2AXVA

Structure of prgx y153c mutant
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
302
structure length
302
Chain Sequence
FKIGSVLKQIRQELNYHQIDLYSGIMSKSVYIKVEADSRPISVEELSKFSERLGVNFFEILNRAGMNTKSVNETGKEKLLISKIFTNPDLFDKNFQRIEPKRLTSLQYFSIYLGYISIAHHYNIEVPTFNKTITSDLKHLYDKRTTFFGIDCEIVSNLLNVLPYEEVSSIIKPMYPIVDSFGKDYDLTIQTVLKNALTISIMNRNLKEAQYYINQFEHLKTIKNISINGYYDLEINYLKQIYQFLTDKNIDSYLNAVNIINIFKIIGKEDIHRSLVEELTKISAKEKFTPPKEVTMYYENYV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PrgX
publication title Structure of peptide sex pheromone receptor PrgX and PrgX/pheromone complexes and regulation of conjugation in Enterococcus faecalis.
pubmed doi rcsb
source organism Enterococcus faecalis
molecule tags Transcription
total genus 118
structure length 302
sequence length 302
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01381 HTH_3 Helix-turn-helix
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 2axvA01
1.25.40.400 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2axvA02
3MLFA 1L1MA 1JWLA 3ZHMA 4PU3C 3FMYA 4X4GA 1ZZBA 1RIOA 1CJGA 3QYXA 2AXUA 1VPWA 2B5AA 4J1XA 1ZUGA 4Z59A 1WETA 4Z5CA 1UXDA 3H5TA 1ZZ7A 3KZ3A 2GZUA 2LYPA 2XI8A 2D5VA 2JVLA 2LYRA 2IU7A 2IVQA 3EUSA 1PRUA 1ZZ8A 3G7DA 4NDWA 4Z5HA 2LYQA 4X4DA 2XSDC 1ZZCA 2KZ8A 4I6TA 3ZKCA 1PNRA 4O8BA 3RZZA 1EFAA 1OCTC 2KPJA 2R1JL 3F52A 3CLCA 1YSEA 3JXBC 3HZIB 1PERL 2MEZA 2BNNA 5K98B 4J1WA 2BJCA 1QP0A 1DWKA 3LISA 4I8TA 1QQAA 2EBYA 3S8QA 4JQDA 2ICPA 1X57A 1QQBA 2IUOA 2CROA 2FJRA 2AW6A 4X4HA 1LLIA 2R63A 2MQKA 2PUEA 2AWIA 4IA8A 1BDIA 1LCDA 4GQMA 2BNOA 1XWRA 2IVBA 1S7EA 2LCVA 5A7LA 2EWTA 3UFDA 3DNVB 1BDHA 3JXDL 1B0NA 4X4EA 3OQMA 3F51A 3BD1A 1LQCA 2XIUA 1UXCA 2O4AA 1QP4A 3CECA 4JCYA 1RPEL 1ZVVA 2GRMA 4X4FA 4X4BA 3SCGA 4YG4A 4YG7B 4YARA 4X4CA 2GRLA 2EF8A 1R69A 3GBFA 2KEJA 1UTXA 1ZZ9A 1X2LA 2OFYA 3L1PA 3QWGA 4FN3A 3D1NI 2WIUB 2O49A 4X4IA 1RZSA 2LYLA 2XJ3A 2LYSA 3PXPA 3U3WA 4F8DA 3SCHA 4OB4A 2O38A 1ZZ6A 1LMB3 1QP7A 2HSGA 2BNMA 2WUSR 2L49A 2PUFA 2LYKA 3FYAA 1AU7A 2PUBA 4GHJA 1E3OC 1IC8A 4MCXA 1NERA 1POUA 1Y7YA 4FBIA 3QQ6A 1Y9QA 3R1FA 1WH6A 3VK0A 2KEIA 3OQOA 1JH9A 2PUDA 4PU7A 2PPXA 1PRVA 3IVPA 3OP9A 2PUGA 2IV1A 2PUCA 4YBAA 1DW9A 1JFSA 1HF0A 3GN5B 3LFPA 2H8RA 1WIZA 2AXZA 4Y42A 2AXVA 1WH8A 2PE5A 4I6RA 4IWRA 1NEQA 3BDNA 4Z58A 1SQ8A 3F6WA 4PU4C 1ADRA 1LCCA 3SCFA 1ZAYA 1RZRD 3KXAA 3OQNA 4MCTA 4Z5DA 1RZRA 1CQTA 2OR1L 2HINA 4I6UA 3BS3A 2PUAA 2PIJA 1ZS4A 2AUWA 2A6CA 2L8NA 1QPZA 3FYMA 1GT0C 3QF3A 2JCGA 2LYJA 2IVGA 3G5GA 3KJXA 2XCJA 3CROL 1R63A 4PU8A 1OSLA 3OMTA 3GN5A 3JXCL 4YG1A 4JCXA 3ZHIA 1O4XA 3B7HA 4IVZA 3TRBA 2KEKA 1JFTA 1ZPQA 2CSFA 1PRAA 3O9XA 2ICTA
chains in the Genus database with same CATH superfamily
2DWZA 2I9CA 4GTMA 3LVQE 3TWRA 3URZA 1ZUGA 3GZSA 4KBQA 5FQ8A 2LYPA 2D5VA 2XPZA 2IU7A 1H6PA 3PE4A 3ZKCA 5ENPD 2F0YA 2KZ8A 3SF4A 2PXBA 4O8BA 4DI4A 1Z6TA 1ELKA 4F6RD 3KEAA 3UM2A 4DE8A 2MEZA 2HYZA 2P9NG 2WM9A 4FA6A 1DCQA 4J8SA 3ZGQA 2R63A 4HOSA 1MX6A 2V8SE 3T5VA 4Y6WA 4KZCA 3ZW3A 3JYSA 3UFDA 3WXXA 3A9XA 2C0MA 3DEOA 2M63A 4I6JA 5DT2A 1S64A 5D0QD 4YDWA 2O4AA 1O1SA 4HLLA 4PUCA 3HIZA 4X4BA 4U63A 4G24A 4GMJA 2PXPA 4EQZA 5DIZA 4TV3A 4I9EA 2WQ6A 3ZUVB 2LNMA 3ASFA 2J9QA 3FHEA 3PUKA 3PH0C 2ODRD 3BUAA 3GZDA 1AU7A 2DYRE 4U7EB 4BT8A 1NERA 2KEIA 2J8SD 5ENQD 3VLFA 3AG4E 2WQ7A 1HF0A 3ZHEA 1HH8A 2X6HA 4CGWA 3TWWA 3L08A 4HNAD 4IULA 5CEDB 4DX1A 1OWLA 3B95A 2FULA 4GB9A 1N4RA 2CHXA 4ANXA 4UUCA 4A55A 3B7HA 5A23A 1JFTA 3LPZA 3ME5A 3PEUB 3FULA 1QNFA 1YA0A 5JJ6A 3AS5A 3PZ3A 3F6QA 1TNOA 2ZGDA 3UTMA 4HLEA 2X6FA 4BEPA 3AG3E 2LYRA 2IU1A 2KBXA 1PRUA 2R5SA 1BLXB 3C98A 1PNRA 4ANWA 3MJWA 4U0SA 1XNFA 3CLCA 1PERL 4WNFA 4U8HA 3SFZA 1QQBA 3ZKJA 2I6HA 2PXLA 5A7LA 2H6GA 4M7CA 4HS2A 3JXDL 3BD1A 1TR4A 5CBNA 4NQ0A 3ZU7B 2B6CA 3ZN3A 2GRLA 3GZCA 2L6JA 2WXKA 4I6EA 2VGXA 3L1PA 1JCSA 4X4IA 3UINC 3EUVA 4KVMA 2WXLA 1H2VC 3FUNA 1Y8MA 3MCXA 3HVEA 3FYAA 1HS6A 5FTPA 3ML9A 1POUA 3KSQA 4KT6B 3Q7FA 2BKGA 1OUVA 3TWXA 3HVEB 3CKCA 4RG9A 4EHMA 1DW9A 3M9LA 2VJ8A 3T8KA 2AXVA 2F8YA 1ADRA 3L22A 1KPSB 3KXAA 1NA3A 5CCLA 2HO1A 2LUHA 1MX2A 3PZDA 5HRYA 3MYVA 2LAHA 3ZHIA 4WVLA 1BU9A 4I9CA 2R03A 3FUDA 3QKYA 1ZPQA 4OAVB 3MA5A 3E32A 2R2LA 1H2UA 1U2VG 1LD8A 4F1PA 1OCRE 5AAOA 3ZYLA 5CHEE 2XEHA 4GA2A 2IO3C 4K0RA 3Q5MA 4GAAA 3SQVA 4JEHA 2GZUA 2JVLA 3FEXA 3ABLE 3G7DA 3Q4AB 1SVXA 2LLWA 3Q15A 4LG6A 1EFAA 4UWHA 2KPJA 1NW3A 3IBEA 1QP0A 1QQAA 3ASOE 3HXCA 4JQDA 4Q96A 3C72A 1TJCA 5AQ7A 5FZRA 2AWIA 3ZXSA 2P9LG 4APFA 1W3BA 4GYYA 4U04A 3CGHA 1ZVVA 1D8EA 5CMWA 1NFIE 1Z3YA 4X4FA 2C0LA 3D9KA 4EK9A 2EF8A 4BSXA 1O5MA 3CHOA 2O49A 2CHWA 3FH7A 1N11A 4H7YA 2NC9A 2HSGA 3QWVA 2WXNA 2OOEA 3S7DA 2XCCA 3L82A 2XPYA 4TRQA 4DPRA 5LCWJ 2CG3A 3CHQA 3DM5A 2XZDG 2XENA 4Z5DA 2VYIA 5EX0A 3I4GA 1U3CA 4JA9A 3FYMA 4PU8A 1OSLA 4UI9J 3PS6A 2V5QC 3G2TA 1E7UA 2ICTA 5CEAA 2UY1A 4WNDA 1B89A 3UXGA 2XXPA 2NXPA 4BERA 5D0OD 3E4BA 5AJDA 3T8MA 4ER6A 4BETA 3H5TA 2WXMA 2PM6A 2ETAA 4ER3A 3FTSA 4NDWA 3ZPXA 4BSZB 3MZLB 3TFLA 1YSEA 3IKOB 3MV3B 3Q49B 4JB8P 5CRUA 2EBYA 1ZBPA 3FP3A 4GCOA 1IQRA 1DC2A 2CROA 3NZUA 2FEZA 2MQKA 4GTSA 3LS8A 2DVWA 4XIFA 2IVBA 3TAXA 1KT1A 3QB2A 1E7VA 2XGOA 1UG3A 3NOCD 3CVYA 2BTDA 4R7LA 2PQNA 2ZIRA 4OVVA 1N9AA 1TN7A 3FH5A 4J8EA 4FN3A 2J08A 3T5XA 3U66A 2FO1E 3PUJA 3UIOC 5B1AE 4F7AA 3U4TA 3SCHA 4J8YA 3IV0A 4CGVA 4NURA 1KLXA 2DIWA 4XKBA 2WXIA 2ONDA 3SR4A 5EDSA 2XRYA 3QNKA 4YBAA 1A17A 3CVWA 2KCLA 4I6RA 3CKBA 4Z58A 3I5PA 1FT2A 1K1BA 3C3RA 2XPIA 5KNHD 2HINA 3RJVA 4K5AB 1ZS4A 1NA0A 2L8NA 4E6HA 3RRMB 5LX8A 2IVGA 3ABME 3CIAA 4BT9A 1OXJA 3ZYQA 1IYGA 2E0IA 2ZISA 4GTVA 4UWLA 4A1SA 5LCWC 4FADA 2WMOA 5ENOD 1OWNA 2V4LA 2L6BA 2EIJE 5ENNA 2RFAA 4Z59A 3CVUA 1E8YA 4YVOA 2ZXWE 3FUIA 3ZIMA 4AV7A 5ANLA 4ANUA 2RG8A 3R9AB 1ZZCA 5BT1A 4LERA 4UI9C 4N2QA 4BWRA 2XQ0A 4J1WA 4AOFA 4X4HA 3LXUX 2KCVA 3ZPJA 3U64A 3LVRE 4NACA 3ASDA 2VSNA 1BDHA 3ZVVA 3OQMA 4HI9A 4MLPA 5AQBA 1Q2ZA 1QBQA 4TXQA 4GZ5A 1RPEL 4ACKA 3SCGA 4YG4A 3UIPC 3UI2A 4X8QA 3DSSA 3NXHA 2A5EA 3SO8A 4GU5A 3ONLA 5FINA 4GHJA 4MCXA 2Y4UA 1WAO1 1WH6A 3R9MA 4PU7A 4ABNA 4AM9A 3OP9A 3ULEG 2V0PA 1TNBA 1NEQA 2P9IG 2LLVA 3Q73A 1RZRA 3OXFA 4RQIA 2WMNA 1IKND 3TWVA 3OMTA 3FEYA 3FUEA 4JZYA 3VTXA 3JCKC 1XGWA 1RIOA 3PE5A 2IONA 2B5AA 3APFA 2H6HA 4F53A 1ZZ7A 4G8LA 1YMPA 3SNXA 4K5CA 2J4DA 3QOUA 3EUSA 1OCOE 4XI0A 1SQMA 2J07A 2H6FA 3DEPA 5FQ7A 4DJAA 3Q9NC 5AJLA 2OVFA 3B7TA 3UKUG 4D10C 4O1PA 1FPPA 4I2ZA 4IA8A 1ZU2A 5FIOA 1S7EA 1FT1A 2OEVA 2WQHA 4N3AA 3HYMB 1TN6A 4GYOA 3OAWA 3RRNB 2GROB 1X5BA 3PRZA 4HOUA 3S7BA 5BV0A 4X4CA 1R69A 3ESLA 2MHKA 4DX6D 2WXJA 2BUGA 3ONKA 2XJ3A 3ZEFA 3ENEA 4WUYA 1ZZ6A 3EJNA 5JJTA 2Y4TA 3Q47B 2PUBA 4GZDA 4JEUA 1ZB1A 3FH8A 3TEPA 2DZNA 1Z5SC 2ZGGA 3KSLA 4G26A 3RU0A 2AXZA 1RW2A 4UQXA 3JXJA 4QFVA 5G05J 2WB2A 4ER7A 4I2WA 5DRTA 4I1OB 3QOXA 4G25A 1O4XA 4GYWA 1A5EA 5AYWD 3MLFA 1JWLA 3ZHMA 2GW1A 3SY2A 3QYXA 1EDUA 5EX3A 4XEIG 3MEKA 4Z5CA 5A7DB 4N39A 4BX8A 4OVUA 1N4SA 3OKZA 1HG5A 1WY6A 4I43A 1OCTC 2Y1LE 4PS7A 3HZIB 1TN8A 2GRQB 4KXKB 2ICPA 3HXEA 4A3TA 1IHGA 4HORA 2PUEA 2VGEA 3I3NA 2I2OA 3MX3A 2BNOA 2RFMA 2ETBA 5T3RA 3PNLB 5KNGA 3QDNA 1N4PA 3V2XA 3J5QB 5AARA 4YARA 5HI7A 3FTVA 4LNUD 2OFYA 5JJ7A 3KD7A 5FZQA 3D9MA 1MHQA 3FTWA 2WXOA 4HBDA 3GZDC 3IHVA 5JHBA 2E2EA 3JUEA 5FQ4A 3TWQA 2VSOE 5DRYA 3KS2A 4GTRA 1HFAA 5AQAA 3NROA 4DLOA 5EN5D 2OCCE 2R17C 1N0RA 4GMLA 4TXPA 2HCSA 1ZAYA 3OQNA 2UWJG 3C5RA 4ZFHA 1OCZE 4MKTA 4IYPA 3EHMA 2P9UG 1GT0C 2XCBA 2VGYA 1JPLA 3SI5A 1HQ1A 2Y3AA 5T4YA 1L1MA 5C2YA 1K8KG 2KC7A 4YDYA 3NOGD 4V3IA 3LY7A 5G05C 3FWVA 4B89A 5DTRA 4GTOA 4DUIA 2XSDC 4X4DA 1QYMA 5IY5E 3PVLA 4PS8A 2X6KA 3C3QA 5AN8A 2BNNA 4FHJA 2VQ2A 4DK5A 3AG2E 2PNNA 3ASHA 3UM1A 1QZ2A 4C48B 1XWRA 4JW1A 2PXDA 2RKKA 2M4HA 2V5FA 2GRRB 1K1AA 3V30A 3APDA 2VTBB 5ENTD 2H6IA 4WWPA 1SA5A 2MYOA 4L1BA 4DE9A 4L9PA 3TELA 4CDNA 3D9IA 4L7TA 1DCEA 2WXFA 2PXTA 3GYZA 2LYKA 4GTTA 4RVBA 5LFAA 1Y9QA 3SFYA 2PUDA 4ER5A 4JPSA 3QARA 4HI8A 4LEUA 3W9FA 5C1DA 4J8DA 1OWOA 1WDYA 3J5PA 4URKA 3F6WA 3AU4A 3EDTB 3ESKA 3UWPA 4DI3A 2LO6A 1HO8A 1OCCE 4F1SA 3BS3A 1JCQA 4XE0A 2DBAA 3VLDA 2LYJA 2XCJA 3LY9A 1R63A 4LSZE 2ETCA 3JXIA 3JQ1A 3NB2A 4WNGA 2YQ8A 4ILHB 4RG6A 5CRVA 4EBAG 2F8XK 4QQIA 4YVQC 1TJFA 3B7BA 3U9WA 3E37A 2XRZA 2XI8A 2FBNA 4AY5A 3R7QA 3MEJA 4CDRA 2V4HC 3A9ZA 3TJPA 2PL2A 4M3OA 4C9BB 1NP7A 3NZLA 1N52A 3B13A 1UJKA 3AS8A 2XS1A 4JXTA 3Q79A 4C0MA 3CLJA 3RKVA 2PQRA 4ILIA 4BFRA 3G2UA 3QC1A 1MX4A 3B7UX 3FUHA 1UJJA 1H2TC 1LQCA 4NRHB 2IY0C 3CECA 2LXLA 5BPPA 3FU5A 1E90A 2KATA 2IQCA 3K9IA 4WWNA 3MV2B 3L6AA 1HE8A 5EIDA 2P9SG 4HOTA 2LYLA 3PXPA 5GAHi 5EYLA 2HCNA 4I1AA 1OWPA 3PZ4A 2RD0A 1YCSB 3DXKG 3G2WA 2QYUA 3QQ6A 4K03A 4MRUA 4ER0A 2ILRA 1H19A 3DSTA 4J0UA 4YNDA 4G8KA 1JFSA 2H8RA 3ABKE 2VEOA 4U8YD 2IO2C 5E76A 2XXAA 4AIFA 3UUXA 4Z68A 4LUNU 4Q69A 4I6UA 4FHKA 2PIJA 5ENRD 2JCGA 3LCAA 1LTXA 4CCAA 4UQZA 1H6KA 2QC9A 4JHKA 3TRBA 1KT0A 1SZ9A 3L13A 5T8IA 5KCMA 3PDNA 2JABA 3MKQA 3LKUA 2HR2A 1WETA 1UXDA 4L2YA 3G2SA 4OYSA 1OT8A 3MKQB 1QP7A 4Z5HA 2OV8A 4BY6A 1EPUA 4FULA 4DLQA 1FVFA 2PXQA 3CK8A 2L1PA 3LYAA 4J6IA 3N71A 3F52A 3AG1E 4A1GA 5K98B 5ANRA 3LISA 4I8TA 3QAQA 1INZA 2FFHA 3DXMG 2AW6A 1S0PA 3ML8A 4DX5D 4U07A 4OBMA 1GW6A 3ZFWA 3AAAC 2KXPC 3FU0A 1MJ0A 1DULA 1LD7A 3F51A 1HXIA 1BPOA 3HXDA 2XXQA 4U95D 2KEJA 3QWGA 3O48A 2WIUB 2PXFA 1DVPA 3QWWA 4OB4A 1LMB3 2Y0BG 4GZ6A 3FDHA 4G23A 1SW6A 3LDZA 3LY8A 3UPVA 2YHCA 2ZU6B 3EU5A 2Q7FA 3CHMA 3VK0A 2L9BA 4N5CA 3ASNE 1RZ4A 5CCMA 5G04J 5E75A 5DTQA 4ME2A 4MCTA 3G2VA 5ARFA 5GAGi 5BXOA 3PZ1A 1E8WA 2I1KA 4ATGA 3IHYA 4I1MA 2P9PG 2VSYA 4FU3A 4HOQA 3A9YA 4JCXA 2AJAA 1DNPA 3TL5A 1BD8A 4AXHA 1N4QA 5KWDA 3UX4A 4B0ZA 1MZCA 3OXLA 5HS0A 3PE3A 3RRUA 4J1XA 3DPDA 4HQDA 2OEWA 4MS6A 3KEZA 3FTZA 2LYQA 4LCTA 4N5QA 4JHJA 1EYHA 3HRAA 4GCNA 2BJCA 1TYQG 1DWKA 1UW4B 1X57A 2J4BA 4WNEA 2FJRA 2OVBA 2QY7A 3DSWA 4ANVA 3JQ0A 1BDIA 3CK7A 5KJKA 1N95A 2BEDA 2WXQA 4HFGA 2YINA 2IOLA 5ARGA 2FI7A 4HB5A 3UT4A 4FJZA 4Q2JA 3BG0B 4JCYA 2FO7A 2J7UA 1UOHA 3SX0A 3RK6A 4TXRA 1X2LA 3C3OA 2V3CC 3CHRA 1HX8A 1RZSA 3U3WA 2QFCA 3NDBB 4WWOA 2GRNB 4DX2A 4MBGA 3SHFA 1OWMA 2BNMA 4O60A 5D66A 2A4ZA 2PPXA 2WXPA 1PRVA 2JQEA 3APCA 2WXRA 3GN5B 4UWGA 3ZYMA 1G3NB 4JL0A 4BTAA 4I17A 1LCCA 4UWKA 4O6FA 3JUIA 1H6OA 1N54A 3TXMA 3KJXA 4KYOB 4AP2A 1TNYA 3CVNA 1HF8A 1O1RA 1H0AA 3FUKA 4IN3B 2L0TB 5JUWA 3T9KA 1PRAA 1QQEA 4EQFA 4N3CA 3DWLG 5G04C 3TWUA 1ELWA 3FU6A 5CMYA 2EILE 4APOA 1P5QA 4JHRA 2YBDA 2L0IA 1K3ZD 2X38A 1ZZ8A 4I6TA 4FC8A 5J08A 4PDXA 3EHRA 3CEQA 4HVBA 2DCPA 3LJNA 2IUOA 2WVIA 3FTYA 1LLIA 1LCDA 4GZ3A 2XEVA 2EWTA 1TNUA 2EIKE 3DNVB 5H7PA 2XIUA 4CEMA 4U0UA 4GPKA 3L9TA 2GRMA 1JCRA 4EZJA 1UTXA 2IFUA 4XX5A 3ZNGA 4A3VA 3IEGA 1JWGA 5JMND 4CT0A 3DPYA 3W9GA 4EECA 3ZHEB 3PZ2A 3D3MA 3HDXA 4G1TA 1JH9A 2NSZA 3LJ3A 3AU5A 2IV1A 2PUCA 2I1JA 1SZAA 2BF0X 3VLEA 1MQSA 1WIZA 2PE5A 1JUQA 1KZPA 2YHEA 2OR1L 3CVXA 3O4ZA 2KM4A 4XI9A 1BI7B 2IEJA 5CERB 4HRAA 3CROL 2CFZA 2PM7A 2P58C 2IF4A 4B8AA 4EPZA 2EIME 5BUZA 1KZOA 3G0TA 1V54E 2EINE 2Y69E 4H7XA 3RSEG 3D9JA 2CG2A 2VSXE 4Y6CA 3KZ3A 3AS4A 3SZ7A 3WG7E 4UWFA 3CQCB 2LSVA 3TG4A 4KZ0A 2PXVA 3LQXA 5B1BE 3KAEA 4GA1A 3CV0A 3ZXPA 3TGOA 3NAWA 3JXBC 4TUUA 1E96B 3VTYA 4LNBA 1NI1A 2GRPB 3P1UA 4ACLA 4AEZC 5EYPF 3L16A 5EILA 3CVQA 1UN8A 2PXEA 2XHEA 3KL4A 2VGXB 3CVLA 5J90A 2XEEA 1B0NA 4EZIA 5JHAA 2B0OE 3Q78A 5KBAA 4L2LA 3B7RL 5DSXA 3E30A 1IXVA 2VTBA 1HG2A 2LYSA 4GTPA 5CECB 2O38A 4ATZD 4W9RA 3BQOA 3DRAA 3IXEA 1TEZA 3DSVA 2JLBA 1Y6IA 2GGFA 1L5JA 5G55A 4U8VD 3ULYA 4JC8A 2MRIA 1E8XA 3V79K 4U96D 5BNWA 3GZ1A 4ZHBA 1ELRA 5JA4D 1N94A 3CSFA 4B8CB 2XZTG 4P29A 5HKPA 3BDNA 4FJYA 3L54A 1D9SA 4NIKA 5AIJA 1IHBA 4EKIA 2F37A 4RLYA 2AUWA 2XGMA 3FUMA 5A6CA 5M72A 3EIJA 4IRUA 3GW4A 3RO3A 5FZSA 3X2QE 1WG0A 4FP7A 2AVPA 3FMYA 3HXFA 4C0EA 4X4GA 2XGSA 2AXUA 1VPWA 1NL4A 3LEWA 4CZ2D 3ASGA 1YYHA 4Q94A 2A5UA 3AJIA 2LAIA 4K5BA 3UM0A 4F3VA 4CDMA 2BKKB 1WM5A 4XKCA 1S70B 5KJLA 2KZTA 3PEVB 4GA0A 3BG1B 2WXHA 1FVHA 4HRMB 3HHMA 2LCVA 2JEKA 4DRXE 3VWSA 2R02A 3S2AA 2KZTB 2PZIA 3SD5A 1BI8B 3NQPA 1PY1A 4EZKA 4N3BA 1TNZA 4KMOA 4I6GA 3ZRHA 4AY6A 4A63B 2MOWA 1ZZ9A 3D1NI 5CBOA 3QFIA 3FFLA 3E34A 3HXBA 4LNGA 2L49A 2R05A 5AQ9A 1IC8A 1Y7YA 4XZ4A 4EBAA 1Z3XA 3IVPA 4YDEA 3R09A 1X81A 3LFPA 1WH8A 2C2LA 1SQ8A 3SCFA 3TG5A 1RZRD 3Q7AA 2UY1B 4WAFA 4BESA 2LXMA 3MKRA 2PUAA 2CFUA 2A6CA 1QPZA 5ENSD 4N2SA 1QZXA 3TXNA 4AJWA 2FF4A 3FUJA 4UI9K 2LSUA 3P2BA 2CSFA 1OY3D 1NZNA 2QYJA 3CVVA 4PU3C 2DYSE 2XS8A 2X3MA 3SBTB 2J7WA 5LP0A 2J49A 4HRNA 5EIBE 5D2MC 3UKRG 3S8QA 3S7JA 2QZAA 4KVOA 3RZZA 1HZ4A 4J8FA 2R1JL 5AENA 3GZ2A 2IOSA 3UT8A 3ZYKA 3CHSA 3PNTB 4U0ZA 4RSYA 3FTXA 4JVSA 3CK9A 1IQUA 3RIBA 4GQMA 3D9LA 3Q9UC 4J7WA 3V2OA 4TUMA 1AP7A 1S63A 5FWQA 4EZLA 5B3SE 4YDOA 2HM8A 1UXCA 1QP4A 1PAQA 3BEEA 3HG0D 3OTNA 4BX9A 2LNIA 3QK0A 4YG7B 3CVPA 1UN9A 3I4RB 1E8ZA 1PC2A 3D9OA 3GUUA 2WPVA 3QOWA 3FUFA 4CRWA 2P9KG 3R7RA 5HQ8A 3EIQC 4F8DA 4HRLA 4GZCA 2X6JA 5DTMA 2EQXA 2WUSR 3DSUA 4E85A 4GMRA 1E3OC 4DX7D 3RAUA 3BU8A 3NF1A 4FLBA 3TWTA 3OQOA 3UMVA 2J09A 3D9PA 1VDYA 1MYOA 3ULQA 4Y42A 3D9HA 3SFXA 1N0QA 4PU4C 3CSTA 2WXGA 1CQTA 4JD2G 3ISMC 3UT7A 3DSXA 1V55E 2MXDA 3QF3A 3S7FA 3G5GA 4B94A 5ITZF 4PH4B 4O1OA 4YG1A 4IVZA 2KEKA 1U3DA 3O9XA 3FU3A 5FT9A 1ZZBA 1CJGA 2PXUA 3EHNA 3NZSA 1U2ZA 4CT4A 5FJYA 2IVQA 3EU9A 2X6IA 2YNQA 3L17A 4PS3A 1JWFA 4HXIA 1AWCB 4GTQA 3B7SA 2NYJA 5G2NA 3NBNB 3QJZA 2KCKA 4GPMA 4G11A 2DZOA 3EHQA 1SA4A 3CR3A 3E33A 4X4EA 3DBSA 4LRZA 5LOZA 4BTBA 5FQ6A 4CYMD 4EKGA 3PREA 5BXUA 3SGHA 3GBFA 2HFZA 3OXGA 1EF1C 3QWPA 1QB2A 1O1TA 2HE0A 4UQYA 4JA7A 2PUFA 3D9NA 5BW8C 5EKQD 3CHPA 4FBIA 4G2VA 3OWQA 3R1FA 1HU3A 3FTUA 1MFQC 1FCHA 4AVXA 5BV1A 2IJGX 3V31A 2R59A 5KJMA 2PUGA 3TWSA 1LF8A 4IWRA 3RO2A 4B93B 3Q75A 2CHZA 4L23A 3MGBA 3SBSA 1D8DA 2PXKA 4FLHA 3UM3A 4OAUC 5KJNA 3FY4A 3UQ3A 3GN5A 3JXCL 3CQGB 5DBKA 4ILGA 2P2CP
chains in the Genus database with same CATH topology
4A1SA 5BUZA 5LCWC 4FADA 2WMOA 4EBAG 1OWNA 2I9CA 4H7XA 2V4LA 3LVQE 3D9JA 4YVQC 5ENNA 1TJFA 3U9WA 3URZA 1ZUGA 4Z59A 2CG2A 3CVUA 2VSXE 3GZSA 4KBQA 1E8YA 4Y6CA 4YVOA 2XRZA 3KZ3A 5FQ8A 5LX8A 3FUIA 3AS4A 2LYPA 3SZ7A 2XI8A 2D5VA 2FBNA 4UWFA 3ZIMA 5ANLA 2XPZA 3CQCB 2LSVA 4AV7A 4ANUA 4AY5A 3TG4A 4KZ0A 2IU7A 2RG8A 3PE4A 3ZKCA 3R9AB 1ZZCA 2KZ8A 3R7QA 5BT1A 3KAEA 4LERA 4GA1A 3CV0A 4UI9C 3SF4A 4CDRA 4O8BA 4DI4A 3TGOA 1Z6TA 4N2QA 4BWRA 1ELKA 2PL2A 2XQ0A 4M3OA 3TJPA 4C9BB 1NP7A 3JXBC 4TUUA 2MEZA 1E96B 1N52A 2HYZA 4J1WA 2WM9A 3VTYA 3B13A 1UJKA 3AS8A 4FA6A 3P1UA 4ACLA 4AEZC 4AOFA 4J8SA 4JXTA 3ZGQA 4X4HA 3L16A 4C0MA 3CVQA 2R63A 1UN8A 2XHEA 3CLJA 3RKVA 3LXUX 4HOSA 2PQRA 2V8SE 3T5VA 4ILIA 2KCVA 4Y6WA 3ZPJA 4KZCA 3ZW3A 3JYSA 3U64A 2VGXB 4BFRA 3LVRE 4NACA 3ASDA 3UFDA 3CVLA 2VSNA 3G2UA 3B7UX 3QC1A 1BDHA 3WXXA 5J90A 3ZVVA 2C0MA 2M63A 1B0NA 3FUHA 4I6JA 3OQMA 5D0QD 1UJJA 1H2TC 1LQCA 4MLPA 4NRHB 5JHAA 2O4AA 4GZ5A 3CECA 1RPEL 4ACKA 4PUCA 3HIZA 4X4BA 3SCGA 4YG4A 4G24A 4GMJA 3FU5A 4U63A 5BPPA 1E90A 2KATA 2IQCA 5DIZA 3K9IA 4I9EA 4L2LA 3B7RL 4TV3A 4WWNA 2WQ6A 3MV2B 3L6AA 1HE8A 4GU5A 4HOTA 2VTBA 2LYLA 3PXPA 1HG2A 2LYSA 3ASFA 3ONLA 2J9QA 4I1AA 2O38A 4W9RA 1OWPA 3FHEA 3PUKA 3PH0C 1AU7A 4GHJA 2RD0A 4BT8A 1TEZA 4MCXA 2JLBA 2Y4UA 3G2WA 1NERA 1Y6IA 1L5JA 2GGFA 3QQ6A 2KEIA 1WAO1 1WH6A 5G55A 4K03A 3VLFA 4MRUA 4PU7A 4JC8A 2ILRA 1H19A 2MRIA 1E8XA 4J0UA 4ABNA 4AM9A 3OP9A 5BNWA 3GZ1A 1ELRA 4YNDA 3CSFA 1JFSA 1HF0A 2H8RA 4B8CB 2WQ7A 3ZHEA 1HH8A 2V0PA 2X6HA 4P29A 4CGWA 1NEQA 3BDNA 3L08A 5E76A 4AIFA 4FJYA 3L54A 4IULA 3UUXA 1RZRA 3OXFA 4LUNU 1OWLA 5AIJA 4Q69A 4I6UA 2FULA 4FHKA 2PIJA 4GB9A 2AUWA 2XGMA 3FUMA 2JCGA 5A6CA 2CHXA 2WMNA 5M72A 3LCAA 4ANXA 3OMTA 3EIJA 4IRUA 4A55A 3FEYA 3FUEA 3GW4A 3RO3A 4JZYA 4UQZA 3B7HA 1H6KA 4CCAA 4JHKA 3TRBA 5A23A 1JFTA 1KT0A 1SZ9A 3L13A 3LPZA 3PEUB 5FZSA 3VTXA 4FP7A 3FULA 2AVPA 1QNFA 1YA0A 5T8IA 5KCMA 3JCKC 1XGWA 3AS5A 3FMYA 5JJ6A 3PDNA 4C0EA 4X4GA 2XGSA 1RIOA 2AXUA 3MKQA 3LKUA 1VPWA 2IONA 2B5AA 3APFA 3LEWA 3ASGA 4HLEA 2X6FA 2HR2A 1WETA 4F53A 1UXDA 1ZZ7A 4Q94A 4L2YA 2A5UA 2LAIA 3G2SA 2LYRA 4OYSA 4F3VA 3SNXA 3MKQB 2IU1A 2J4DA 3QOUA 4CDMA 3EUSA 1PRUA 4Z5HA 1QP7A 2OV8A 2R5SA 3C98A 4BY6A 1PNRA 1EPUA 3MJWA 1SQMA 2J07A 1FVFA 4FULA 1WM5A 4U0SA 4XI0A 4DLQA 1XNFA 3CK8A 4J6IA 3LYAA 3N71A 5FQ7A 4DJAA 3CLCA 3F52A 4XKCA 5AJLA 1PERL 4A1GA 4WNFA 5K98B 2OVFA 5ANRA 3LISA 4I8TA 3B7TA 3QAQA 5KJLA 4U8HA 2KZTA 4D10C 1INZA 3SFZA 1QQBA 3PEVB 2AW6A 4GA0A 1S0PA 4I2ZA 3BG1B 3ML8A 2WXHA 4U07A 1FVHA 1GW6A 4IA8A 1ZU2A 2I6HA 3ZFWA 3HHMA 2LCVA 1S7EA 5A7LA 2JEKA 3S2AA 2KZTB 2PZIA 3FU0A 3SD5A 3NQPA 1PY1A 2WQHA 3HYMB 4N3AA 4HS2A 3JXDL 4EZKA 4GYOA 3F51A 1HXIA 3BD1A 1BPOA 4N3BA 3OAWA 4NQ0A 3RRNB 1X5BA 3PRZA 4HOUA 4I6GA 4KMOA 3S7BA 5BV0A 3ZRHA 3ZN3A 4AY6A 4X4CA 2GRLA 2MOWA 1R69A 2KEJA 2L6JA 2WXKA 4I6EA 1ZZ9A 3ESLA 2VGXA 2MHKA 3L1PA 3QWGA 3D1NI 3O48A 2WIUB 2WXJA 4X4IA 1DVPA 2BUGA 3QWWA 3ONKA 2XJ3A 3FFLA 3ENEA 4KVMA 3ZEFA 4WUYA 2WXLA 1H2VC 4OB4A 1ZZ6A 3EJNA 1LMB3 3FDHA 3FUNA 4GZ6A 1Y8MA 3MCXA 4G23A 3HVEA 2L49A 5JJTA 3LDZA 3FYAA 2Y4TA 3LY8A 2PUBA 3Q47B 3UPVA 1IC8A 1HS6A 2YHCA 4GZDA 2ZU6B 3ML9A 4JEUA 1POUA 1Y7YA 2Q7FA 5FTPA 3FH8A 3CHMA 3VK0A 4XZ4A 2L9BA 4KT6B 4N5CA 4EBAA 1OUVA 5CCMA 1Z3XA 3IVPA 3HVEB 3CKCA 4G26A 3RU0A 4RG9A 5G04J 5E75A 1DW9A 2VJ8A 3LFPA 2AXZA 2AXVA 1WH8A 2C2LA 1SQ8A 1ADRA 3L22A 4ME2A 3SCFA 4UQXA 3TG5A 1RZRD 3KXAA 1NA3A 4MCTA 3G2VA 2UY1B 4WAFA 5ARFA 5CCLA 3MKRA 2PUAA 2CFUA 2HO1A 2A6CA 1QPZA 1E8WA 2I1KA 4QFVA 5G05J 2WB2A 4ATGA 4N2SA 3IHYA 3PZDA 4I1MA 2VSYA 4I2WA 4FU3A 3MYVA 4HOQA 4I1OB 4JCXA 3TXNA 1DNPA 4G25A 4AJWA 2FF4A 2LAHA 3FUJA 3ZHIA 1O4XA 3TL5A 4UI9K 2LSUA 3FUDA 3P2BA 3QKYA 4I9CA 1ZPQA 2CSFA 4GYWA 4AXHA 3MA5A 1H2UA 1NZNA 5AYWD 3UX4A 4B0ZA 3CVVA 3MLFA 1JWLA 3ZHMA 4PU3C 3ZYLA 3OXLA 2GW1A 5CHEE 3QYXA 3PE3A 4GA2A 3RRUA 2X3MA 1EDUA 4J1XA 5EX3A 3SBTB 4K0RA 3Q5MA 3DPDA 4GAAA 3MEKA 5LP0A 4Z5CA 5A7DB 4N39A 2J49A 4JEHA 2GZUA 4BX8A 4OVUA 2JVLA 3FEXA 1HG5A 4MS6A 3KEZA 3S8QA 3G7DA 3FTZA 2LYQA 3Q4AB 3S7JA 4LCTA 1WY6A 4KVOA 3Q15A 3RZZA 1EFAA 1HZ4A 4I43A 4UWHA 1OCTC 2KPJA 4JHJA 4J8FA 4PS7A 2R1JL 5AENA 3HZIB 1EYHA 2IOSA 3GZ2A 4GCNA 2BJCA 3IBEA 1QP0A 1DWKA 4KXKB 3UT8A 3ZYKA 1QQAA 3CHSA 4JQDA 2ICPA 4A3TA 1UW4B 1X57A 2J4BA 3PNTB 1IHGA 4WNEA 4HORA 4Q96A 2FJRA 4U0ZA 2OVBA 2QY7A 1TJCA 4RSYA 3FTXA 4JVSA 3CK9A 2PUEA 5FZRA 1IQUA 2AWIA 3I3NA 4ANVA 2I2OA 3JQ0A 1BDIA 3CK7A 4GQMA 2BNOA 3D9LA 3MX3A 3RIBA 3ZXSA 5KJKA 2WXQA 4HFGA 5FWQA 4EZLA 2YINA 2IOLA 5T3RA 3PNLB 5ARGA 4APFA 2FI7A 3UT4A 2HM8A 4FJZA 1UXCA 1W3BA 4GYYA 1QP4A 3BG0B 1PAQA 4JCYA 2FO7A 3QDNA 3BEEA 3CGHA 1ZVVA 4U04A 5CMWA 3OTNA 1Z3YA 4ANWA 4BX9A 4X4FA 2C0LA 2LNIA 3D9KA 4YG7B 3CVPA 3QK0A 4YARA 5HI7A 1UN9A 3I4RB 2EF8A 1E8ZA 1PC2A 4BSXA 3D9OA 3RK6A 3FTVA 2WPVA 1X2LA 2OFYA 5JJ7A 3KD7A 5FZQA 3D9MA 3CHOA 3FUFA 2O49A 1MHQA 3CHRA 1HX8A 2CHWA 2WXOA 3FTWA 3FH7A 3R7RA 4CRWA 5HQ8A 1RZSA 4H7YA 3U3WA 2QFCA 3EIQC 4F8DA 4WWOA 4GZCA 3IHVA 2NC9A 2X6JA 5JHBA 3SHFA 2HSGA 2EQXA 1OWMA 2BNMA 2WUSR 3QWVA 4E85A 2E2EA 1E3OC 2WXNA 2OOEA 3S7DA 2XCCA 3NF1A 2A4ZA 4FLBA 3OQOA 5FQ4A 2VSOE 2PPXA 2WXPA 3KS2A 1PRVA 2XPYA 3UMVA 1HFAA 4TRQA 2J09A 4DPRA 3APCA 2WXRA 3D9PA 1VDYA 4DLOA 5LCWJ 2CG3A 3GN5B 3CHQA 4UWGA 3ULQA 4Y42A 2R17C 3ZYMA 4GMLA 4JL0A 4BTAA 4I17A 4PU4C 1LCCA 4UWKA 1ZAYA 3CSTA 3OQNA 2UWJG 4Z5DA 4O6FA 2WXGA 1CQTA 2VYIA 5EX0A 3I4GA 3UT7A 3JUIA 1U3CA 4MKTA 4IYPA 4JA9A 1N54A 3EHMA 3FYMA 1GT0C 3TXMA 3QF3A 3S7FA 3G5GA 3KJXA 2VGYA 2XCBA 4KYOB 4AP2A 4B94A 4PU8A 1OSLA 4PH4B 1JPLA 3CVNA 3SI5A 1HF8A 1H0AA 4YG1A 4UI9J 3PS6A 3FUKA 4IN3B 4IVZA 2KEKA 2L0TB 1U3DA 1PRAA 3O9XA 1QQEA 2Y3AA 4EQFA 3G2TA 1E7UA 2ICTA 4N3CA 5T4YA 3FU3A 2UY1A 4WNDA 1L1MA 5G04C 1ELWA 5C2YA 3FU6A 5CMYA 5FT9A 1B89A 1ZZBA 1CJGA 4APOA 2NXPA 3EHNA 1P5QA 4JHRA 5D0OD 3E4BA 5AJDA 3T8MA 3H5TA 2KC7A 2WXMA 3NZSA 2L0IA 4V3IA 2PM6A 3LY7A 5G05C 4CT4A 5FJYA 3FWVA 3FTSA 4B89A 2IVQA 2X38A 1ZZ8A 4NDWA 2XSDC 4X4DA 4I6TA 2X6IA 4FC8A 2YNQA 3L17A 3MZLB 4PS3A 1JWFA 3PVLA 4HXIA 4PS8A 1YSEA 3IKOB 3MV3B 2X6KA 3Q49B 5J08A 2BNNA 4FHJA 3B7SA 4PDXA 2VQ2A 3CEQA 2EBYA 1ZBPA 3FP3A 4DK5A 4HVBA 5G2NA 4GCOA 3ASHA 1IQRA 2DCPA 2IUOA 2WVIA 2CROA 3QJZA 3FTYA 1LLIA 1QZ2A 3NZUA 2KCKA 2FEZA 2MQKA 4G11A 3LS8A 1LCDA 4GZ3A 4XIFA 1XWRA 2IVBA 2XEVA 4JW1A 3TAXA 2EWTA 1KT1A 3QB2A 1E7VA 2XGOA 1UG3A 2V5FA 3DNVB 3CR3A 3APDA 2VTBB 4X4EA 3DBSA 4LRZA 5LOZA 2XIUA 4BTBA 3CVYA 4CEMA 4U0UA 4WWPA 5FQ6A 4GPKA 2BTDA 4L1BA 4R7LA 2GRMA 2PQNA 3PREA 4OVVA 3FH5A 3SGHA 4J8EA 3GBFA 4EZJA 1UTXA 2IFUA 4XX5A 4A3VA 3IEGA 1JWGA 4CDNA 4FN3A 2J08A 3T5XA 3D9IA 3U66A 3PUJA 4CT0A 3OXGA 4L7TA 4F7AA 1EF1C 3QWPA 3U4TA 3SCHA 3IV0A 4EECA 2WXFA 4UQYA 3ZHEB 4JA7A 3D3MA 3GYZA 2PUFA 3D9NA 2LYKA 3HDXA 4NURA 5BW8C 4CGVA 5EKQD 1KLXA 3CHPA 4FBIA 2DIWA 4RVBA 5LFAA 4XKBA 1Y9QA 3R1FA 1HU3A 2WXIA 4G1TA 1JH9A 4G2VA 2NSZA 2ONDA 2PUDA 3FTUA 4JPSA 1FCHA 3QARA 4AVXA 5EDSA 5BV1A 3LJ3A 2IJGX 3AU5A 2R59A 5KJMA 2XRYA 2PUGA 2IV1A 4LEUA 2PUCA 4YBAA 2I1JA 1SZAA 3QNKA 2BF0X 3VLEA 1LF8A 1A17A 5C1DA 3CVWA 1MQSA 1WIZA 2KCLA 2PE5A 4IWRA 1OWOA 1JUQA 4I6RA 4J8DA 3CKBA 4URKA 4Z58A 2YHEA 3F6WA 3RO2A 3AU4A 3I5PA 3EDTB 3ESKA 2CHZA 4DI3A 4L23A 2LO6A 2OR1L 3MGBA 3CVXA 3SBSA 2XPIA 3RJVA 2HINA 1HO8A 4F1SA 3BS3A 4XE0A 4FLHA 1ZS4A 1NA0A 2DBAA 2KM4A 2L8NA 3O4ZA 4XI9A 3VLDA 4E6HA 3RRMB 5KJNA 2LYJA 2IVGA 3CROL 2CFZA 2XCJA 2PM7A 3FY4A 3LY9A 1R63A 2P58C 3UQ3A 3JQ1A 3CIAA 2IF4A 3GN5A 3JXCL 4WNGA 3CQGB 4B8AA 4BT9A 4EPZA 5DBKA 4ILGA 2YQ8A 4ILHB 3ZYQA 1IYGA 4RG6A 2E0IA 4UWLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MLF A;  1L1M A;  1JWL A;  3ZHM A;  4PU3 C;  3FMY A;  4X4G A;  1ZZB A;  1RIO A;  1CJG A;  3QYX A;  2AXU A;  1VPW A;  2B5A A;  4J1X A;  1ZUG A;  4Z59 A;  1WET A;  4Z5C A;  1UXD A;  3H5T A;  1ZZ7 A;  3KZ3 A;  2GZU A;  2LYP A;  2XI8 A;  2D5V A;  2JVL A;  2LYR A;  2IU7 A;  2IVQ A;  3EUS A;  1PRU A;  1ZZ8 A;  3G7D A;  4NDW A;  4Z5H A;  2LYQ A;  4X4D A;  2XSD C;  1ZZC A;  2KZ8 A;  4I6T A;  3ZKC A;  1PNR A;  4O8B A;  3RZZ A;  1EFA A;  1OCT C;  2KPJ A;  2R1J L;  3F52 A;  3CLC A;  1YSE A;  3JXB C;  3HZI B;  1PER L;  2MEZ A;  2BNN A;  5K98 B;  4J1W A;  2BJC A;  1QP0 A;  1DWK A;  3LIS A;  4I8T A;  1QQA A;  2EBY A;  3S8Q A;  4JQD A;  2ICP A;  1X57 A;  1QQB A;  2IUO A;  2CRO A;  2FJR A;  2AW6 A;  4X4H A;  1LLI A;  2R63 A;  2MQK A;  2PUE A;  2AWI A;  4IA8 A;  1BDI A;  1LCD A;  4GQM A;  2BNO A;  1XWR A;  2IVB A;  1S7E A;  2LCV A;  5A7L A;  2EWT A;  3UFD A;  3DNV B;  1BDH A;  3JXD L;  1B0N A;  4X4E A;  3OQM A;  3F51 A;  3BD1 A;  1LQC A;  2XIU A;  1UXC A;  2O4A A;  1QP4 A;  3CEC A;  4JCY A;  1RPE L;  1ZVV A;  2GRM A;  4X4F A;  4X4B A;  3SCG A;  4YG4 A;  4YG7 B;  4YAR A;  4X4C A;  2GRL A;  2EF8 A;  1R69 A;  3GBF A;  2KEJ A;  1UTX A;  1ZZ9 A;  1X2L A;  2OFY A;  3L1P A;  3QWG A;  4FN3 A;  3D1N I;  2WIU B;  2O49 A;  4X4I A;  1RZS A;  2LYL A;  2XJ3 A;  2LYS A;  3PXP A;  3U3W A;  4F8D A;  3SCH A;  4OB4 A;  2O38 A;  1ZZ6 A;  1LMB 3;  1QP7 A;  2HSG A;  2BNM A;  2WUS R;  2L49 A;  2PUF A;  2LYK A;  3FYA A;  1AU7 A;  2PUB A;  4GHJ A;  1E3O C;  1IC8 A;  4MCX A;  1NER A;  1POU A;  1Y7Y A;  4FBI A;  3QQ6 A;  1Y9Q A;  3R1F A;  1WH6 A;  3VK0 A;  2KEI A;  3OQO A;  1JH9 A;  2PUD A;  4PU7 A;  2PPX A;  1PRV A;  3IVP A;  3OP9 A;  2PUG A;  2IV1 A;  2PUC A;  4YBA A;  1DW9 A;  1JFS A;  1HF0 A;  3GN5 B;  3LFP A;  2H8R A;  1WIZ A;  2AXZ A;  4Y42 A;  2AXV A;  1WH8 A;  2PE5 A;  4I6R A;  4IWR A;  1NEQ A;  3BDN A;  4Z58 A;  1SQ8 A;  3F6W A;  4PU4 C;  1ADR A;  1LCC A;  3SCF A;  1ZAY A;  1RZR D;  3KXA A;  3OQN A;  4MCT A;  4Z5D A;  1RZR A;  1CQT A;  2OR1 L;  2HIN A;  4I6U A;  3BS3 A;  2PUA A;  2PIJ A;  1ZS4 A;  2AUW A;  2A6C A;  2L8N A;  1QPZ A;  3FYM A;  1GT0 C;  3QF3 A;  2JCG A;  2LYJ A;  2IVG A;  3G5G A;  3KJX A;  2XCJ A;  3CRO L;  1R63 A;  4PU8 A;  1OSL A;  3OMT A;  3GN5 A;  3JXC L;  4YG1 A;  4JCX A;  3ZHI A;  1O4X A;  3B7H A;  4IVZ A;  3TRB A;  2KEK A;  1JFT A;  1ZPQ A;  2CSF A;  1PRA A;  3O9X A;  2ICT A; 
#chains in the Genus database with same CATH topology
 2DWZ A;  2I9C A;  4GTM A;  3LVQ E;  3TWR A;  3URZ A;  1ZUG A;  3GZS A;  4KBQ A;  5FQ8 A;  2LYP A;  2D5V A;  2XPZ A;  2IU7 A;  1H6P A;  3PE4 A;  3ZKC A;  5ENP D;  2F0Y A;  2KZ8 A;  3SF4 A;  2PXB A;  4O8B A;  4DI4 A;  1Z6T A;  1ELK A;  4F6R D;  3KEA A;  3UM2 A;  4DE8 A;  2MEZ A;  2HYZ A;  2P9N G;  2WM9 A;  4FA6 A;  1DCQ A;  4J8S A;  3ZGQ A;  2R63 A;  4HOS A;  1MX6 A;  2V8S E;  3T5V A;  4Y6W A;  4KZC A;  3ZW3 A;  3JYS A;  3UFD A;  3WXX A;  3A9X A;  2C0M A;  3DEO A;  2M63 A;  4I6J A;  5DT2 A;  1S64 A;  5D0Q D;  4YDW A;  2O4A A;  1O1S A;  4HLL A;  4PUC A;  3HIZ A;  4X4B A;  4U63 A;  4G24 A;  4GMJ A;  2PXP A;  4EQZ A;  5DIZ A;  4TV3 A;  4I9E A;  2WQ6 A;  3ZUV B;  2LNM A;  3ASF A;  2J9Q A;  3FHE A;  3PUK A;  3PH0 C;  2ODR D;  3BUA A;  3GZD A;  1AU7 A;  2DYR E;  4U7E B;  4BT8 A;  1NER A;  2KEI A;  2J8S D;  5ENQ D;  3VLF A;  3AG4 E;  2WQ7 A;  1HF0 A;  3ZHE A;  1HH8 A;  2X6H A;  4CGW A;  3TWW A;  3L08 A;  4HNA D;  4IUL A;  5CED B;  4DX1 A;  1OWL A;  3B95 A;  2FUL A;  4GB9 A;  1N4R A;  2CHX A;  4ANX A;  4UUC A;  4A55 A;  3B7H A;  5A23 A;  1JFT A;  3LPZ A;  3ME5 A;  3PEU B;  3FUL A;  1QNF A;  1YA0 A;  5JJ6 A;  3AS5 A;  3PZ3 A;  3F6Q A;  1TNO A;  2ZGD A;  3UTM A;  4HLE A;  2X6F A;  4BEP A;  3AG3 E;  2LYR A;  2IU1 A;  2KBX A;  1PRU A;  2R5S A;  1BLX B;  3C98 A;  1PNR A;  4ANW A;  3MJW A;  4U0S A;  1XNF A;  3CLC A;  1PER L;  4WNF A;  4U8H A;  3SFZ A;  1QQB A;  3ZKJ A;  2I6H A;  2PXL A;  5A7L A;  2H6G A;  4M7C A;  4HS2 A;  3JXD L;  3BD1 A;  1TR4 A;  5CBN A;  4NQ0 A;  3ZU7 B;  2B6C A;  3ZN3 A;  2GRL A;  3GZC A;  2L6J A;  2WXK A;  4I6E A;  2VGX A;  3L1P A;  1JCS A;  4X4I A;  3UIN C;  3EUV A;  4KVM A;  2WXL A;  1H2V C;  3FUN A;  1Y8M A;  3MCX A;  3HVE A;  3FYA A;  1HS6 A;  5FTP A;  3ML9 A;  1POU A;  3KSQ A;  4KT6 B;  3Q7F A;  2BKG A;  1OUV A;  3TWX A;  3HVE B;  3CKC A;  4RG9 A;  4EHM A;  1DW9 A;  3M9L A;  2VJ8 A;  3T8K A;  2AXV A;  2F8Y A;  1ADR A;  3L22 A;  1KPS B;  3KXA A;  1NA3 A;  5CCL A;  2HO1 A;  2LUH A;  1MX2 A;  3PZD A;  5HRY A;  3MYV A;  2LAH A;  3ZHI A;  4WVL A;  1BU9 A;  4I9C A;  2R03 A;  3FUD A;  3QKY A;  1ZPQ A;  4OAV B;  3MA5 A;  3E32 A;  2R2L A;  1H2U A;  1U2V G;  1LD8 A;  4F1P A;  1OCR E;  5AAO A;  3ZYL A;  5CHE E;  2XEH A;  4GA2 A;  2IO3 C;  4K0R A;  3Q5M A;  4GAA A;  3SQV A;  4JEH A;  2GZU A;  2JVL A;  3FEX A;  3ABL E;  3G7D A;  3Q4A B;  1SVX A;  2LLW A;  3Q15 A;  4LG6 A;  1EFA A;  4UWH A;  2KPJ A;  1NW3 A;  3IBE A;  1QP0 A;  1QQA A;  3ASO E;  3HXC A;  4JQD A;  4Q96 A;  3C72 A;  1TJC A;  5AQ7 A;  5FZR A;  2AWI A;  3ZXS A;  2P9L G;  4APF A;  1W3B A;  4GYY A;  4U04 A;  3CGH A;  1ZVV A;  1D8E A;  5CMW A;  1NFI E;  1Z3Y A;  4X4F A;  2C0L A;  3D9K A;  4EK9 A;  2EF8 A;  4BSX A;  1O5M A;  3CHO A;  2O49 A;  2CHW A;  3FH7 A;  1N11 A;  4H7Y A;  2NC9 A;  2HSG A;  3QWV A;  2WXN A;  2OOE A;  3S7D A;  2XCC A;  3L82 A;  2XPY A;  4TRQ A;  4DPR A;  5LCW J;  2CG3 A;  3CHQ A;  3DM5 A;  2XZD G;  2XEN A;  4Z5D A;  2VYI A;  5EX0 A;  3I4G A;  1U3C A;  4JA9 A;  3FYM A;  4PU8 A;  1OSL A;  4UI9 J;  3PS6 A;  2V5Q C;  3G2T A;  1E7U A;  2ICT A;  5CEA A;  2UY1 A;  4WND A;  1B89 A;  3UXG A;  2XXP A;  2NXP A;  4BER A;  5D0O D;  3E4B A;  5AJD A;  3T8M A;  4ER6 A;  4BET A;  3H5T A;  2WXM A;  2PM6 A;  2ETA A;  4ER3 A;  3FTS A;  4NDW A;  3ZPX A;  4BSZ B;  3MZL B;  3TFL A;  1YSE A;  3IKO B;  3MV3 B;  3Q49 B;  4JB8 P;  5CRU A;  2EBY A;  1ZBP A;  3FP3 A;  4GCO A;  1IQR A;  1DC2 A;  2CRO A;  3NZU A;  2FEZ A;  2MQK A;  4GTS A;  3LS8 A;  2DVW A;  4XIF A;  2IVB A;  3TAX A;  1KT1 A;  3QB2 A;  1E7V A;  2XGO A;  1UG3 A;  3NOC D;  3CVY A;  2BTD A;  4R7L A;  2PQN A;  2ZIR A;  4OVV A;  1N9A A;  1TN7 A;  3FH5 A;  4J8E A;  4FN3 A;  2J08 A;  3T5X A;  3U66 A;  2FO1 E;  3PUJ A;  3UIO C;  5B1A E;  4F7A A;  3U4T A;  3SCH A;  4J8Y A;  3IV0 A;  4CGV A;  4NUR A;  1KLX A;  2DIW A;  4XKB A;  2WXI A;  2OND A;  3SR4 A;  5EDS A;  2XRY A;  3QNK A;  4YBA A;  1A17 A;  3CVW A;  2KCL A;  4I6R A;  3CKB A;  4Z58 A;  3I5P A;  1FT2 A;  1K1B A;  3C3R A;  2XPI A;  5KNH D;  2HIN A;  3RJV A;  4K5A B;  1ZS4 A;  1NA0 A;  2L8N A;  4E6H A;  3RRM B;  5LX8 A;  2IVG A;  3ABM E;  3CIA A;  4BT9 A;  1OXJ A;  3ZYQ A;  1IYG A;  2E0I A;  2ZIS A;  4GTV A;  4UWL A;  4A1S A;  5LCW C;  4FAD A;  2WMO A;  5ENO D;  1OWN A;  2V4L A;  2L6B A;  2EIJ E;  5ENN A;  2RFA A;  4Z59 A;  3CVU A;  1E8Y A;  4YVO A;  2ZXW E;  3FUI A;  3ZIM A;  4AV7 A;  5ANL A;  4ANU A;  2RG8 A;  3R9A B;  1ZZC A;  5BT1 A;  4LER A;  4UI9 C;  4N2Q A;  4BWR A;  2XQ0 A;  4J1W A;  4AOF A;  4X4H A;  3LXU X;  2KCV A;  3ZPJ A;  3U64 A;  3LVR E;  4NAC A;  3ASD A;  2VSN A;  1BDH A;  3ZVV A;  3OQM A;  4HI9 A;  4MLP A;  5AQB A;  1Q2Z A;  1QBQ A;  4TXQ A;  4GZ5 A;  1RPE L;  4ACK A;  3SCG A;  4YG4 A;  3UIP C;  3UI2 A;  4X8Q A;  3DSS A;  3NXH A;  2A5E A;  3SO8 A;  4GU5 A;  3ONL A;  5FIN A;  4GHJ A;  4MCX A;  2Y4U A;  1WAO 1;  1WH6 A;  3R9M A;  4PU7 A;  4ABN A;  4AM9 A;  3OP9 A;  3ULE G;  2V0P A;  1TNB A;  1NEQ A;  2P9I G;  2LLV A;  3Q73 A;  1RZR A;  3OXF A;  4RQI A;  2WMN A;  1IKN D;  3TWV A;  3OMT A;  3FEY A;  3FUE A;  4JZY A;  3VTX A;  3JCK C;  1XGW A;  1RIO A;  3PE5 A;  2ION A;  2B5A A;  3APF A;  2H6H A;  4F53 A;  1ZZ7 A;  4G8L A;  1YMP A;  3SNX A;  4K5C A;  2J4D A;  3QOU A;  3EUS A;  1OCO E;  4XI0 A;  1SQM A;  2J07 A;  2H6F A;  3DEP A;  5FQ7 A;  4DJA A;  3Q9N C;  5AJL A;  2OVF A;  3B7T A;  3UKU G;  4D10 C;  4O1P A;  1FPP A;  4I2Z A;  4IA8 A;  1ZU2 A;  5FIO A;  1S7E A;  1FT1 A;  2OEV A;  2WQH A;  4N3A A;  3HYM B;  1TN6 A;  4GYO A;  3OAW A;  3RRN B;  2GRO B;  1X5B A;  3PRZ A;  4HOU A;  3S7B A;  5BV0 A;  4X4C A;  1R69 A;  3ESL A;  2MHK A;  4DX6 D;  2WXJ A;  2BUG A;  3ONK A;  2XJ3 A;  3ZEF A;  3ENE A;  4WUY A;  1ZZ6 A;  3EJN A;  5JJT A;  2Y4T A;  3Q47 B;  2PUB A;  4GZD A;  4JEU A;  1ZB1 A;  3FH8 A;  3TEP A;  2DZN A;  1Z5S C;  2ZGG A;  3KSL A;  4G26 A;  3RU0 A;  2AXZ A;  1RW2 A;  4UQX A;  3JXJ A;  4QFV A;  5G05 J;  2WB2 A;  4ER7 A;  4I2W A;  5DRT A;  4I1O B;  3QOX A;  4G25 A;  1O4X A;  4GYW A;  1A5E A;  5AYW D;  3MLF A;  1JWL A;  3ZHM A;  2GW1 A;  3SY2 A;  3QYX A;  1EDU A;  5EX3 A;  4XEI G;  3MEK A;  4Z5C A;  5A7D B;  4N39 A;  4BX8 A;  4OVU A;  1N4S A;  3OKZ A;  1HG5 A;  1WY6 A;  4I43 A;  1OCT C;  2Y1L E;  4PS7 A;  3HZI B;  1TN8 A;  2GRQ B;  4KXK B;  2ICP A;  3HXE A;  4A3T A;  1IHG A;  4HOR A;  2PUE A;  2VGE A;  3I3N A;  2I2O A;  3MX3 A;  2BNO A;  2RFM A;  2ETB A;  5T3R A;  3PNL B;  5KNG A;  3QDN A;  1N4P A;  3V2X A;  3J5Q B;  5AAR A;  4YAR A;  5HI7 A;  3FTV A;  4LNU D;  2OFY A;  5JJ7 A;  3KD7 A;  5FZQ A;  3D9M A;  1MHQ A;  3FTW A;  2WXO A;  4HBD A;  3GZD C;  3IHV A;  5JHB A;  2E2E A;  3JUE A;  5FQ4 A;  3TWQ A;  2VSO E;  5DRY A;  3KS2 A;  4GTR A;  1HFA A;  5AQA A;  3NRO A;  4DLO A;  5EN5 D;  2OCC E;  2R17 C;  1N0R A;  4GML A;  4TXP A;  2HCS A;  1ZAY A;  3OQN A;  2UWJ G;  3C5R A;  4ZFH A;  1OCZ E;  4MKT A;  4IYP A;  3EHM A;  2P9U G;  1GT0 C;  2XCB A;  2VGY A;  1JPL A;  3SI5 A;  1HQ1 A;  2Y3A A;  5T4Y A;  1L1M A;  5C2Y A;  1K8K G;  2KC7 A;  4YDY A;  3NOG D;  4V3I A;  3LY7 A;  5G05 C;  3FWV A;  4B89 A;  5DTR A;  4GTO A;  4DUI A;  2XSD C;  4X4D A;  1QYM A;  5IY5 E;  3PVL A;  4PS8 A;  2X6K A;  3C3Q A;  5AN8 A;  2BNN A;  4FHJ A;  2VQ2 A;  4DK5 A;  3AG2 E;  2PNN A;  3ASH A;  3UM1 A;  1QZ2 A;  4C48 B;  1XWR A;  4JW1 A;  2PXD A;  2RKK A;  2M4H A;  2V5F A;  2GRR B;  1K1A A;  3V30 A;  3APD A;  2VTB B;  5ENT D;  2H6I A;  4WWP A;  1SA5 A;  2MYO A;  4L1B A;  4DE9 A;  4L9P A;  3TEL A;  4CDN A;  3D9I A;  4L7T A;  1DCE A;  2WXF A;  2PXT A;  3GYZ A;  2LYK A;  4GTT A;  4RVB A;  5LFA A;  1Y9Q A;  3SFY A;  2PUD A;  4ER5 A;  4JPS A;  3QAR A;  4HI8 A;  4LEU A;  3W9F A;  5C1D A;  4J8D A;  1OWO A;  1WDY A;  3J5P A;  4URK A;  3F6W A;  3AU4 A;  3EDT B;  3ESK A;  3UWP A;  4DI3 A;  2LO6 A;  1HO8 A;  1OCC E;  4F1S A;  3BS3 A;  1JCQ A;  4XE0 A;  2DBA A;  3VLD A;  2LYJ A;  2XCJ A;  3LY9 A;  1R63 A;  4LSZ E;  2ETC A;  3JXI A;  3JQ1 A;  3NB2 A;  4WNG A;  2YQ8 A;  4ILH B;  4RG6 A;  5CRV A;  4EBA G;  2F8X K;  4QQI A;  4YVQ C;  1TJF A;  3B7B A;  3U9W A;  3E37 A;  2XRZ A;  2XI8 A;  2FBN A;  4AY5 A;  3R7Q A;  3MEJ A;  4CDR A;  2V4H C;  3A9Z A;  3TJP A;  2PL2 A;  4M3O A;  4C9B B;  1NP7 A;  3NZL A;  1N52 A;  3B13 A;  1UJK A;  3AS8 A;  2XS1 A;  4JXT A;  3Q79 A;  4C0M A;  3CLJ A;  3RKV A;  2PQR A;  4ILI A;  4BFR A;  3G2U A;  3QC1 A;  1MX4 A;  3B7U X;  3FUH A;  1UJJ A;  1H2T C;  1LQC A;  4NRH B;  2IY0 C;  3CEC A;  2LXL A;  5BPP A;  3FU5 A;  1E90 A;  2KAT A;  2IQC A;  3K9I A;  4WWN A;  3MV2 B;  3L6A A;  1HE8 A;  5EID A;  2P9S G;  4HOT A;  2LYL A;  3PXP A;  5GAH i;  5EYL A;  2HCN A;  4I1A A;  1OWP A;  3PZ4 A;  2RD0 A;  1YCS B;  3DXK G;  3G2W A;  2QYU A;  3QQ6 A;  4K03 A;  4MRU A;  4ER0 A;  2ILR A;  1H19 A;  3DST A;  4J0U A;  4YND A;  4G8K A;  1JFS A;  2H8R A;  3ABK E;  2VEO A;  4U8Y D;  2IO2 C;  5E76 A;  2XXA A;  4AIF A;  3UUX A;  4Z68 A;  4LUN U;  4Q69 A;  4I6U A;  4FHK A;  2PIJ A;  5ENR D;  2JCG A;  3LCA A;  1LTX A;  4CCA A;  4UQZ A;  1H6K A;  2QC9 A;  4JHK A;  3TRB A;  1KT0 A;  1SZ9 A;  3L13 A;  5T8I A;  5KCM A;  3PDN A;  2JAB A;  3MKQ A;  3LKU A;  2HR2 A;  1WET A;  1UXD A;  4L2Y A;  3G2S A;  4OYS A;  1OT8 A;  3MKQ B;  1QP7 A;  4Z5H A;  2OV8 A;  4BY6 A;  1EPU A;  4FUL A;  4DLQ A;  1FVF A;  2PXQ A;  3CK8 A;  2L1P A;  3LYA A;  4J6I A;  3N71 A;  3F52 A;  3AG1 E;  4A1G A;  5K98 B;  5ANR A;  3LIS A;  4I8T A;  3QAQ A;  1INZ A;  2FFH A;  3DXM G;  2AW6 A;  1S0P A;  3ML8 A;  4DX5 D;  4U07 A;  4OBM A;  1GW6 A;  3ZFW A;  3AAA C;  2KXP C;  3FU0 A;  1MJ0 A;  1DUL A;  1LD7 A;  3F51 A;  1HXI A;  1BPO A;  3HXD A;  2XXQ A;  4U95 D;  2KEJ A;  3QWG A;  3O48 A;  2WIU B;  2PXF A;  1DVP A;  3QWW A;  4OB4 A;  1LMB 3;  2Y0B G;  4GZ6 A;  3FDH A;  4G23 A;  1SW6 A;  3LDZ A;  3LY8 A;  3UPV A;  2YHC A;  2ZU6 B;  3EU5 A;  2Q7F A;  3CHM A;  3VK0 A;  2L9B A;  4N5C A;  3ASN E;  1RZ4 A;  5CCM A;  5G04 J;  5E75 A;  5DTQ A;  4ME2 A;  4MCT A;  3G2V A;  5ARF A;  5GAG i;  5BXO A;  3PZ1 A;  1E8W A;  2I1K A;  4ATG A;  3IHY A;  4I1M A;  2P9P G;  2VSY A;  4FU3 A;  4HOQ A;  3A9Y A;  4JCX A;  2AJA A;  1DNP A;  3TL5 A;  1BD8 A;  4AXH A;  1N4Q A;  5KWD A;  3UX4 A;  4B0Z A;  1MZC A;  3OXL A;  5HS0 A;  3PE3 A;  3RRU A;  4J1X A;  3DPD A;  4HQD A;  2OEW A;  4MS6 A;  3KEZ A;  3FTZ A;  2LYQ A;  4LCT A;  4N5Q A;  4JHJ A;  1EYH A;  3HRA A;  4GCN A;  2BJC A;  1TYQ G;  1DWK A;  1UW4 B;  1X57 A;  2J4B A;  4WNE A;  2FJR A;  2OVB A;  2QY7 A;  3DSW A;  4ANV A;  3JQ0 A;  1BDI A;  3CK7 A;  5KJK A;  1N95 A;  2BED A;  2WXQ A;  4HFG A;  2YIN A;  2IOL A;  5ARG A;  2FI7 A;  4HB5 A;  3UT4 A;  4FJZ A;  4Q2J A;  3BG0 B;  4JCY A;  2FO7 A;  2J7U A;  1UOH A;  3SX0 A;  3RK6 A;  4TXR A;  1X2L A;  3C3O A;  2V3C C;  3CHR A;  1HX8 A;  1RZS A;  3U3W A;  2QFC A;  3NDB B;  4WWO A;  2GRN B;  4DX2 A;  4MBG A;  3SHF A;  1OWM A;  2BNM A;  4O60 A;  5D66 A;  2A4Z A;  2PPX A;  2WXP A;  1PRV A;  2JQE A;  3APC A;  2WXR A;  3GN5 B;  4UWG A;  3ZYM A;  1G3N B;  4JL0 A;  4BTA A;  4I17 A;  1LCC A;  4UWK A;  4O6F A;  3JUI A;  1H6O A;  1N54 A;  3TXM A;  3KJX A;  4KYO B;  4AP2 A;  1TNY A;  3CVN A;  1HF8 A;  1O1R A;  1H0A A;  3FUK A;  4IN3 B;  2L0T B;  5JUW A;  3T9K A;  1PRA A;  1QQE A;  4EQF A;  4N3C A;  3DWL G;  5G04 C;  3TWU A;  1ELW A;  3FU6 A;  5CMY A;  2EIL E;  4APO A;  1P5Q A;  4JHR A;  2YBD A;  2L0I A;  1K3Z D;  2X38 A;  1ZZ8 A;  4I6T A;  4FC8 A;  5J08 A;  4PDX A;  3EHR A;  3CEQ A;  4HVB A;  2DCP A;  3LJN A;  2IUO A;  2WVI A;  3FTY A;  1LLI A;  1LCD A;  4GZ3 A;  2XEV A;  2EWT A;  1TNU A;  2EIK E;  3DNV B;  5H7P A;  2XIU A;  4CEM A;  4U0U A;  4GPK A;  3L9T A;  2GRM A;  1JCR A;  4EZJ A;  1UTX A;  2IFU A;  4XX5 A;  3ZNG A;  4A3V A;  3IEG A;  1JWG A;  5JMN D;  4CT0 A;  3DPY A;  3W9G A;  4EEC A;  3ZHE B;  3PZ2 A;  3D3M A;  3HDX A;  4G1T A;  1JH9 A;  2NSZ A;  3LJ3 A;  3AU5 A;  2IV1 A;  2PUC A;  2I1J A;  1SZA A;  2BF0 X;  3VLE A;  1MQS A;  1WIZ A;  2PE5 A;  1JUQ A;  1KZP A;  2YHE A;  2OR1 L;  3CVX A;  3O4Z A;  2KM4 A;  4XI9 A;  1BI7 B;  2IEJ A;  5CER B;  4HRA A;  3CRO L;  2CFZ A;  2PM7 A;  2P58 C;  2IF4 A;  4B8A A;  4EPZ A;  2EIM E;  5BUZ A;  1KZO A;  3G0T A;  1V54 E;  2EIN E;  2Y69 E;  4H7X A;  3RSE G;  3D9J A;  2CG2 A;  2VSX E;  4Y6C A;  3KZ3 A;  3AS4 A;  3SZ7 A;  3WG7 E;  4UWF A;  3CQC B;  2LSV A;  3TG4 A;  4KZ0 A;  2PXV A;  3LQX A;  5B1B E;  3KAE A;  4GA1 A;  3CV0 A;  3ZXP A;  3TGO A;  3NAW A;  3JXB C;  4TUU A;  1E96 B;  3VTY A;  4LNB A;  1NI1 A;  2GRP B;  3P1U A;  4ACL A;  4AEZ C;  5EYP F;  3L16 A;  5EIL A;  3CVQ A;  1UN8 A;  2PXE A;  2XHE A;  3KL4 A;  2VGX B;  3CVL A;  5J90 A;  2XEE A;  1B0N A;  4EZI A;  5JHA A;  2B0O E;  3Q78 A;  5KBA A;  4L2L A;  3B7R L;  5DSX A;  3E30 A;  1IXV A;  2VTB A;  1HG2 A;  2LYS A;  4GTP A;  5CEC B;  2O38 A;  4ATZ D;  4W9R A;  3BQO A;  3DRA A;  3IXE A;  1TEZ A;  3DSV A;  2JLB A;  1Y6I A;  2GGF A;  1L5J A;  5G55 A;  4U8V D;  3ULY A;  4JC8 A;  2MRI A;  1E8X A;  3V79 K;  4U96 D;  5BNW A;  3GZ1 A;  4ZHB A;  1ELR A;  5JA4 D;  1N94 A;  3CSF A;  4B8C B;  2XZT G;  4P29 A;  5HKP A;  3BDN A;  4FJY A;  3L54 A;  1D9S A;  4NIK A;  5AIJ A;  1IHB A;  4EKI A;  2F37 A;  4RLY A;  2AUW A;  2XGM A;  3FUM A;  5A6C A;  5M72 A;  3EIJ A;  4IRU A;  3GW4 A;  3RO3 A;  5FZS A;  3X2Q E;  1WG0 A;  4FP7 A;  2AVP A;  3FMY A;  3HXF A;  4C0E A;  4X4G A;  2XGS A;  2AXU A;  1VPW A;  1NL4 A;  3LEW A;  4CZ2 D;  3ASG A;  1YYH A;  4Q94 A;  2A5U A;  3AJI A;  2LAI A;  4K5B A;  3UM0 A;  4F3V A;  4CDM A;  2BKK B;  1WM5 A;  4XKC A;  1S70 B;  5KJL A;  2KZT A;  3PEV B;  4GA0 A;  3BG1 B;  2WXH A;  1FVH A;  4HRM B;  3HHM A;  2LCV A;  2JEK A;  4DRX E;  3VWS A;  2R02 A;  3S2A A;  2KZT B;  2PZI A;  3SD5 A;  1BI8 B;  3NQP A;  1PY1 A;  4EZK A;  4N3B A;  1TNZ A;  4KMO A;  4I6G A;  3ZRH A;  4AY6 A;  4A63 B;  2MOW A;  1ZZ9 A;  3D1N I;  5CBO A;  3QFI A;  3FFL A;  3E34 A;  3HXB A;  4LNG A;  2L49 A;  2R05 A;  5AQ9 A;  1IC8 A;  1Y7Y A;  4XZ4 A;  4EBA A;  1Z3X A;  3IVP A;  4YDE A;  3R09 A;  1X81 A;  3LFP A;  1WH8 A;  2C2L A;  1SQ8 A;  3SCF A;  3TG5 A;  1RZR D;  3Q7A A;  2UY1 B;  4WAF A;  4BES A;  2LXM A;  3MKR A;  2PUA A;  2CFU A;  2A6C A;  1QPZ A;  5ENS D;  4N2S A;  1QZX A;  3TXN A;  4AJW A;  2FF4 A;  3FUJ A;  4UI9 K;  2LSU A;  3P2B A;  2CSF A;  1OY3 D;  1NZN A;  2QYJ A;  3CVV A;  4PU3 C;  2DYS E;  2XS8 A;  2X3M A;  3SBT B;  2J7W A;  5LP0 A;  2J49 A;  4HRN A;  5EIB E;  5D2M C;  3UKR G;  3S8Q A;  3S7J A;  2QZA A;  4KVO A;  3RZZ A;  1HZ4 A;  4J8F A;  2R1J L;  5AEN A;  3GZ2 A;  2IOS A;  3UT8 A;  3ZYK A;  3CHS A;  3PNT B;  4U0Z A;  4RSY A;  3FTX A;  4JVS A;  3CK9 A;  1IQU A;  3RIB A;  4GQM A;  3D9L A;  3Q9U C;  4J7W A;  3V2O A;  4TUM A;  1AP7 A;  1S63 A;  5FWQ A;  4EZL A;  5B3S E;  4YDO A;  2HM8 A;  1UXC A;  1QP4 A;  1PAQ A;  3BEE A;  3HG0 D;  3OTN A;  4BX9 A;  2LNI A;  3QK0 A;  4YG7 B;  3CVP A;  1UN9 A;  3I4R B;  1E8Z A;  1PC2 A;  3D9O A;  3GUU A;  2WPV A;  3QOW A;  3FUF A;  4CRW A;  2P9K G;  3R7R A;  5HQ8 A;  3EIQ C;  4F8D A;  4HRL A;  4GZC A;  2X6J A;  5DTM A;  2EQX A;  2WUS R;  3DSU A;  4E85 A;  4GMR A;  1E3O C;  4DX7 D;  3RAU A;  3BU8 A;  3NF1 A;  4FLB A;  3TWT A;  3OQO A;  3UMV A;  2J09 A;  3D9P A;  1VDY A;  1MYO A;  3ULQ A;  4Y42 A;  3D9H A;  3SFX A;  1N0Q A;  4PU4 C;  3CST A;  2WXG A;  1CQT A;  4JD2 G;  3ISM C;  3UT7 A;  3DSX A;  1V55 E;  2MXD A;  3QF3 A;  3S7F A;  3G5G A;  4B94 A;  5ITZ F;  4PH4 B;  4O1O A;  4YG1 A;  4IVZ A;  2KEK A;  1U3D A;  3O9X A;  3FU3 A;  5FT9 A;  1ZZB A;  1CJG A;  2PXU A;  3EHN A;  3NZS A;  1U2Z A;  4CT4 A;  5FJY A;  2IVQ A;  3EU9 A;  2X6I A;  2YNQ A;  3L17 A;  4PS3 A;  1JWF A;  4HXI A;  1AWC B;  4GTQ A;  3B7S A;  2NYJ A;  5G2N A;  3NBN B;  3QJZ A;  2KCK A;  4GPM A;  4G11 A;  2DZO A;  3EHQ A;  1SA4 A;  3CR3 A;  3E33 A;  4X4E A;  3DBS A;  4LRZ A;  5LOZ A;  4BTB A;  5FQ6 A;  4CYM D;  4EKG A;  3PRE A;  5BXU A;  3SGH A;  3GBF A;  2HFZ A;  3OXG A;  1EF1 C;  3QWP A;  1QB2 A;  1O1T A;  2HE0 A;  4UQY A;  4JA7 A;  2PUF A;  3D9N A;  5BW8 C;  5EKQ D;  3CHP A;  4FBI A;  4G2V A;  3OWQ A;  3R1F A;  1HU3 A;  3FTU A;  1MFQ C;  1FCH A;  4AVX A;  5BV1 A;  2IJG X;  3V31 A;  2R59 A;  5KJM A;  2PUG A;  3TWS A;  1LF8 A;  4IWR A;  3RO2 A;  4B93 B;  3Q75 A;  2CHZ A;  4L23 A;  3MGB A;  3SBS A;  1D8D A;  2PXK A;  4FLH A;  3UM3 A;  4OAU C;  5KJN A;  3FY4 A;  3UQ3 A;  3GN5 A;  3JXC L;  3CQG B;  5DBK A;  4ILG A;  2P2C P; 
#chains in the Genus database with same CATH homology
 4A1S A;  5BUZ A;  5LCW C;  4FAD A;  2WMO A;  4EBA G;  1OWN A;  2I9C A;  4H7X A;  2V4L A;  3LVQ E;  3D9J A;  4YVQ C;  5ENN A;  1TJF A;  3U9W A;  3URZ A;  1ZUG A;  4Z59 A;  2CG2 A;  3CVU A;  2VSX E;  3GZS A;  4KBQ A;  1E8Y A;  4Y6C A;  4YVO A;  2XRZ A;  3KZ3 A;  5FQ8 A;  5LX8 A;  3FUI A;  3AS4 A;  2LYP A;  3SZ7 A;  2XI8 A;  2D5V A;  2FBN A;  4UWF A;  3ZIM A;  5ANL A;  2XPZ A;  3CQC B;  2LSV A;  4AV7 A;  4ANU A;  4AY5 A;  3TG4 A;  4KZ0 A;  2IU7 A;  2RG8 A;  3PE4 A;  3ZKC A;  3R9A B;  1ZZC A;  2KZ8 A;  3R7Q A;  5BT1 A;  3KAE A;  4LER A;  4GA1 A;  3CV0 A;  4UI9 C;  3SF4 A;  4CDR A;  4O8B A;  4DI4 A;  3TGO A;  1Z6T A;  4N2Q A;  4BWR A;  1ELK A;  2PL2 A;  2XQ0 A;  4M3O A;  3TJP A;  4C9B B;  1NP7 A;  3JXB C;  4TUU A;  2MEZ A;  1E96 B;  1N52 A;  2HYZ A;  4J1W A;  2WM9 A;  3VTY A;  3B13 A;  1UJK A;  3AS8 A;  4FA6 A;  3P1U A;  4ACL A;  4AEZ C;  4AOF A;  4J8S A;  4JXT A;  3ZGQ A;  4X4H A;  3L16 A;  4C0M A;  3CVQ A;  2R63 A;  1UN8 A;  2XHE A;  3CLJ A;  3RKV A;  3LXU X;  4HOS A;  2PQR A;  2V8S E;  3T5V A;  4ILI A;  2KCV A;  4Y6W A;  3ZPJ A;  4KZC A;  3ZW3 A;  3JYS A;  3U64 A;  2VGX B;  4BFR A;  3LVR E;  4NAC A;  3ASD A;  3UFD A;  3CVL A;  2VSN A;  3G2U A;  3B7U X;  3QC1 A;  1BDH A;  3WXX A;  5J90 A;  3ZVV A;  2C0M A;  2M63 A;  1B0N A;  3FUH A;  4I6J A;  3OQM A;  5D0Q D;  1UJJ A;  1H2T C;  1LQC A;  4MLP A;  4NRH B;  5JHA A;  2O4A A;  4GZ5 A;  3CEC A;  1RPE L;  4ACK A;  4PUC A;  3HIZ A;  4X4B A;  3SCG A;  4YG4 A;  4G24 A;  4GMJ A;  3FU5 A;  4U63 A;  5BPP A;  1E90 A;  2KAT A;  2IQC A;  5DIZ A;  3K9I A;  4I9E A;  4L2L A;  3B7R L;  4TV3 A;  4WWN A;  2WQ6 A;  3MV2 B;  3L6A A;  1HE8 A;  4GU5 A;  4HOT A;  2VTB A;  2LYL A;  3PXP A;  1HG2 A;  2LYS A;  3ASF A;  3ONL A;  2J9Q A;  4I1A A;  2O38 A;  4W9R A;  1OWP A;  3FHE A;  3PUK A;  3PH0 C;  1AU7 A;  4GHJ A;  2RD0 A;  4BT8 A;  1TEZ A;  4MCX A;  2JLB A;  2Y4U A;  3G2W A;  1NER A;  1Y6I A;  1L5J A;  2GGF A;  3QQ6 A;  2KEI A;  1WAO 1;  1WH6 A;  5G55 A;  4K03 A;  3VLF A;  4MRU A;  4PU7 A;  4JC8 A;  2ILR A;  1H19 A;  2MRI A;  1E8X A;  4J0U A;  4ABN A;  4AM9 A;  3OP9 A;  5BNW A;  3GZ1 A;  1ELR A;  4YND A;  3CSF A;  1JFS A;  1HF0 A;  2H8R A;  4B8C B;  2WQ7 A;  3ZHE A;  1HH8 A;  2V0P A;  2X6H A;  4P29 A;  4CGW A;  1NEQ A;  3BDN A;  3L08 A;  5E76 A;  4AIF A;  4FJY A;  3L54 A;  4IUL A;  3UUX A;  1RZR A;  3OXF A;  4LUN U;  1OWL A;  5AIJ A;  4Q69 A;  4I6U A;  2FUL A;  4FHK A;  2PIJ A;  4GB9 A;  2AUW A;  2XGM A;  3FUM A;  2JCG A;  5A6C A;  2CHX A;  2WMN A;  5M72 A;  3LCA A;  4ANX A;  3OMT A;  3EIJ A;  4IRU A;  4A55 A;  3FEY A;  3FUE A;  3GW4 A;  3RO3 A;  4JZY A;  4UQZ A;  3B7H A;  1H6K A;  4CCA A;  4JHK A;  3TRB A;  5A23 A;  1JFT A;  1KT0 A;  1SZ9 A;  3L13 A;  3LPZ A;  3PEU B;  5FZS A;  3VTX A;  4FP7 A;  3FUL A;  2AVP A;  1QNF A;  1YA0 A;  5T8I A;  5KCM A;  3JCK C;  1XGW A;  3AS5 A;  3FMY A;  5JJ6 A;  3PDN A;  4C0E A;  4X4G A;  2XGS A;  1RIO A;  2AXU A;  3MKQ A;  3LKU A;  1VPW A;  2ION A;  2B5A A;  3APF A;  3LEW A;  3ASG A;  4HLE A;  2X6F A;  2HR2 A;  1WET A;  4F53 A;  1UXD A;  1ZZ7 A;  4Q94 A;  4L2Y A;  2A5U A;  2LAI A;  3G2S A;  2LYR A;  4OYS A;  4F3V A;  3SNX A;  3MKQ B;  2IU1 A;  2J4D A;  3QOU A;  4CDM A;  3EUS A;  1PRU A;  4Z5H A;  1QP7 A;  2OV8 A;  2R5S A;  3C98 A;  4BY6 A;  1PNR A;  1EPU A;  3MJW A;  1SQM A;  2J07 A;  1FVF A;  4FUL A;  1WM5 A;  4U0S A;  4XI0 A;  4DLQ A;  1XNF A;  3CK8 A;  4J6I A;  3LYA A;  3N71 A;  5FQ7 A;  4DJA A;  3CLC A;  3F52 A;  4XKC A;  5AJL A;  1PER L;  4A1G A;  4WNF A;  5K98 B;  2OVF A;  5ANR A;  3LIS A;  4I8T A;  3B7T A;  3QAQ A;  5KJL A;  4U8H A;  2KZT A;  4D10 C;  1INZ A;  3SFZ A;  1QQB A;  3PEV B;  2AW6 A;  4GA0 A;  1S0P A;  4I2Z A;  3BG1 B;  3ML8 A;  2WXH A;  4U07 A;  1FVH A;  1GW6 A;  4IA8 A;  1ZU2 A;  2I6H A;  3ZFW A;  3HHM A;  2LCV A;  1S7E A;  5A7L A;  2JEK A;  3S2A A;  2KZT B;  2PZI A;  3FU0 A;  3SD5 A;  3NQP A;  1PY1 A;  2WQH A;  3HYM B;  4N3A A;  4HS2 A;  3JXD L;  4EZK A;  4GYO A;  3F51 A;  1HXI A;  3BD1 A;  1BPO A;  4N3B A;  3OAW A;  4NQ0 A;  3RRN B;  1X5B A;  3PRZ A;  4HOU A;  4I6G A;  4KMO A;  3S7B A;  5BV0 A;  3ZRH A;  3ZN3 A;  4AY6 A;  4X4C A;  2GRL A;  2MOW A;  1R69 A;  2KEJ A;  2L6J A;  2WXK A;  4I6E A;  1ZZ9 A;  3ESL A;  2VGX A;  2MHK A;  3L1P A;  3QWG A;  3D1N I;  3O48 A;  2WIU B;  2WXJ A;  4X4I A;  1DVP A;  2BUG A;  3QWW A;  3ONK A;  2XJ3 A;  3FFL A;  3ENE A;  4KVM A;  3ZEF A;  4WUY A;  2WXL A;  1H2V C;  4OB4 A;  1ZZ6 A;  3EJN A;  1LMB 3;  3FDH A;  3FUN A;  4GZ6 A;  1Y8M A;  3MCX A;  4G23 A;  3HVE A;  2L49 A;  5JJT A;  3LDZ A;  3FYA A;  2Y4T A;  3LY8 A;  2PUB A;  3Q47 B;  3UPV A;  1IC8 A;  1HS6 A;  2YHC A;  4GZD A;  2ZU6 B;  3ML9 A;  4JEU A;  1POU A;  1Y7Y A;  2Q7F A;  5FTP A;  3FH8 A;  3CHM A;  3VK0 A;  4XZ4 A;  2L9B A;  4KT6 B;  4N5C A;  4EBA A;  1OUV A;  5CCM A;  1Z3X A;  3IVP A;  3HVE B;  3CKC A;  4G26 A;  3RU0 A;  4RG9 A;  5G04 J;  5E75 A;  1DW9 A;  2VJ8 A;  3LFP A;  2AXZ A;  2AXV A;  1WH8 A;  2C2L A;  1SQ8 A;  1ADR A;  3L22 A;  4ME2 A;  3SCF A;  4UQX A;  3TG5 A;  1RZR D;  3KXA A;  1NA3 A;  4MCT A;  3G2V A;  2UY1 B;  4WAF A;  5ARF A;  5CCL A;  3MKR A;  2PUA A;  2CFU A;  2HO1 A;  2A6C A;  1QPZ A;  1E8W A;  2I1K A;  4QFV A;  5G05 J;  2WB2 A;  4ATG A;  4N2S A;  3IHY A;  3PZD A;  4I1M A;  2VSY A;  4I2W A;  4FU3 A;  3MYV A;  4HOQ A;  4I1O B;  4JCX A;  3TXN A;  1DNP A;  4G25 A;  4AJW A;  2FF4 A;  2LAH A;  3FUJ A;  3ZHI A;  1O4X A;  3TL5 A;  4UI9 K;  2LSU A;  3FUD A;  3P2B A;  3QKY A;  4I9C A;  1ZPQ A;  2CSF A;  4GYW A;  4AXH A;  3MA5 A;  1H2U A;  1NZN A;  5AYW D;  3UX4 A;  4B0Z A;  3CVV A;  3MLF A;  1JWL A;  3ZHM A;  4PU3 C;  3ZYL A;  3OXL A;  2GW1 A;  5CHE E;  3QYX A;  3PE3 A;  4GA2 A;  3RRU A;  2X3M A;  1EDU A;  4J1X A;  5EX3 A;  3SBT B;  4K0R A;  3Q5M A;  3DPD A;  4GAA A;  3MEK A;  5LP0 A;  4Z5C A;  5A7D B;  4N39 A;  2J49 A;  4JEH A;  2GZU A;  4BX8 A;  4OVU A;  2JVL A;  3FEX A;  1HG5 A;  4MS6 A;  3KEZ A;  3S8Q A;  3G7D A;  3FTZ A;  2LYQ A;  3Q4A B;  3S7J A;  4LCT A;  1WY6 A;  4KVO A;  3Q15 A;  3RZZ A;  1EFA A;  1HZ4 A;  4I43 A;  4UWH A;  1OCT C;  2KPJ A;  4JHJ A;  4J8F A;  4PS7 A;  2R1J L;  5AEN A;  3HZI B;  1EYH A;  2IOS A;  3GZ2 A;  4GCN A;  2BJC A;  3IBE A;  1QP0 A;  1DWK A;  4KXK B;  3UT8 A;  3ZYK A;  1QQA A;  3CHS A;  4JQD A;  2ICP A;  4A3T A;  1UW4 B;  1X57 A;  2J4B A;  3PNT B;  1IHG A;  4WNE A;  4HOR A;  4Q96 A;  2FJR A;  4U0Z A;  2OVB A;  2QY7 A;  1TJC A;  4RSY A;  3FTX A;  4JVS A;  3CK9 A;  2PUE A;  5FZR A;  1IQU A;  2AWI A;  3I3N A;  4ANV A;  2I2O A;  3JQ0 A;  1BDI A;  3CK7 A;  4GQM A;  2BNO A;  3D9L A;  3MX3 A;  3RIB A;  3ZXS A;  5KJK A;  2WXQ A;  4HFG A;  5FWQ A;  4EZL A;  2YIN A;  2IOL A;  5T3R A;  3PNL B;  5ARG A;  4APF A;  2FI7 A;  3UT4 A;  2HM8 A;  4FJZ A;  1UXC A;  1W3B A;  4GYY A;  1QP4 A;  3BG0 B;  1PAQ A;  4JCY A;  2FO7 A;  3QDN A;  3BEE A;  3CGH A;  1ZVV A;  4U04 A;  5CMW A;  3OTN A;  1Z3Y A;  4ANW A;  4BX9 A;  4X4F A;  2C0L A;  2LNI A;  3D9K A;  4YG7 B;  3CVP A;  3QK0 A;  4YAR A;  5HI7 A;  1UN9 A;  3I4R B;  2EF8 A;  1E8Z A;  1PC2 A;  4BSX A;  3D9O A;  3RK6 A;  3FTV A;  2WPV A;  1X2L A;  2OFY A;  5JJ7 A;  3KD7 A;  5FZQ A;  3D9M A;  3CHO A;  3FUF A;  2O49 A;  1MHQ A;  3CHR A;  1HX8 A;  2CHW A;  2WXO A;  3FTW A;  3FH7 A;  3R7R A;  4CRW A;  5HQ8 A;  1RZS A;  4H7Y A;  3U3W A;  2QFC A;  3EIQ C;  4F8D A;  4WWO A;  4GZC A;  3IHV A;  2NC9 A;  2X6J A;  5JHB A;  3SHF A;  2HSG A;  2EQX A;  1OWM A;  2BNM A;  2WUS R;  3QWV A;  4E85 A;  2E2E A;  1E3O C;  2WXN A;  2OOE A;  3S7D A;  2XCC A;  3NF1 A;  2A4Z A;  4FLB A;  3OQO A;  5FQ4 A;  2VSO E;  2PPX A;  2WXP A;  3KS2 A;  1PRV A;  2XPY A;  3UMV A;  1HFA A;  4TRQ A;  2J09 A;  4DPR A;  3APC A;  2WXR A;  3D9P A;  1VDY A;  4DLO A;  5LCW J;  2CG3 A;  3GN5 B;  3CHQ A;  4UWG A;  3ULQ A;  4Y42 A;  2R17 C;  3ZYM A;  4GML A;  4JL0 A;  4BTA A;  4I17 A;  4PU4 C;  1LCC A;  4UWK A;  1ZAY A;  3CST A;  3OQN A;  2UWJ G;  4Z5D A;  4O6F A;  2WXG A;  1CQT A;  2VYI A;  5EX0 A;  3I4G A;  3UT7 A;  3JUI A;  1U3C A;  4MKT A;  4IYP A;  4JA9 A;  1N54 A;  3EHM A;  3FYM A;  1GT0 C;  3TXM A;  3QF3 A;  3S7F A;  3G5G A;  3KJX A;  2VGY A;  2XCB A;  4KYO B;  4AP2 A;  4B94 A;  4PU8 A;  1OSL A;  4PH4 B;  1JPL A;  3CVN A;  3SI5 A;  1HF8 A;  1H0A A;  4YG1 A;  4UI9 J;  3PS6 A;  3FUK A;  4IN3 B;  4IVZ A;  2KEK A;  2L0T B;  1U3D A;  1PRA A;  3O9X A;  1QQE A;  2Y3A A;  4EQF A;  3G2T A;  1E7U A;  2ICT A;  4N3C A;  5T4Y A;  3FU3 A;  2UY1 A;  4WND A;  1L1M A;  5G04 C;  1ELW A;  5C2Y A;  3FU6 A;  5CMY A;  5FT9 A;  1B89 A;  1ZZB A;  1CJG A;  4APO A;  2NXP A;  3EHN A;  1P5Q A;  4JHR A;  5D0O D;  3E4B A;  5AJD A;  3T8M A;  3H5T A;  2KC7 A;  2WXM A;  3NZS A;  2L0I A;  4V3I A;  2PM6 A;  3LY7 A;  5G05 C;  4CT4 A;  5FJY A;  3FWV A;  3FTS A;  4B89 A;  2IVQ A;  2X38 A;  1ZZ8 A;  4NDW A;  2XSD C;  4X4D A;  4I6T A;  2X6I A;  4FC8 A;  2YNQ A;  3L17 A;  3MZL B;  4PS3 A;  1JWF A;  3PVL A;  4HXI A;  4PS8 A;  1YSE A;  3IKO B;  3MV3 B;  2X6K A;  3Q49 B;  5J08 A;  2BNN A;  4FHJ A;  3B7S A;  4PDX A;  2VQ2 A;  3CEQ A;  2EBY A;  1ZBP A;  3FP3 A;  4DK5 A;  4HVB A;  5G2N A;  4GCO A;  3ASH A;  1IQR A;  2DCP A;  2IUO A;  2WVI A;  2CRO A;  3QJZ A;  3FTY A;  1LLI A;  1QZ2 A;  3NZU A;  2KCK A;  2FEZ A;  2MQK A;  4G11 A;  3LS8 A;  1LCD A;  4GZ3 A;  4XIF A;  1XWR A;  2IVB A;  2XEV A;  4JW1 A;  3TAX A;  2EWT A;  1KT1 A;  3QB2 A;  1E7V A;  2XGO A;  1UG3 A;  2V5F A;  3DNV B;  3CR3 A;  3APD A;  2VTB B;  4X4E A;  3DBS A;  4LRZ A;  5LOZ A;  2XIU A;  4BTB A;  3CVY A;  4CEM A;  4U0U A;  4WWP A;  5FQ6 A;  4GPK A;  2BTD A;  4L1B A;  4R7L A;  2GRM A;  2PQN A;  3PRE A;  4OVV A;  3FH5 A;  3SGH A;  4J8E A;  3GBF A;  4EZJ A;  1UTX A;  2IFU A;  4XX5 A;  4A3V A;  3IEG A;  1JWG A;  4CDN A;  4FN3 A;  2J08 A;  3T5X A;  3D9I A;  3U66 A;  3PUJ A;  4CT0 A;  3OXG A;  4L7T A;  4F7A A;  1EF1 C;  3QWP A;  3U4T A;  3SCH A;  3IV0 A;  4EEC A;  2WXF A;  4UQY A;  3ZHE B;  4JA7 A;  3D3M A;  3GYZ A;  2PUF A;  3D9N A;  2LYK A;  3HDX A;  4NUR A;  5BW8 C;  4CGV A;  5EKQ D;  1KLX A;  3CHP A;  4FBI A;  2DIW A;  4RVB A;  5LFA A;  4XKB A;  1Y9Q A;  3R1F A;  1HU3 A;  2WXI A;  4G1T A;  1JH9 A;  4G2V A;  2NSZ A;  2OND A;  2PUD A;  3FTU A;  4JPS A;  1FCH A;  3QAR A;  4AVX A;  5EDS A;  5BV1 A;  3LJ3 A;  2IJG X;  3AU5 A;  2R59 A;  5KJM A;  2XRY A;  2PUG A;  2IV1 A;  4LEU A;  2PUC A;  4YBA A;  2I1J A;  1SZA A;  3QNK A;  2BF0 X;  3VLE A;  1LF8 A;  1A17 A;  5C1D A;  3CVW A;  1MQS A;  1WIZ A;  2KCL A;  2PE5 A;  4IWR A;  1OWO A;  1JUQ A;  4I6R A;  4J8D A;  3CKB A;  4URK A;  4Z58 A;  2YHE A;  3F6W A;  3RO2 A;  3AU4 A;  3I5P A;  3EDT B;  3ESK A;  2CHZ A;  4DI3 A;  4L23 A;  2LO6 A;  2OR1 L;  3MGB A;  3CVX A;  3SBS A;  2XPI A;  3RJV A;  2HIN A;  1HO8 A;  4F1S A;  3BS3 A;  4XE0 A;  4FLH A;  1ZS4 A;  1NA0 A;  2DBA A;  2KM4 A;  2L8N A;  3O4Z A;  4XI9 A;  3VLD A;  4E6H A;  3RRM B;  5KJN A;  2LYJ A;  2IVG A;  3CRO L;  2CFZ A;  2XCJ A;  2PM7 A;  3FY4 A;  3LY9 A;  1R63 A;  2P58 C;  3UQ3 A;  3JQ1 A;  3CIA A;  2IF4 A;  3GN5 A;  3JXC L;  4WNG A;  3CQG B;  4B8A A;  4BT9 A;  4EPZ A;  5DBK A;  4ILG A;  2YQ8 A;  4ILH B;  3ZYQ A;  1IYG A;  4RG6 A;  2E0I A;  4UWL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...