  3CQC B;  2H8R A;  3FH5 A;  4UQY A;  4B0Z A;  3GUU A;  4R7L A;  4WND A;  3I4R B;  2HYZ A;  4JW1 A;  2PNN A;  3MCX A;  2WXI A;  2XRY A;  4AIF A;  2KXP C;  3QOU A;  1N4S A;  2R17 C;  2I9C A;  4OYS A;  2IOS A;  1SZ9 A;  1OWN A;  4RQI A;  2ZIS A;  3O9X A;  4MCX A;  3APC A;  4I2W A;  4I2Z A;  3PXP A;  3UIN C;  4I6E A;  3NF1 A;  3CEQ A;  1OT8 A;  2WQH A;  3ZKC A;  4Y6W A;  4NIK A;  1JCQ A;  4CCA A;  2WQ6 A;  4EQF A;  2XJ3 A;  4C0M A;  1YMP A;  3OXL A;  3ESK A;  4W9R A;  4A1S A;  1DWK A;  2EIM E;  2J7U A;  1SVX A;  3QAR A;  3DPY A;  3D9M A;  4MBG A;  1BI7 B;  4QFV A;  1U2Z A;  3CVW A;  1KLX A;  2QY7 A;  2JVL A;  4LEU A;  4XEI G;  1OCC E;  3KXA A;  2D5V A;  3SCG A;  1JCR A;  3B7R L;  3J5Q B;  2UY1 B;  4ANX A;  2P58 C;  3PDN A;  4DX6 D;  3L22 A;  4J8S A;  3U4T A;  4Z5H A;  4KZC A;  3ZUV B;  3VK0 A;  4PU8 A;  3Q4A B;  1PRU A;  1TNU A;  2PXE A;  2EIK E;  2HO1 A;  2VSX E;  4GB9 A;  3Q49 B;  4UQX A;  3IKO B;  3FEY A;  3R9M A;  1PRV A;  2IVB A;  5ENT D;  3ZNG A;  1UN9 A;  3Q75 A;  1SA5 A;  2XEH A;  3D9H A;  4I1A A;  3SZ7 A;  3SQV A;  2LYP A;  2FI7 A;  2Q7F A;  3L17 A;  4CZ2 D;  2PPX A;  3JCK C;  2V0P A;  3ENE A;  3PEU B;  3R7R A;  3B95 A;  2LSV A;  2IV1 A;  4DE9 A;  1IHB A;  4FLB A;  4JXT A;  2H6I A;  2MQK A;  5LX8 A;  1JWL A;  3TWV A;  4Y6C A;  3B7H A;  5BUZ A;  5K98 B;  3CHQ A;  4GYO A;  5G05 C;  1PY1 A;  3UT8 A;  4TXP A;  2IEJ A;  4KVO A;  5HKP A;  5KJK A;  5CCM A;  4BER A;  2OR1 L;  4IN3 B;  3PEV B;  5ANR A;  3TXN A;  3TRB A;  3FTU A;  4U7E B;  3E32 A;  3HXB A;  4GTR A;  1JFT A;  3SHF A;  3VTX A;  3EIJ A;  3ZHE A;  2WPV A;  1S64 A;  1S7E A;  3BUA A;  3PE5 A;  3QDN A;  1ZZB A;  3ZHM A;  2XPI A;  2EQX A;  4V3I A;  3GZ1 A;  4PU7 A;  4RG9 A;  5BNW A;  2DYS E;  5A7D B;  4A63 B;  1NL4 A;  3G2S A;  5C1D A;  1ZUG A;  2B5A A;  1AU7 A;  2FFH A;  2GRP B;  3RO3 A;  5EN5 D;  2WIU B;  4GZD A;  4MRU A;  4O1P A;  4HI8 A;  3E37 A;  1E7V A;  3ZYM A;  4TRQ A;  3PZ4 A;  3NAW A;  2GGF A;  5ARF A;  2V5F A;  1QQE A;  3URZ A;  4UWG A;  1OXJ A;  4YND A;  2FJR A;  4ATZ D;  3AAA C;  3T9K A;  3CHR A;  3ABK E;  4PS3 A;  2Y1L E;  4YG7 B;  2MOW A;  1DC2 A;  4CYM D;  4RLY A;  4GU5 A;  2KEK A;  1DVP A;  1UW4 B;  4GPK A;  4TXQ A;  5FJY A;  1E7U A;  3Q47 B;  2J9Q A;  1VPW A;  2QC9 A;  3APF A;  2KAT A;  4HOR A;  3AU4 A;  2XPY A;  4J8Y A;  3NB2 A;  3LJN A;  1ZZC A;  4U95 D;  4E85 A;  2PXD A;  3NDB B;  3GW4 A;  3GZD C;  3ME5 A;  4APO A;  3V2O A;  3FY4 A;  5LCW C;  2VYI A;  1YYH A;  4GTM A;  2AXV A;  4GMJ A;  5LCW J;  3SD5 A;  3EUS A;  5JJT A;  1BDI A;  3AG1 E;  5FZQ A;  5B1A E;  3CVU A;  2P9L G;  3CR3 A;  4Z5D A;  5JJ6 A;  4GTP A;  2HCS A;  1ZZ8 A;  1UOH A;  1NEQ A;  5EID A;  4MCT A;  4HLE A;  3FUE A;  1NER A;  4MS6 A;  1N52 A;  4HOQ A;  2X6I A;  1N0R A;  3G0T A;  3JXD L;  5LOZ A;  3GZD A;  1GT0 C;  3UKU G;  3W9F A;  3LFP A;  4DX1 A;  3ZHI A;  1SZA A;  1QZX A;  3L54 A;  4DLQ A;  2LLW A;  2Y4U A;  3CKB A;  5ENQ D;  4JA7 A;  3ZRH A;  4AP2 A;  4GTV A;  4RVB A;  3BDN A;  4XE0 A;  3ONK A;  4A3V A;  2GRL A;  1U3C A;  3L13 A;  4ACL A;  4ER7 A;  1TJF A;  3CQG B;  4GTT A;  1H2V C;  3QWP A;  4J8D A;  4J0U A;  2MYO A;  2E2E A;  3ZGQ A;  2PZI A;  3A9Z A;  4OVU A;  1D9S A;  1ZAY A;  1TNY A;  2PXF A;  2XCC A;  2RD0 A;  3UM2 A;  3TFL A;  4YVO A;  2PUA A;  2ZXW E;  4TXR A;  4G8L A;  2DWZ A;  5FWQ A;  3ZU7 B;  4X4H A;  4GCN A;  4ILI A;  4ZHB A;  1BDH A;  4HOT A;  5AQ9 A;  4I1O B;  3CVL A;  4G1T A;  4N2S A;  5AYW D;  3QWG A;  2XEN A;  1AP7 A;  4Z68 A;  3SF4 A;  2ION A;  4CGW A;  2VTB A;  2GW1 A;  2R03 A;  3DEO A;  2PXB A;  3PZ3 A;  5BXU A;  3OQO A;  4EEC A;  2IJG X;  4JCX A;  4EPZ A;  3FUN A;  4KMO A;  2BNN A;  3R7Q A;  1HF0 A;  2XEV A;  2KPJ A;  1X2L A;  3FUM A;  3CLJ A;  4HRN A;  2X6F A;  4AXH A;  4WNF A;  5FT9 A;  1OCZ E;  1HZ4 A;  4WWN A;  1NP7 A;  1V54 E;  1FT2 A;  4Z58 A;  5AAR A;  3FUL A;  4HI9 A;  3LY8 A;  2FEZ A;  1E8W A;  3DST A;  5CBN A;  3C3Q A;  3S8Q A;  3UKR G;  1MX4 A;  3BG1 B;  4URK A;  1Y8M A;  1B89 A;  2VGX A;  2YQ8 A;  1U3D A;  3CRO L;  1HF8 A;  5EIL A;  2XRZ A;  1HFA A;  4AM9 A;  4GQM A;  3JUI A;  4G23 A;  3D9I A;  4ATG A;  4HOS A;  3KZ3 A;  4J6I A;  1TN8 A;  2V4L A;  2WXK A;  3MV3 B;  3KD7 A;  3L16 A;  4FN3 A;  2L6B A;  2P9I G;  5AEN A;  1TJC A;  2KZT B;  4K03 A;  2PE5 A;  3BD1 A;  1HH8 A;  4XIF A;  2X3M A;  1IQR A;  2R63 A;  4CDN A;  1JPL A;  3B13 A;  2IOL A;  3GZS A;  5FIN A;  4BES A;  3ZN3 A;  4ILG A;  3MJW A;  4PS7 A;  5HS0 A;  1BU9 A;  1E3O C;  2VQ2 A;  2BNM A;  2HFZ A;  5BXO A;  1TYQ G;  2Y4T A;  3NQP A;  1A17 A;  2O49 A;  1RZS A;  3CIA A;  4F1S A;  1K1A A;  3HG0 D;  1N0Q A;  1OWL A;  4H7X A;  4DK5 A;  3ULE G;  5FQ4 A;  3FEX A;  3ESL A;  2E0I A;  4L23 A;  2IFU A;  2XEE A;  2B0O E;  3T8K A;  4TUM A;  3JXJ A;  1ELW A;  1LF8 A;  4A1G A;  4GZ6 A;  2AXZ A;  1Z6T A;  2P9N G;  1TR4 A;  2BKG A;  1JUQ A;  4QQI A;  3SCF A;  2RFM A;  3CK7 A;  2GRO B;  3CHM A;  1MX2 A;  1WIZ A;  2P9K G;  3UUX A;  4DI3 A;  2XXQ A;  1BI8 B;  3QQ6 A;  1V55 E;  4GZ5 A;  3PZ1 A;  1NA0 A;  4O60 A;  3GBF A;  3QB2 A;  3FU6 A;  3NOC D;  4B89 A;  4JHJ A;  2M4H A;  3CK9 A;  3TWR A;  4N39 A;  5KJL A;  3SY2 A;  3FU5 A;  1UJJ A;  4Q2J A;  3LY7 A;  3UM3 A;  3G2U A;  3ASF A;  2WB2 A;  5E76 A;  4B8A A;  1LLI A;  1LCC A;  3I5P A;  4N3C A;  4JHK A;  3EHR A;  4BX8 A;  3JQ0 A;  3TG4 A;  4EK9 A;  4YAR A;  3H5T A;  4WNE A;  4JCY A;  3HXE A;  4P29 A;  3AG2 E;  4EQZ A;  4FJZ A;  1N11 A;  5EYP F;  1SQ8 A;  3R1F A;  3DNV B;  2VEO A;  3LDZ A;  3QOW A;  2PXQ A;  3FHE A;  4HQD A;  1HQ1 A;  5CMY A;  2XCB A;  1TEZ A;  1W3B A;  4ANU A;  3RSE G;  2OEW A;  3QF3 A;  2XS8 A;  3CEC A;  3SI5 A;  4K0R A;  4X4D A;  1IYG A;  3TEP A;  2PXL A;  3U9W A;  3QOX A;  4PU3 C;  2A5U A;  2LXL A;  2LNI A;  1N4Q A;  3ZYQ A;  3GZ2 A;  3ABM E;  5KWD A;  1LQC A;  3ZFW A;  3SBT B;  4DI4 A;  1EFA A;  2WXL A;  2O38 A;  3B7B A;  5DRY A;  3LIS A;  3E33 A;  3BEE A;  3MKQ A;  3ULY A;  3OXG A;  2EF8 A;  2VGX B;  4K5B A;  3TWT A;  1GW6 A;  3D9K A;  3CVX A;  3NZL A;  4GMR A;  4CEM A;  1Y6I A;  3UTM A;  4N2Q A;  2FBN A;  2LO6 A;  3DSS A;  4C9B B;  2GRN B;  3FDH A;  5HRY A;  5EIB E;  3MEJ A;  3N71 A;  2PUG A;  3Q7A A;  2XS1 A;  3CHP A;  2XSD C;  4G24 A;  2LAH A;  3GYZ A;  4AVX A;  4TV3 A;  3B7U X;  1SW6 A;  2DVW A;  2YIN A;  2V3C C;  4YDO A;  5CMW A;  3U64 A;  3RRU A;  4NUR A;  2H6H A;  3LEW A;  3CV0 A;  1QPZ A;  3S7B A;  3A9X A;  5JJ7 A;  3KSL A;  5H7P A;  5CRV A;  3C3O A;  2JQE A;  2OND A;  4I6T A;  2LYS A;  3FYA A;  2KCL A;  4WNG A;  3I3N A;  3IV0 A;  1OUV A;  4IVZ A;  5DTR A;  3GZC A;  2DIW A;  3MA5 A;  1TNZ A;  1H0A A;  1IQU A;  2ETB A;  3ULQ A;  1WH6 A;  3F51 A;  2KEI A;  4MLP A;  4M3O A;  3ZXP A;  1ZVV A;  1Z3Y A;  2I1J A;  4BTB A;  4Q69 A;  2CHZ A;  4AEZ C;  1H6P A;  1IHG A;  1N95 A;  3OMT A;  3D9O A;  2VTB B;  2LAI A;  2NXP A;  3DRA A;  1LMB 3;  3HYM B;  3RKV A;  3PVL A;  2VSN A;  3TJP A;  1YCS B;  2CFU A;  4JEH A;  3KS2 A;  5BT1 A;  5DSX A;  1QZ2 A;  1WDY A;  4DLO A;  4F7A A;  3RK6 A;  4YDY A;  2XXA A;  1ZBP A;  3UIP C;  3IBE A;  2LCV A;  3O48 A;  1ZS4 A;  3FMY A;  1L5J A;  4UWF A;  4B93 B;  3DSV A;  2GRM A;  3LPZ A;  2WMN A;  5KCM A;  2J07 A;  1ZU2 A;  3AS8 A;  1O4X A;  2WVI A;  3DBS A;  4CT0 A;  4ER3 A;  2X6J A;  4EHM A;  4BX9 A;  3DEP A;  3V2X A;  3DSW A;  2VJ8 A;  5AAO A;  5A7L A;  2DBA A;  2XHE A;  3CSF A;  5ITZ F;  5M72 A;  4RSY A;  4L2L A;  5DRT A;  1FT1 A;  4DX2 A;  3FUD A;  4KVM A;  2JLB A;  1H6K A;  2IO2 C;  3CHS A;  4F3V A;  2L8N A;  5E75 A;  4NAC A;  2XGM A;  1ZB1 A;  3HIZ A;  3RZZ A;  1WG0 A;  2HM8 A;  4GA2 A;  2ICT A;  2VGY A;  2OVF A;  3PRE A;  4Z5C A;  2IF4 A;  5FQ8 A;  2GZU A;  3K9I A;  4LSZ E;  5J90 A;  4EZJ A;  2F8X K;  3QKY A;  2A5E A;  1HU3 A;  2OVB A;  3MLF A;  2KZ8 A;  2PM7 A;  5J08 A;  2KBX A;  5JUW A;  3SNX A;  2X6H A;  1WAO 1;  1K1B A;  1ZPQ A;  1ZZ9 A;  2L6J A;  3BU8 A;  4G8K A;  1HE8 A;  5DIZ A;  4UI9 J;  4G11 A;  1Z3X A;  3L1P A;  2MXD A;  3CGH A;  1INZ A;  2ZU6 B;  1NI1 A;  2CRO A;  5KNH D;  5T8I A;  1UXD A;  3CVN A;  3LY9 A;  1RPE L;  3UIO C;  2J08 A;  1HXI A;  3FU3 A;  4CRW A;  3CHO A;  5AQB A;  3D3M A;  4JL0 A;  5ENP D;  1E8Y A;  1N9A A;  1HS6 A;  4YBA A;  2PUF A;  3S7D A;  4PS8 A;  3UWP A;  2P9P G;  2FF4 A;  4NRH B;  5EKQ D;  1LD8 A;  4Y42 A;  4I17 A;  4LRZ A;  1P5Q A;  4ACK A;  4EZK A;  3B7S A;  3UPV A;  3JQ1 A;  3SCH A;  4OVV A;  3CVQ A;  3QJZ A;  4HB5 A;  1NW3 A;  1FVH A; 
#chains in the Genus database with same CATH homology
 1JPL A;  3B13 A;  2IOL A;  3FUK A;  1SZ9 A;  4GA1 A;  4BY6 A;  3GZS A;  1E8X A;  1OWN A;  3O9X A;  4MCX A;  3AS4 A;  1HO8 A;  3APC A;  4I2W A;  2UY1 A;  4I2Z A;  3PXP A;  5EDS A;  4GYY A;  4NQ0 A;  3ZN3 A;  1OCT C;  4I6E A;  4ILG A;  3NF1 A;  3CEQ A;  3MJW A;  1MQS A;  2WQH A;  2BJC A;  1QQB A;  2WXF A;  4PS7 A;  4UWL A;  3ZKC A;  2X6K A;  1OWM A;  3TAX A;  3ZEF A;  2XI8 A;  2M63 A;  3IHV A;  4LUN U;  4Y6W A;  1E3O C;  2VQ2 A;  2WXO A;  3P1U A;  4MKT A;  5KJN A;  4PDX A;  2BNM A;  4CCA A;  2WQ6 A;  2Y4T A;  4EQF A;  2XJ3 A;  4C0M A;  3NQP A;  1A17 A;  1ZZ6 A;  2YHE A;  3OXL A;  2PUC A;  3G5G A;  2O49 A;  2PM6 A;  1RZS A;  3CIA A;  3ESK A;  4FHK A;  4W9R A;  4A1S A;  4F1S A;  1DWK A;  4GCO A;  3QAR A;  5D0O D;  2XIU A;  1IC8 A;  4J1W A;  2I6H A;  1OWL A;  4H7X A;  5BW8 C;  4DK5 A;  1Y9Q A;  2NC9 A;  3D9M A;  1H2T C;  3ML9 A;  4QFV A;  5FQ4 A;  3FEX A;  3ESL A;  3CVW A;  2CG3 A;  1KLX A;  1JWF A;  2E0I A;  2QY7 A;  3VLE A;  1LCD A;  2JVL A;  2IFU A;  4LEU A;  4L23 A;  3G2W A;  4X4F A;  4WAF A;  2LYR A;  3KXA A;  1ELW A;  2D5V A;  3SCG A;  1LF8 A;  3Q5M A;  2IUO A;  4A1G A;  1E8Z A;  3B7R L;  4GZ6 A;  2AXZ A;  1Z6T A;  4J8F A;  2UY1 B;  1XGW A;  1JUQ A;  3SCF A;  3HZI B;  4ANX A;  3GN5 B;  3CHM A;  3CK7 A;  2AUW A;  2J09 A;  2P58 C;  2FUL A;  3PDN A;  4I6U A;  1WIZ A;  3UUX A;  4DI3 A;  1RZR D;  3EDT B;  1L1M A;  3L22 A;  4UQZ A;  4FUL A;  3IHY A;  4N3B A;  3FWV A;  4XI9 A;  5G04 C;  3QQ6 A;  4I6R A;  2L9B A;  3F6W A;  4Z5H A;  2XCJ A;  4GZ5 A;  4J8S A;  4KZC A;  1NA0 A;  4PU4 C;  3VK0 A;  2AWI A;  5ARG A;  3GBF A;  3O4Z A;  4PU8 A;  4GA0 A;  3QB2 A;  3FU6 A;  1PRU A;  3Q4A B;  4YVQ C;  3S2A A;  3SBS A;  4BT8 A;  1H2U A;  4B89 A;  4JHJ A;  1RZR A;  4YG4 A;  2WXJ A;  3VLF A;  3CK9 A;  2HO1 A;  4Q94 A;  2VSX E;  4GB9 A;  3R9A B;  4N39 A;  5KJL A;  3CLC A;  3FU5 A;  3Q49 B;  1X5B A;  4UQX A;  4HOU A;  1UJJ A;  3IKO B;  1R63 A;  3FEY A;  3LY7 A;  3EHN A;  2X38 A;  4FHJ A;  4GHJ A;  3BG0 B;  3G2U A;  3LJ3 A;  3ASF A;  1HG5 A;  1OWO A;  2PL2 A;  3C98 A;  5FQ7 A;  2WB2 A;  3ZVV A;  1PRV A;  5E76 A;  2IVB A;  4B8A A;  4BWR A;  5G04 J;  1LLI A;  3U66 A;  1UN9 A;  2R1J L;  4JQD A;  1ELK A;  1LCC A;  3I5P A;  4N3C A;  3ASH A;  4JHK A;  3D9L A;  4BX8 A;  3U3W A;  4I1A A;  3JYS A;  4BTA A;  3SZ7 A;  3JQ0 A;  2LYP A;  3E4B A;  2FI7 A;  3TG4 A;  2Q7F A;  4JC8 A;  3CKC A;  3L17 A;  3RRN B;  3T8M A;  1X57 A;  4YAR A;  1UJK A;  4ILH B;  4HFG A;  4GAA A;  3HVE B;  5BPP A;  3H5T A;  3OQM A;  3FTZ A;  3BS3 A;  2PPX A;  4X4B A;  4WNE A;  3UT4 A;  1NA3 A;  4GZ3 A;  3JCK C;  1N54 A;  4JCY A;  2V0P A;  3ENE A;  3PEU B;  4I9E A;  2XQ0 A;  4P29 A;  3D9P A;  1ADR A;  1HG2 A;  3PRZ A;  4WWO A;  4F53 A;  4FJZ A;  1EF1 C;  3R7R A;  4IWR A;  5T3R A;  2LSV A;  2R59 A;  1UN8 A;  2IV1 A;  4G26 A;  1SQ8 A;  5LFA A;  4KZ0 A;  5CCL A;  2L0T B;  4RG6 A;  3R1F A;  4J8E A;  1PNR A;  4FLB A;  4JXT A;  2MQK A;  5LX8 A;  1JWL A;  3DNV B;  3MV2 B;  1DW9 A;  4Y6C A;  5G05 J;  4BSX A;  3B7H A;  3LDZ A;  5BUZ A;  5K98 B;  3CHQ A;  4GYO A;  4KBQ A;  3FHE A;  3L6A A;  4GML A;  5G05 C;  1PY1 A;  1EYH A;  3UT8 A;  5LP0 A;  4B94 A;  2UWJ G;  5CMY A;  2MEZ A;  2MHK A;  2MRI A;  5FTP A;  4ANV A;  2XCB A;  4KVO A;  5KJK A;  1UG3 A;  4N5C A;  4Z59 A;  5CCM A;  2CFZ A;  3T5V A;  3MYV A;  1TEZ A;  2OR1 L;  2L0I A;  1W3B A;  4IN3 B;  4ANU A;  3D9J A;  2HSG A;  2R5S A;  3TG5 A;  4U63 A;  2LSU A;  3D9N A;  4YG1 A;  3PEV B;  3QF3 A;  5ANR A;  4AY6 A;  3IVP A;  3TXN A;  3CEC A;  3SI5 A;  4A55 A;  3MZL B;  1FCH A;  3TRB A;  1RIO A;  3FTU A;  4K0R A;  2I1K A;  4JA9 A;  3LVR E;  4TUU A;  3FH7 A;  4X4D A;  1JFT A;  2XGO A;  1IYG A;  3SHF A;  3VTX A;  4I6G A;  3PS6 A;  3EIJ A;  3U9W A;  3CVP A;  3FU0 A;  3S7F A;  3ZHE A;  3KEZ A;  5DBK A;  2WPV A;  4G25 A;  4XI0 A;  4E6H A;  4PU3 C;  4JVS A;  1S7E A;  4LER A;  2WQ7 A;  2A5U A;  3NZU A;  2LNI A;  5AIJ A;  3NZS A;  3QDN A;  4JPS A;  1ZZB A;  3ZHM A;  2XPI A;  2EQX A;  3G2V A;  4V3I A;  3ZYQ A;  1XWR A;  3GZ1 A;  1WM5 A;  4PU7 A;  3GZ2 A;  4RG9 A;  1LQC A;  5BNW A;  1OSL A;  3LKU A;  5A7D B;  3SBT B;  3ZFW A;  4DI4 A;  1EFA A;  4KYO B;  3LS8 A;  2FO7 A;  2WXL A;  4ANW A;  3G2S A;  2O38 A;  3PE4 A;  4LCT A;  1ZUG A;  5C1D A;  1EDU A;  2B5A A;  2RG8 A;  4FC8 A;  3LIS A;  1AU7 A;  1JWG A;  3VTY A;  3BEE A;  3MKQ A;  3RRM B;  3RO3 A;  1HX8 A;  3OXG A;  4KT6 B;  3RO2 A;  2EF8 A;  1ZZ7 A;  2WIU B;  2HIN A;  2VGX B;  3OTN A;  4GZD A;  4HXI A;  2WXP A;  1CQT A;  4MRU A;  1GW6 A;  4PUC A;  4EBA A;  2LYK A;  3D9K A;  3CVX A;  3OP9 A;  4CEM A;  1E7V A;  3TXM A;  4TRQ A;  3ZYM A;  4UI9 K;  1BPO A;  4D10 C;  2GGF A;  3G7D A;  4X4E A;  4I8T A;  1Y6I A;  4HS2 A;  3ZXS A;  2NSZ A;  3QK0 A;  4XKB A;  4N2Q A;  4XX5 A;  2PUE A;  2V5F A;  4U0Z A;  5ARF A;  4XZ4 A;  3FH8 A;  2FBN A;  2HR2 A;  3B7T A;  1QQE A;  2LO6 A;  1NZN A;  3URZ A;  4UWG A;  4AV7 A;  4IA8 A;  2AXU A;  2FJR A;  2VSO E;  4UWH A;  4YND A;  4C0E A;  4C9B B;  2PUB A;  3FDH A;  3CHR A;  4PS3 A;  3G2T A;  4YG7 B;  2MOW A;  3ONL A;  3OQN A;  2IU1 A;  3EJN A;  3N71 A;  3QNK A;  4GU5 A;  2KEK A;  2PUG A;  1DVP A;  1UW4 B;  3CHP A;  4Q96 A;  4GPK A;  3RU0 A;  2XSD C;  5FJY A;  2LYJ A;  1MHQ A;  1E7U A;  1QP0 A;  2LAH A;  3GYZ A;  4G24 A;  4TV3 A;  3Q47 B;  4AVX A;  4I6J A;  3B7U X;  4I9C A;  2J9Q A;  2AVP A;  2YIN A;  2I2O A;  3HDX A;  4U8H A;  5CMW A;  1VPW A;  3APF A;  1UTX A;  3U64 A;  2KAT A;  4HOR A;  3RRU A;  2PQN A;  3MEK A;  5T4Y A;  3AU4 A;  3UFD A;  3PZD A;  4NUR A;  4FAD A;  2QFC A;  3LEW A;  3MX3 A;  3CV0 A;  3ML8 A;  2KM4 A;  1QPZ A;  2XPY A;  3QYX A;  3S7B A;  3WXX A;  1ZZC A;  2Y3A A;  3UQ3 A;  4E85 A;  3FUF A;  4O6F A;  4X4G A;  1JH9 A;  1YA0 A;  2WXM A;  3GW4 A;  2KC7 A;  5JJ7 A;  4U04 A;  4APO A;  2BUG A;  2OND A;  4I6T A;  2A6C A;  2LYS A;  3FYA A;  2KCL A;  3FY4 A;  4AJW A;  4WNG A;  5LCW C;  1PRA A;  2VYI A;  3I4G A;  1E90 A;  2WXR A;  3I3N A;  3IV0 A;  1YSE A;  1OUV A;  3P2B A;  4IVZ A;  3MA5 A;  2AXV A;  2DIW A;  4GMJ A;  4AY5 A;  5LCW J;  2WXQ A;  3RJV A;  4UI9 C;  3OXF A;  2JEK A;  3SD5 A;  1H0A A;  4GYW A;  1IQU A;  2WXN A;  3EUS A;  3PH0 C;  3ULQ A;  1WH6 A;  3F51 A;  2KEI A;  4MLP A;  3IEG A;  4M3O A;  5JJT A;  2CHW A;  1BDI A;  1ZVV A;  2CHX A;  1Z3Y A;  2I1J A;  2C0L A;  4JZY A;  5FZQ A;  3CVU A;  4BTB A;  1WY6 A;  3CR3 A;  1KT0 A;  4CDM A;  4Z5D A;  4CDN A;  4Q69 A;  1VDY A;  5JJ6 A;  3TGO A;  2CHZ A;  2XGS A;  4GZC A;  4AEZ C;  1ZZ8 A;  1IHG A;  4IUL A;  3OMT A;  5D0Q D;  2V8S E;  3D9O A;  3CST A;  3QC1 A;  3OAW A;  4U07 A;  2LAI A;  2VTB B;  1B0N A;  1NEQ A;  4KXK B;  1EPU A;  1FVF A;  2NXP A;  3MGB A;  4WUY A;  1XNF A;  4FA6 A;  3L08 A;  1LMB 3;  2ILR A;  3HYM B;  3D1N I;  4FLH A;  5FZR A;  3RKV A;  4L2Y A;  3PVL A;  1JFS A;  2VSN A;  4MCT A;  3PE3 A;  2C0M A;  3QAQ A;  4HLE A;  3FUE A;  2OFY A;  1NER A;  1Y7Y A;  2CFU A;  4JEH A;  3TJP A;  1KT1 A;  2J4B A;  2CG2 A;  3FUJ A;  3KS2 A;  3HHM A;  3CK8 A;  3FUI A;  5BT1 A;  2O4A A;  3ZYL A;  1QZ2 A;  3F52 A;  2L49 A;  3LCA A;  4MS6 A;  4DLO A;  4F7A A;  4PH4 B;  3JXB C;  1N52 A;  3RK6 A;  4HOQ A;  1SQM A;  1ZBP A;  1ELR A;  2X6I A;  4G2V A;  3IBE A;  5EX3 A;  2WXG A;  3PUK A;  5BV0 A;  2LCV A;  3O48 A;  4CGV A;  3S7J A;  1ZS4 A;  5HI7 A;  3FMY A;  3CVY A;  4I43 A;  1L5J A;  4UWF A;  2IU7 A;  4X4I A;  3JXD L;  4I1M A;  2GRM A;  5LOZ A;  3UT7 A;  3LPZ A;  3ZPJ A;  1GT0 C;  5BV1 A;  1UXC A;  2WMN A;  3LFP A;  5KCM A;  2J07 A;  3ZHI A;  1WH8 A;  1SZA A;  5G2N A;  4FJY A;  1ZU2 A;  3L54 A;  3ZYK A;  3AS8 A;  1O4X A;  2BF0 X;  2IQC A;  3FP3 A;  5C2Y A;  3AU5 A;  4DLQ A;  2LYL A;  2KZT A;  2XPZ A;  2Y4U A;  3CKB A;  2WUS R;  2AW6 A;  4JA7 A;  3ZRH A;  2KCK A;  4AP2 A;  2WVI A;  4RVB A;  3TL5 A;  3DBS A;  3FYM A;  3BDN A;  4XE0 A;  1PER L;  3ONK A;  3ZW3 A;  5ENN A;  4A3V A;  2GRL A;  1U3C A;  3L13 A;  4ACL A;  4APF A;  3GN5 A;  1TJF A;  3CQG B;  4CT0 A;  1POU A;  2KCV A;  4FU3 A;  2WM9 A;  2X6J A;  3KAE A;  1H2V C;  2J4D A;  3SGH A;  4BX9 A;  3QWP A;  4J8D A;  4EBA G;  4J0U A;  2VJ8 A;  4B8C B;  2E2E A;  3ZGQ A;  2YNQ A;  4J1X A;  5A7L A;  2DBA A;  2XHE A;  3CSF A;  4L1B A;  5M72 A;  4RSY A;  4L2L A;  4WWP A;  3FTY A;  1QP7 A;  5AJL A;  3UX4 A;  2PZI A;  2IVQ A;  4A3T A;  4CDR A;  2VSY A;  4OVU A;  1E96 B;  1ZAY A;  1PAQ A;  3FUD A;  2JLB A;  4KVM A;  1H6K A;  3CHS A;  2XCC A;  4F8D A;  4F3V A;  2RD0 A;  5A6C A;  2L8N A;  2PQR A;  3FTS A;  2JCG A;  5E75 A;  4FBI A;  4YVO A;  2PUA A;  3VLD A;  1WET A;  4EZL A;  4O8B A;  4X4C A;  4NAC A;  2LYQ A;  4FP7 A;  2XGM A;  3FTV A;  3ASD A;  3FFL A;  5FWQ A;  4IYP A;  3HIZ A;  4X4H A;  3APD A;  4JHR A;  3RZZ A;  2A4Z A;  2HM8 A;  4GA2 A;  2PUD A;  2ICT A;  3LXU X;  4GCN A;  4ILI A;  1BDH A;  2OVF A;  2VGY A;  4HOT A;  3T5X A;  4OB4 A;  3LVQ E;  1H19 A;  3PRE A;  4I1O B;  3DPD A;  3CVL A;  4Z5C A;  2IF4 A;  2J49 A;  3MKQ B;  2C2L A;  4G1T A;  4N2S A;  5FQ8 A;  2GZU A;  5AYW D;  3QWG A;  3K9I A;  3LYA A;  3MKR A;  3Q15 A;  3RIB A;  3SF4 A;  2KEJ A;  2ION A;  2EWT A;  1DNP A;  3SFZ A;  4CGW A;  2VTB A;  2GW1 A;  3QWW A;  4ABN A;  3HVE A;  5J90 A;  4EZJ A;  3UMV A;  3QKY A;  5ANL A;  5KJM A;  1R69 A;  3OQO A;  1HU3 A;  3MLF A;  2BNO A;  2KZ8 A;  2OVB A;  2PM7 A;  3FUH A;  4L7T A;  4EEC A;  5J08 A;  2IJG X;  4JCX A;  4ME2 A;  3PNT B;  3PNL B;  3SNX A;  4EPZ A;  2X6H A;  3FUN A;  4KMO A;  2BNN A;  4U0S A;  4XKC A;  1QNF A;  2PIJ A;  3AS5 A;  3R7Q A;  1HF0 A;  2XEV A;  1WAO 1;  4DJA A;  5HQ8 A;  3QWV A;  2DCP A;  4IRU A;  4CT4 A;  2KPJ A;  3ZHE B;  2IVG A;  5CHE E;  4H7Y A;  3ZIM A;  1X2L A;  4BT9 A;  3FUM A;  3CLJ A;  4BFR A;  1ZPQ A;  1ZZ9 A;  2L6J A;  1HE8 A;  2BTD A;  2X6F A;  5DIZ A;  4AXH A;  4NDW A;  2YHC A;  4UI9 J;  3EIQ C;  4WNF A;  2EBY A;  5FT9 A;  3CVV A;  4G11 A;  1Z3X A;  3L1P A;  1HZ4 A;  5AJD A;  3JXC L;  4WWN A;  1NP7 A;  2WXH A;  4Z58 A;  3CGH A;  1INZ A;  2ZU6 B;  3KJX A;  5FQ6 A;  2CRO A;  3FUL A;  1S0P A;  4UWK A;  5T8I A;  3LY8 A;  2FEZ A;  1E8W A;  1UXD A;  1QQA A;  3CVN A;  1RPE L;  3LY9 A;  3S8Q A;  2J08 A;  4JEU A;  4N3A A;  4U0U A;  5EX0 A;  1HXI A;  3FU3 A;  4CRW A;  3CHO A;  3FTX A;  4DPR A;  3BG1 B;  2OOE A;  3D3M A;  1Y8M A;  1B89 A;  4JL0 A;  4URK A;  2VGX A;  3FTW A;  1QP4 A;  1OWP A;  2YQ8 A;  4HVB A;  1U3D A;  3CRO L;  1HF8 A;  3CQC B;  2H8R A;  5FZS A;  1E8Y A;  3FH5 A;  2XRZ A;  4UQY A;  1HFA A;  4B0Z A;  1HS6 A;  4AM9 A;  4YBA A;  1PC2 A;  4GQM A;  4R7L A;  2PUF A;  2WMO A;  3D9I A;  3JUI A;  4G23 A;  4WND A;  5G55 A;  4ATG A;  4HOS A;  3KZ3 A;  3I4R B;  4J6I A;  4PS8 A;  3S7D A;  2V4L A;  2WXK A;  2HYZ A;  3MV3 B;  4JW1 A;  4AOF A;  3KD7 A;  5JHA A;  1CJG A;  2FF4 A;  3PUJ A;  3U4T A;  3L16 A;  4NRH B;  5JHB A;  3MCX A;  5EKQ D;  5A23 A;  4FN3 A;  3EHM A;  4Y42 A;  3ASG A;  4I17 A;  5AEN A;  1TJC A;  2KZT B;  2CSF A;  1P5Q A;  2WXI A;  2XRY A;  4LRZ A;  4ACK A;  4AIF A;  4EZK A;  3B7S A;  3UPV A;  3JQ1 A;  3SCH A;  4K03 A;  3QOU A;  2PE5 A;  4OVV A;  3BD1 A;  3CVQ A;  3QJZ A;  2ICP A;  2R17 C;  2I9C A;  1FVH A;  1HH8 A;  4OYS A;  2OV8 A;  4XIF A;  2IOS A;  2X3M A;  1IQR A;  2R63 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...