2AXVA

Structure of prgx y153c mutant
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
302
structure length
302
Chain Sequence
FKIGSVLKQIRQELNYHQIDLYSGIMSKSVYIKVEADSRPISVEELSKFSERLGVNFFEILNRAGMNTKSVNETGKEKLLISKIFTNPDLFDKNFQRIEPKRLTSLQYFSIYLGYISIAHHYNIEVPTFNKTITSDLKHLYDKRTTFFGIDCEIVSNLLNVLPYEEVSSIIKPMYPIVDSFGKDYDLTIQTVLKNALTISIMNRNLKEAQYYINQFEHLKTIKNISINGYYDLEINYLKQIYQFLTDKNIDSYLNAVNIINIFKIIGKEDIHRSLVEELTKISAKEKFTPPKEVTMYYENYV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of peptide sex pheromone receptor PrgX and PrgX/pheromone complexes and regulation of conjugation in Enterococcus faecalis.
pubmed doi rcsb
source organism Enterococcus faecalis
molecule tags Transcription
molecule keywords PrgX
total genus 118
structure length 302
sequence length 302
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01381 HTH_3 Helix-turn-helix
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 2axvA01
1.25.40.400 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2axvA02
3KZ3A 1ZZ6A 2KPJA 4I6RA 2WIUB 1UXDA 3OP9A 4NDWA 4PU7A 3GN5A 3G7DA 5A7LA 3KXAA 1ZZBA 3B7HA 4Z58A 4X4HA 1CQTA 3TRBA 3JXDL 3F52A 3HZIB 3EUSA 3QQ6A 4YG1A 3D1NI 2LYPA 1LQCA 1UTXA 1ADRA 3OQNA 1PNRA 2BNNA 3PXPA 1JWLA 1NERA 1AU7A 2GRMA 4PU4C 1BDIA 1PRVA 2IUOA 2LYQA 1DWKA 3BS3A 1ZVVA 1X2LA 2CROA 4I8TA 4IWRA 2L8NA 2O38A 2PPXA 3QF3A 4O8BA 4FBIA 4X4GA 3JXCL 2EBYA 1PERL 3FYMA 1YSEA 2XSDC 4MCXA 2EF8A 2WUSR 2AXVA 3G5GA 1E3OC 2PUDA 2XJ3A 3QWGA 4J1XA 2PUCA 2JCGA 1CJGA 1Y9QA 1JFTA 4X4BA 4Y42A 1ZZ8A 4X4IA 2B5AA 3LFPA 1ZPQA 1ZZ9A 2CSFA 2LYLA 4J1WA 4Z5CA 4YG7B 1IC8A 1JFSA 1LLIA 2LYRA 2H8RA 2R63A 1WIZA 2HINA 1S7EA 2D5VA 3L1PA 1QQAA 1UXCA 1R69A 3H5TA 2LYSA 2A6CA 1LMB3 4Z59A 2AW6A 2AXUA 2IV1A 4IA8A 3RZZA 4JCXA 2OFYA 2AWIA 4FN3A 1HF0A 5K98B 2AUWA 1DW9A 2PUGA 2PE5A 2OR1L 4JQDA 2PUBA 2GRLA 4YG4A 4IVZA 4X4EA 1ZZCA 3SCFA 3GN5B 2BNOA 1NEQA 3S8QA 1WETA 1QP0A 4F8DA 3FMYA 1RZSA 1O4XA 4JCYA 2KEKA 2MQKA 3F51A 4I6UA 4I6TA 1RZRA 3DNVB 1POUA 4YBAA 3KJXA 3QYXA 1R63A 3OQOA 2LCVA 4YARA 3F6WA 2PUEA 1WH6A 3CECA 2IU7A 1OSLA 1LCCA 3BD1A 3R1FA 3SCGA 1B0NA 1Y7YA 1RZRD 3FYAA 1RIOA 3U3WA 2KEJA 1ZUGA 2XIUA 4X4CA 2BNMA 2MEZA 1XWRA 1X57A 3OMTA 4Z5HA 2FJRA 2ICTA 1RPEL 1JH9A 2JVLA 4X4DA 4MCTA 2R1JL 2O49A 2IVBA 2EWTA 4Z5DA 1SQ8A 2KZ8A 2GZUA 3JXBC 2LYKA 1WH8A 3CROL 3ZKCA 2KEIA 1PRAA 3LISA 2PIJA 3GBFA 1LCDA 2ICPA 1ZAYA 1PRUA 2AXZA 3IVPA 3O9XA 2LYJA 2XI8A 1VPWA 2IVGA 4GHJA 1L1MA 1QP4A 1BDHA 4GQMA 4X4FA 2BJCA 2XCJA 2L49A 3VK0A 1GT0C 2PUAA 3UFDA 2HSGA 4OB4A 1EFAA 1OCTC 2IVQA 1QP7A 1QPZA 3SCHA 3OQMA 3CLCA 2PUFA 2O4AA 3MLFA 4PU3C 1ZS4A 1QQBA 3BDNA 3ZHMA 1ZZ7A 4PU8A 3ZHIA
chains in the Genus database with same CATH superfamily
2YHEA 3IHYA 2WIUB 4PU7A 4W9RA 3TWXA 3C5RA 4OYSA 4O1OA 3E34A 3NBNB 3L17A 1N4PA 4OBMA 4TUUA 2B0OE 5ENQD 4PU4C 3PREA 1S70B 4GYWA 1ZBPA 4AEZC 1KZOA 2LNIA 3DSVA 4Q69A 3OXFA 1PERL 3ULEG 2I9CA 4UWFA 4WNDA 2WUSR 1E3OC 2AXVA 3D9PA 2PUDA 3EIQC 3ZXSA 3GYZA 5CCMA 2JCGA 1E8WA 3ZPJA 1Y9QA 3QFIA 1K8KG 3NF1A 1Z3YA 3ULQA 1LLIA 3MYVA 4U8YD 3VLDA 4GMRA 5HS0A 2VSNA 3C3QA 3MZLB 3RZZA 1OY3D 5BXUA 4F1SA 1DW9A 2F0YA 3ASDA 1NEQA 3S8QA 3Q4AB 2WXNA 1O4XA 3ZYQA 3VLEA 3LKUA 2DCPA 3F51A 3AG2E 2WPVA 4UWLA 5EYLA 3QYXA 4XEIG 5ITZF 3JXJA 3ZNGA 1FPPA 4EBAA 4X8QA 4I6JA 4RVBA 5BV1A 1ZUGA 1OWOA 3V2OA 2BNMA 3FUDA 2MEZA 2X6JA 3A9YA 2IF4A 2WQ6A 2WXIA 2XGOA 1OWLA 3D9NA 3Q75A 5JJTA 3NDBB 1EF1C 1WH8A 1O1RA 3RO2A 4HVBA 2PM6A 2HR2A 5KWDA 1LCDA 2R03A 4GYOA 2L49A 3VK0A 3MV2B 3T9KA 1MHQA 1TJCA 3CR3A 1D9SA 4XKCA 5KJLA 5J90A 3IBEA 4WAFA 3NZUA 1NI1A 2PQRA 3ASHA 5DTQA 4TXQA 2VGXB 3GZDA 1ELWA 4PS3A 3KZ3A 3FTWA 4GZDA 2DZOA 3RU0A 3VTYA 1P5QA 2LAIA 1HO8A 3ZW3A 1N4SA 2LAHA 3FTUA 3SR4A 2Y4TA 3S7BA 2QFCA 4I9EA 3I3NA 4FBIA 4O8BA 1H2VC 2J49A 2L6BA 3CSTA 3SD5A 1EDUA 1SA4A 1ELRA 1ZZ8A 3B7UX 2B5AA 4CCAA 2LYLA 4MKTA 5ARGA 3H5TA 3IV0A 4GTVA 4Z59A 3G2WA 1KT0A 4U96D 3L54A 4HNAD 1UJKA 4GTPA 2PUBA 2JQEA 2XXAA 3CHPA 4AP2A 1E7VA 4EKGA 2MQKA 5AQ9A 1MZCA 3R9MA 1RZRA 1HU3A 3NZLA 2OV8A 3PVLA 5CEDB 2P2CP 4C0EA 5CERB 4G11A 1D8DA 2IEJA 1IHGA 2Y69E 3NROA 3UMVA 5G2NA 3Q5MA 3ASFA 4GZ3A 2DVWA 4G8LA 3UT8A 1S64A 2LYKA 3OKZA 2KEIA 3FH5A 2PIJA 3D9HA 4U8VD 1YMPA 1PRUA 2J8SD 2IVGA 5LFAA 5KNHD 5CHEE 5EN5D 2IVQA 3CLCA 5LP0A 2XZTG 1TR4A 4I2ZA 2R5SA 5A7DB 1W3BA 2QYJA 4JL0A 3B13A 4HB5A 5HQ8A 5G55A 3TRBA 3KL4A 5CBOA 3QQ6A 1DNPA 3FU0A 3ZU7B 4PDXA 1OCRE 4C0MA 3CV0A 1N4QA 1OCZE 3BS3A 3TAXA 4HRLA 3DPDA 2XEHA 5H7PA 3UM2A 2X3MA 4GZCA 3RO3A 2WB2A 5CBNA 4YG7B 4AY5A 3DSTA 3G2SA 1BPOA 4KVMA 4M3OA 1HS6A 3NXHA 4I9CA 4JCXA 3JQ1A 2OOEA 2XGMA 4HQDA 3CHRA 2XRZA 4ME2A 1VDYA 3DEOA 3CHSA 4ABNA 1Z5SC 5CMWA 2PXVA 3ZN3A 3CVQA 4XI0A 4JPSA 1RZSA 4LG6A 4JXTA 4AVXA 2Y1LE 3IKOB 1Z3XA 4N5QA 4U8HA 2ODRD 3CVWA 3HXDA 2P9IG 3LY9A 4MS6A 1BU9A 4PH4B 2DYSE 1MYOA 2H6FA 2LSVA 1MFQC 3SI5A 3Q73A 3X2QE 4ER0A 1UN9A 2A5UA 4RSYA 4XKBA 3IVPA 3QOWA 2H6HA 4LUNU 2KCLA 2M4HA 2LNMA 4MLPA 3UM3A 1TJFA 2RFAA 1HZ4A 2C2LA 2LO6A 1D8EA 3Q9NC 3EU9A 3HHMA 4ZHBA 4I1AA 2HYZA 2VGXA 1U3CA 3MKQA 5D0QD 3CVPA 3HXCA 4TXRA 3FDHA 1ADRA 2EINE 3J5PA 4FADA 3R09A 1Z6TA 1TN8A 3LQXA 1AU7A 3UIPC 4GMJA 3DPYA 1PRVA 2I1KA 2IOSA 4CYMD 5FZSA 3DXKG 4JA9A 3JQ0A 1JUQA 3PE4A 3QAQA 2XSDC 3L9TA 4MCXA 2WXKA 4J1XA 1K1AA 4F3VA 4JW1A 3C98A 2AJAA 3GZ1A 5D66A 4AOFA 5G05C 1ZB1A 4CDRA 1MJ0A 4GYYA 4FLHA 1XNFA 4IA8A 3DWLG 2LSUA 4DLOA 5K98B 4KMOA 3B7TA 1MQSA 2PE5A 4OVUA 1JPLA 4CT0A 4CZ2D 5BXOA 4CGVA 2J4BA 2VGEA 5AN8A 3FMYA 5M72A 3QWVA 2ETCA 5ENOD 4CT4A 5DT2A 3PDNA 3F6WA 3APDA 2EIKE 2L0TB 5T3RA 4ZFHA 2KEJA 3APCA 2XIUA 5B1AE 1XWRA 3EJNA 4A55A 3OMTA 5AAOA 2O49A 1O1SA 5JUWA 4YDEA 3CROL 3ZHEB 4J0UA 3B7BA 2M63A 2EIJE 3CQCB 1VPWA 5EX3A 4DE8A 4RG6A 2CHWA 3FUKA 3PNLB 1TEZA 3KAEA 3QK0A 3CGHA 4WWPA 5A23A 3TL5A 2C0MA 3ZHIA 3AS4A 4BT8A 1HG5A 2I1JA 3TXNA 2RD0A 3F52A 3FUIA 1S63A 5AJDA 4YG1A 1GW6A 4K0RA 2ILRA 2V5FA 3HXFA 3FHEA 4O6FA 1H0AA 2X6IA 2WXOA 2LYQA 2FFHA 4TUMA 3FTZA 4UQZA 5D2MC 3ZPXA 5FQ4A 2DZNA 4ER7A 2MYOA 3JUEA 5JMND 1ZZ9A 4WWOA 4K5AB 3MKQB 2HINA 1IHBA 4ANVA 1NP7A 1UXCA 4ILGA 2HE0A 1A17A 2LYSA 2OCCE 2FO7A 1HF0A 2RFMA 4U0ZA 4X4EA 1WETA 3CLJA 4RLYA 4P29A 5AARA 1N0QA 2I6HA 2A4ZA 4GMLA 4YVOA 1LCCA 2VQ2A 2BF0X 1RZRD 1N54A 3I5PA 4FHKA 1ZU2A 4F7AA 5LCWC 3PS6A 4CDMA 3VWSA 2R1JL 4BWRA 1SQ8A 3IEGA 2XPZA 3ESLA 2PNNA 2F8YA 5KCMA 2V5QC 3TG4A 4DK5A 2KM4A 2PUAA 4GQMA 5JHBA 3S2AA 1OCTC 3LYAA 5FIOA 3DXMG 4PU3C 3PUKA 2WXLA 3OWQA 2J7UA 4RQIA 4ACLA 3B7HA 4Z58A 2FI7A 4U04A 4EBAG 3P1UA 4A3VA 4K03A 4DX1A 1BI7B 2PXEA 2X6KA 3OQNA 3KEZA 1TNZA 5C1DA 1DWKA 4HRNA 3TFLA 3AS8A 5LCWJ 1SZAA 4EECA 3EHNA 5G04C 4HXIA 1G3NB 2EBYA 2PXDA 3L08A 2P9UG 1B89A 3Q9UC 3VLFA 4J1WA 2PXKA 2OVFA 4N39A 3M9LA 3O4ZA 1L5JA 1NA3A 3QARA 5FQ8A 2J7WA 2KXPC 4WVLA 3ZYMA 5EIBE 5DBKA 4ILHB 4EZLA 2VSYA 3HIZA 4XI9A 3ASNE 2WQHA 4JEUA 1V54E 2GROB 2BKKB 3HDXA 1R63A 2LCVA 3Q7AA 2IU7A 1JCQA 4GTSA 3PE5A 3R1FA 2ZGGA 5GAGi 2PXQA 3LXUX 1FT1A 2X6FA 2JVLA 4HOQA 4MCTA 4HFGA 3LY8A 3QWPA 3PRZA 3JXBC 4WNFA 3SGHA 3QOXA 2ONDA 2WM9A 3Q15A 5E75A 1FT2A 1TN7A 5CMYA 3D9IA 4X4FA 3D9OA 3DSWA 4OB4A 2J08A 2WXQA 3D9MA 1E96B 4QFVA 1H6PA 3K9IA 3BDNA 5ENTD 4LSZE 4G26A 4EZIA 3LVQE 4BSZB 4TRQA 2CFUA 2Y4UA 4JB8P 4F53A 3FU3A 1NERA 3UKRG 3DSSA 3MGBA 2XXPA 2FULA 1QQEA 5A6CA 3L22A 2CROA 4U0UA 3LDZA 2OVBA 4BY6A 5T8IA 4JA7A 4HS2A 4FU3A 4FLBA 2GRNB 2CSFA 2C0LA 2H8RA 2HM8A 3SFYA 3DSXA 3HG0D 4EQZA 2V8SE 3NZSA 4J8DA 2NXPA 2AW6A 2IV1A 1IKND 3TELA 5ENNA 4UI9C 3FUFA 2VSOE 2WQ7A 2NYJA 5BUZA 1E8ZA 2FF4A 1E8XA 3CECA 1PC2A 1E7UA 5ENSD 5BV0A 1N4RA 4LEUA 2JABA 3AAAC 3A9XA 4B89A 3SF4A 3LJ3A 4Z5HA 1YYHA 3SHFA 4HLLA 1E8YA 2H6GA 3AU4A 3MKRA 1OUVA 5FWQA 5AJLA 2V4LA 4I6EA 4C9BB 1TNBA 3SBTB 3ASOE 3FULA 3TWQA 4PU8A 4DX2A 3CVXA 1CQTA 4EK9A 3TGOA 2E2EA 3EUSA 2VYIA 3EDTB 5CCLA 3D1NI 4AJWA 2XPIA 3ISMC 2XEEA 2R59A 3GZDC 3CVYA 2L6JA 1X2LA 4GCOA 5ANRA 4KZCA 4GTMA 3QWGA 3PH0C 2WXHA 2DYRE 4DE9A 3QC1A 4J6IA 3D3MA 2KCVA 3FEXA 2XCBA 3PZDA 2AUWA 4L7TA 3B7SA 2GRLA 3W9GA 4F6RD 4WNEA 3JCKC 3HVEB 4F8DA 4A63B 5LOZA 3QB2A 1MX4A 2R17C 2PXBA 5BPPA 3SQVA 4UQXA 3E4BA 3BD1A 2GRRB 3FYAA 4KT6B 3R9AB 1DCEA 2QY7A 4K5CA 4BX8A 3EHQA 1UG3A 3QKYA 1IQUA 3JYSA 2GZUA 1HFAA 3ESKA 1MX6A 3L16A 2X38A 4TXPA 2ZIRA 1BD8A 2XGSA 4LNUD 1TNYA 5BNWA 3CKBA 2WXPA 1A5EA 1QNFA 3OQMA 2R2LA 3QOUA 4EHMA 2KATA 1ZZ7A 2WMNA 2JEKA 2ZISA 4V3IA 3R7QA 4I6RA 2VTBA 3OP9A 2XENA 3NAWA 2R05A 1DULA 2P58C 1WM5A 4I1MA 3Q49B 3KSLA 2P9NG 4NACA 3RIBA 5AQBA 2CG3A 2HCNA 1PNRA 2PXUA 3S7FA 3DBSA 1JCSA 3ABLE 3ML9A 3SNXA 2DBAA 4I8TA 2F8XK 4IWRA 2PPXA 1WAO1 3RRUA 5CEAA 4B93B 4U95D 3ZEFA 1H2TC 4Z5CA 1JFSA 5BT1A 3UPVA 1IC8A 1WIZA 4GPMA 3Q78A 3UUXA 2LXMA 4APOA 4A3TA 4HRMB 4D10C 1BLXB 4IRUA 5AQAA 5DTMA 3DM5A 1TYQG 2WXJA 5JJ7A 1UOHA 4JCYA 4URKA 4Z68A 3FTXA 3ZKJA 2WXRA 2DWZA 4XX5A 1WH6A 3C72A 3TWUA 3CKCA 2F37A 4J8EA 5EILA 3SZ7A 4GPKA 1X57A 4QQIA 1JH9A 4X4DA 3BUAA 4LCTA 2IVBA 2EWTA 2J09A 5KBAA 3SY2A 2J07A 4GB9A 3R7RA 3EUVA 2LYJA 4ILIA 4G2VA 4MBGA 1H2UA 4Q96A 4FHJA 3C3RA 3CHQA 1QYMA 3FTSA 1OWMA 4HORA 4BX9A 1QPZA 3G2TA 2GRPB 3FFLA 3I4RB 3VTXA 2P9LG 1XGWA 1N0RA 3GW4A 4FC8A 2JLBA 4E6HA 4B0ZA 3BQOA 4GCNA 4H7XA 1UW4B 1LQCA 5HI7A 1UTXA 3U66A 2BUGA 3EHRA 4GU5A 1BDIA 2IUOA 3UM0A 1DCQA 3WG7E 3ML8A 4G25A 4IYPA 3QF3A 2LLWA 1YSEA 1HQ1A 2A5EA 2MHKA 3CEQA 4LERA 5J08A 1INZA 5KJNA 1N11A 1O5MA 1IXVA 3UT7A 3CVLA 1JFTA 2UY1B 3LCAA 2BTDA 2P9SG 4ATGA 4BETA 4JQDA 1X5BA 4UI9J 3PZ2A 3NOGD 2KEKA 4GZ6A 3MV3B 4R7LA 4U7EB 3DEPA 2WVIA 5EIDA 1OSLA 3B95A 4ER6A 4UUCA 4JEHA 1SQMA 1PAQA 4PS7A 2J9QA 1K1BA 5G04J 4DUIA 2BKGA 2B6CA 2KZ8A 2PQNA 2MOWA 3TXMA 1SW6A 2NC9A 5IY5E 1DVPA 3ZRHA 3UFDA 2XZDG 2HSGA 4BSXA 2RG8A 4I6GA 2PUFA 4APFA 3N71A 4NQ0A 5FJYA 4F1PA 5B1BE 3LS8A 1ZZ6A 2KPJA 2FBNA 1UXDA 3J5QB 3GN5A 3SBSA 5EDSA 3KXAA 1N52A 3APFA 3HZIB 4DI3A 2ZU6B 3AG3E 2LUHA 4YVQC 2PXTA 3LY7A 5FZQA 2PZIA 2OEVA 1Y6IA 2YINA 2O38A 3UXGA 4X4GA 2IOLA 2PL2A 3MA5A 2EF8A 4C48B 1MX2A 2PUCA 2VSXE 4Y42A 3HRAA 2IFUA 3FUEA 3TWTA 2NSZA 2LYRA 3Q47B 1Q2ZA 1S7EA 1QQAA 3NOCD 2XEVA 1AWCB 4JD2G 5DIZA 1KLXA 2QC9A 4ANWA 1S0PA 2EQXA 4O60A 5DRYA 3AS5A 2OR1L 3ZXPA 3PNTB 2GRQB 3E32A 1H6OA 3QDNA 4OAUC 4I6UA 1NA0A 4I6TA 4HOTA 5HKPA 1U3DA 3L13A 3GZCA 3OQOA 1RZ4A 2IO3C 5EX0A 2CHXA 3NB2A 4DRXE 4LNBA 4ANUA 3ZUVB 2IONA 3QJZA 5FQ7A 1QBQA 2PM7A 5AENA 1NW3A 2XQ0A 4GA2A 1NZNA 2H6IA 4WWNA 3PEVB 4Z5DA 4HBDA 3CHOA 4EPZA 3CVVA 3ZKCA 3LISA 4H7YA 1HF8A 3O9XA 1OXJA 3FTYA 4YDWA 1OT8A 2E0IA 2XCJA 4ER5A 4Y6WA 4E85A 3BEEA 1EFAA 2V0PA 1HXIA 4FJYA 1X81A 3UM1A 1ZS4A 2EIME 5A7LA 1KPSB 4GZ5A 1BI8B 4J7WA 3CVUA 5GAHi 3D9LA 4EZJA 1OWNA 3FWVA 4CGWA 1JWLA 2L9BA 1N94A 4J8YA 5JA4D 1PY1A 1SZ9A 3URZA 5KJKA 4AY6A 3QWWA 4BT9A 2L8NA 3HXBA 3JXCL 3PZ3A 3IHVA 4PUCA 4KBQA 2XS1A 3HVEA 2XRYA 3GUUA 3PZ4A 4L1BA 3LFPA 1ZPQA 3ONKA 3V2XA 4WUYA 2R63A 2MRIA 3L1PA 4FJZA 2DIWA 1LMB3 5C2YA 1N9AA 1YA0A 3OTNA 1FVFA 3E30A 3V30A 1ZZCA 4EKIA 1QP0A 5B3SE 3ZGQA 4FP7A 1JCRA 5FINA 3DNVB 3CSFA 1OCCE 4YDOA 1H19A 1HE8A 2Y3AA 1RIOA 4J8SA 3Q79A 2HO1A 3MEKA 1O1TA 3FEYA 4N3CA 2FJRA 4BFRA 5CECB 2BEDA 2ICPA 5FT9A 1H6KA 2AXZA 4M7CA 2XXQA 4DPRA 4GTQA 3RRNB 3AU5A 4B8AA 4IULA 5DTRA 4U0SA 3TG5A 4N3BA 3UT4A 4UQYA 1QQBA 3V31A 2CFZA 1ZAYA 4NDWA 4U07A 4JHJA 2YBDA 1SVXA 3TJPA 3ZYLA 5EYPF 5KNGA 3CK9A 4ANXA 4JHRA 3ZIMA 4TV3A 2Q7FA 3ZVVA 3ONLA 4A1SA 3FYMA 2LLVA 5ANLA 4X4IA 3RK6A 2HFZA 3CVNA 3RKVA 3FU5A 5G05J 1KT1A 1R69A 4HI8A 3EHMA 3OXLA 2GGFA 4ATZD 2AWIA 1JWGA 3L82A 2CHZA 2PUGA 1TN6A 3DSUA 2WXFA 3C3OA 3SCFA 2I2OA 2BNOA 1QZ2A 2VTBB 4CRWA 4I17A 4LNGA 4FULA 1POUA 4YNDA 2PUEA 2CG2A 5ENPD 5JHAA 4DX5D 3PUJA 3ZYKA 1WY6A 1YCSB 4HLEA 3IXEA 4MRUA 2ICTA 2KZTB 3TWWA 1DC2A 2RKKA 5FZRA 3GBFA 2UY1A 3KEAA 4N2SA 3SX0A 5DSXA 3O48A 4BEPA 4KYOB 3BU8A 4GHJA 4UWGA 1QP4A 2BJCA 1Y8MA 3S7JA 3T5XA 2PXPA 2XPYA 3B7RL 2UWJG 4GAAA 1TNOA 4GTRA 3ULYA 5CRVA 4L23A 4EQFA 4G24A 3U9WA 1JWFA 2MXDA 2ETAA 4G8KA 4NIKA 1EPUA 3TWRA 3LEWA 1EYHA 3FUJA 2GRMA 2VJ8A 3CQGB 4DX6D 1LF8A 1WG0A 3I4GA 3FU6A 3T5VA 3CHMA 1QB2A 1QZXA 4U63A 4GA0A 1WDYA 1N95A 3E37A 2YQ8A 2V3CC 5LX8A 3GZ2A 4B8CB 3LPZA 3D9KA 4G1TA 3ABME 4DJAA 5AYWD 3NQPA 2ZXWE 3GN5B 3U64A 1UJJA 4B94A 3OAWA 3OXGA 3DRAA 1HG2A 3PZ1A 4UWHA 3D9JA 4EZKA 1OCOE 4L2LA 4DX7D 3FTVA 4IN3B 4J8FA 1TNUA 3JXIA 3UIOC 2L1PA 4Y6CA 4Q94A 1OWPA 3AG1E 4I43A 2P9KG 1U2VG 3TWVA 3ZHEA 4NRHB 2IQCA 5ARFA 2KZTA 3G0TA 3CK7A 2VEOA 4KVOA 5CRUA 1IQRA 3FUNA 1RW2A 1BDHA 1GT0C 3RAUA 3F6QA 3AJIA 2YHCA 2O4AA 3CIAA 3V79K 3BG1B 4N2QA 3FH7A 5FTPA 3ZHMA 2YNQA 4L9PA 4PS8A 4XZ4A 1LD7A 3MCXA 4O1PA 2QZAA 3FP3A 3G7DA 3U4TA 2LXLA 5FQ6A 4KXKB 3G2VA 3PE3A 5ENRD 2BNNA 3PXPA 1KZPA 2XS8A 1HX8A 1ZVVA 2IY0C 3RJVA 2WMOA 1FCHA 4DI4A 4I2WA 2J4DA 4AM9A 4HOUA 4A1GA 2XJ3A 2IJGX 4HRAA 1IYGA 3EIJA 1CJGA 3ME5A 3FY4A 5D0OD 2EILE 4JC8A 2WXMA 2XCCA 2VGYA 5DRTA 4YDYA 2AXUA 4FN3A 3LVRE 2KCKA 4K5BA 4YG4A 4IVZA 3E33A 2IO2C 3T8MA 4CEMA 3FUHA 3FUMA 3GZSA 3UWPA 2P9PG 3MX3A 4CDNA 4YARA 3PEUB 5BW8C 1UN8A 4BTAA 4BERA 1Y7YA 4LRZA 4N3AA 2PXLA 4RG9A 3MEJA 4X4CA 3UQ3A 2WXGA 2Y0BG 3BG0B 3P2BA 5EKQD 3ENEA 1LTXA 4ER3A 4Q2JA 1ELKA 3SO8A 2KC7A 3RSEG 3UI2A 1L1MA 5T4YA 4DLQA 2GW1A 4OVVA 1QP7A 2X6HA 2IU1A 3ABKE 3MLFA 3Q7FA 1NL4A 2R02A 4UWKA 4GTTA 1ZZBA 4X4HA 3JXDL 4XIFA 2KBXA 4JHKA 2LYPA 3MJWA 4BTBA 4AV7A 4ACKA 5E76A 3A9ZA 3EU5A 4KZ0A 4XE0A 5AIJA 1U2ZA 3T8KA 1K3ZD 4UI9K 3FH8A 3G5GA 4AIFA 4OAVB 4X4BA 3SFXA 3TEPA 3KD7A 5KJMA 4G23A 2D5VA 2A6CA 3S7DA 3UTMA 3JUIA 5JJ6A 2OFYA 1FVHA 3QNKA 2FO1E 2V4HC 5AQ7A 4GTOA 5HRYA 3HYMB 3TWSA 4N5CA 4FA6A 3AG4E 1E90A 3CK8A 3L6AA 1AP7A 3UINC 4JVSA 4WNGA 4YBAA 3UX4A 3KJXA 2OEWA 2FEZA 3ZFWA 3HXEA 4HI9A 2AVPA 4I1OB 3KSQA 3SCGA 1B0NA 3U3WA 4HOSA 1NFIE 2XHEA 3G2UA 3W9FA 3RRMB 1RPEL 2QYUA 4NURA 3ASGA 2ETBA 1PRAA 3SFZA 1LD8A 2PXFA 4AXHA 2L0IA 1V55E 2XI8A 3WXXA 4GA1A 4BESA 2HCSA 4L2YA 3SCHA 4JZYA 1SA5A 3UKUG 1HH8A 2ZGDA 3KS2A 3LJNA
chains in the Genus database with same CATH topology
2YHEA 3R7QA 4NDWA 3IHYA 4I6RA 2WIUB 4PU7A 3OP9A 2VTBA 3AS4A 4U07A 4W9RA 4BT8A 1HG5A 2I1JA 4OYSA 4JHJA 3TXNA 2P58C 2RD0A 1WM5A 4I1MA 3Q49B 3F52A 4NACA 3FUIA 3RIBA 3TJPA 5AJDA 3ZYLA 4YG1A 1GW6A 4K0RA 2CG3A 2ILRA 2V5FA 3L17A 5JHBA 3FHEA 4O6FA 1PNRA 3CK9A 3S7FA 4TUUA 1H0AA 3DBSA 4ANXA 4PU4C 2X6IA 3PREA 4JHRA 2WXOA 2LYQA 3ML9A 1ZBPA 4GYWA 4AEZC 2LNIA 3ZIMA 4TV3A 3SNXA 4Q69A 2Q7FA 2DBAA 4I8TA 4IWRA 2PPXA 1WAO1 3OXFA 3RRUA 3ZVVA 3ONLA 1PERL 3FTZA 2I9CA 4A1SA 3FYMA 4UWFA 4WNDA 5LCWJ 2WUSR 1E3OC 2AXVA 3D9PA 2PUDA 3EIQC 3ZXSA 4UQZA 3GYZA 5CCMA 3ZEFA 2JCGA 1H2TC 1E8WA 5ANLA 5FQ4A 3ZPJA 1Y9QA 4X4IA 3RK6A 3NF1A 4Z5CA 1JFSA 1Z3YA 1ZZ9A 5BT1A 3UPVA 4WWOA 1IC8A 3CVNA 1LLIA 3ULQA 3RKVA 3MKQB 3MYVA 1WIZA 3FU5A 2HINA 5G05J 4ANVA 3VLDA 1KT1A 1NP7A 1UXCA 1R69A 4ILGA 1A17A 2VSNA 2LYSA 3EHMA 3MZLB 3UUXA 3RZZA 3OXLA 4APOA 2FO7A 2GGFA 2AWIA 4A3TA 1HF0A 2CHZA 4D10C 4F1SA 1DW9A 2PUGA 4U0ZA 2WXFA 4IRUA 4X4EA 3ASDA 3SCFA 2I2OA 2BNOA 1NEQA 3S8QA 1WETA 1QZ2A 2WXJA 3CLJA 3Q4AB 4CRWA 5JJ7A 2WXNA 1O4XA 4JCYA 4I17A 3VLEA 3LKUA 3FTXA 3ZYQA 2DCPA 3F51A 2WXRA 4FULA 4P29A 4XX5A 1POUA 4YNDA 2I6HA 2WPVA 2A4ZA 4UWLA 3QYXA 2PUEA 1WH6A 2CG2A 4GMLA 4YVOA 5JHAA 1LCCA 3CKCA 2VQ2A 3PUJA 2BF0X 4EBAA 1RZRD 1N54A 1WY6A 3I5PA 4FHKA 3ZYKA 1ZU2A 4I6JA 4RVBA 4J8EA 4F7AA 5BV1A 1ZUGA 3SZ7A 1OWOA 4HLEA 5LCWC 4GPKA 2BNMA 3FUDA 2MEZA 2X6JA 3PS6A 1X57A 2IF4A 4MRUA 2WQ6A 4CDMA 2ICTA 2WXIA 1JH9A 4X4DA 2KZTB 4LCTA 2R1JL 2XGOA 1OWLA 2IVBA 2EWTA 3D9NA 4BWRA 1SQ8A 5JJTA 1EF1C 2J09A 1WH8A 4HVBA 3RO2A 2PM6A 3IEGA 2XPZA 2HR2A 3ESLA 5FZRA 1LCDA 3GBFA 2J07A 2UY1A 4N2SA 5KCMA 4GB9A 3R7RA 3TG4A 3O48A 2LYJA 4DK5A 4ILIA 4KYOB 4G2VA 2KM4A 4GHJA 4GYOA 4UWGA 1QP4A 2PUAA 4GQMA 2BJCA 2L49A 3VK0A 1H2UA 1Y8MA 3MV2B 4FHJA 1MHQA 1TJCA 3CHQA 3CR3A 4Q96A 3S7JA 4XKCA 1OCTC 1OWMA 3FTSA 3T5XA 5KJLA 5J90A 2XPYA 1QPZA 3B7RL 3LYAA 4BX9A 4HORA 2UWJG 3G2TA 3FFLA 3IBEA 4GAAA 3NZUA 4WAFA 4PU3C 3PUKA 2WXLA 2PQRA 3ASHA 3I4RB 3VTXA 1XGWA 2VGXB 1ELWA 4L23A 3GW4A 4G24A 4PS3A 4EQFA 3U9WA 3KZ3A 1JWFA 3FTWA 4FC8A 4ACLA 4GZDA 2JLBA 4E6HA 3RU0A 4B0ZA 3B7HA 4Z58A 2FI7A 4U04A 4EBAG 3VTYA 3T5VA 4GCNA 3P1UA 1P5QA 4H7XA 1EPUA 4A3VA 1UW4B 3LEWA 2LAIA 1HO8A 4K03A 1LQCA 5HI7A 3ZW3A 1UTXA 3U66A 2LAHA 2BUGA 2X6KA 3OQNA 3FTUA 3KEZA 1EYHA 3FUJA 4GU5A 2GRMA 3S2AA 1BDIA 5C1DA 2IUOA 2VJ8A 1DWKA 3CQGB 3AS8A 3ML8A 2Y4TA 4G25A 1LF8A 1SZAA 2QFCA 3S7BA 3I4GA 3EHNA 4IYPA 4I9EA 4FBIA 4O8BA 3QF3A 1H2VC 2J49A 3CSTA 3FU6A 3CHMA 2EBYA 3I3NA 4HXIA 4EECA 4U63A 1YSEA 2MHKA 3CEQA 3L08A 1EDUA 4GA0A 4LERA 1B89A 5J08A 1ELRA 1INZA 5KJNA 3UT7A 3CVLA 1JFTA 3VLFA 1ZZ8A 2YQ8A 2UY1B 3B7UX 2B5AA 4J1WA 4CCAA 2LYLA 5LX8A 3LCAA 2OVFA 2BTDA 4N39A 4MKTA 3GZ2A 4B8CB 3O4ZA 4ATGA 5ARGA 1L5JA 3H5TA 1NA3A 3IV0A 3QARA 4Z59A 3G2WA 1KT0A 3L54A 3LPZA 5FQ8A 1UJKA 3D9KA 4G1TA 3ZYMA 4JQDA 4DJAA 5AYWD 2PUBA 1X5BA 5DBKA 3NQPA 3GN5B 2VTBB 4ILHB 4EZLA 4UI9J 2VSYA 3HIZA 4XI9A 3CHPA 3U64A 1E7VA 4AP2A 2KEKA 2MQKA 2WQHA 4JEUA 4GZ6A 3MV3B 1UJJA 1RZRA 4R7LA 4B94A 3OAWA 3OXGA 1HU3A 2OV8A 2WVIA 3HDXA 3PVLA 1R63A 2LCVA 1HG2A 2IU7A 1OSLA 4UWHA 3D9JA 4C0EA 4EZKA 4L2LA 3FTVA 3R1FA 4IN3B 4G11A 4JEHA 4J8FA 1SQMA 1IHGA 1PAQA 4PS7A 3UMVA 5G2NA 3Q5MA 4Y6CA 3LXUX 4Q94A 2J9QA 1OWPA 4I43A 2X6FA 3ASFA 4GZ3A 2JVLA 3ZHEA 5G04J 4HOQA 4MCTA 4NRHB 2IQCA 3LY8A 3QWPA 4HFGA 3UT8A 3PRZA 2KZ8A 3JXBC 4WNFA 2LYKA 5ARFA 3SGHA 2KZTA 2PQNA 2MOWA 2ONDA 2WM9A 3TXMA 2KEIA 3FH5A 3Q15A 5E75A 3CK7A 4KVOA 2PIJA 5G04C 1IQRA 1PRUA 2NC9A 1DVPA 5CMYA 2IVGA 3D9IA 3FUNA 1BDHA 4X4FA 3ZRHA 1GT0C 5LFAA 5BV0A 5CHEE 3UFDA 3D9OA 2HSGA 4BSXA 4OB4A 2J08A 2WXQA 2IVQA 2RG8A 3D9MA 2YHCA 3CLCA 1E96B 2PUFA 4I6GA 2O4AA 4QFVA 3CIAA 4APFA 5LP0A 3N71A 3BG1B 3K9IA 4NQ0A 4N2QA 4I2ZA 5FJYA 3FH7A 3BDNA 3LS8A 5FTPA 2R5SA 5A7DB 1W3BA 3ZHMA 2YNQA 4PS8A 4XZ4A 4G26A 1ZZ6A 2KPJA 2FBNA 3MCXA 1UXDA 4JL0A 3GN5A 3G7DA 3FP3A 3U4TA 3SBSA 3LVQE 5EDSA 3KXAA 3B13A 1N52A 3APFA 4TRQA 5HQ8A 5G55A 3TRBA 3HZIB 2CFUA 5FQ6A 4DI3A 2ZU6B 2Y4UA 3QQ6A 1DNPA 3FU0A 4KXKB 4PDXA 3G2VA 3PE3A 4C0MA 2BNNA 3PXPA 4YVQC 3FU3A 1NERA 3LY7A 4F53A 3CV0A 5FZQA 1HX8A 2PZIA 3MGBA 3SD5A 1ZVVA 3BS3A 3RJVA 3TAXA 2WMOA 1FCHA 4DI4A 2FULA 1QQEA 1Y6IA 2J4DA 3L22A 1ZZ7A 2CROA 4I2WA 5A6CA 4U0UA 4AM9A 2YINA 2O38A 3LDZA 2OVBA 4X4GA 2IOLA 3DPDA 4HOUA 2PL2A 4BY6A 3MA5A 2X3MA 4GZCA 5T8IA 2EF8A 4A1GA 4JA7A 3RO3A 2XJ3A 2IJGX 4FU3A 2PUCA 4HS2A 1IYGA 3EIJA 1CJGA 2WB2A 4FLBA 2VSXE 4Y42A 2IFUA 3FUEA 4YG7B 3FY4A 2CSFA 5D0OD 2C0LA 2NSZA 4AY5A 2LYRA 2H8RA 3Q47B 2HM8A 1S7EA 4JC8A 1QQAA 2WXMA 2XCCA 3G2SA 2VGYA 1BPOA 2XEVA 4KVMA 4M3OA 2V8SE 1HS6A 3NZSA 2NXPA 4J8DA 2AW6A 2AXUA 2IV1A 1KLXA 4I9CA 4JCXA 5DIZA 3JQ1A 4ANWA 4FN3A 1S0PA 2OOEA 2XGMA 3CHRA 2EQXA 2XRZA 4ME2A 1VDYA 3AS5A 3LVRE 3CHSA 2OR1L 2KCKA 3PNTB 4ABNA 4URKA 5ENNA 5CMWA 4YG4A 4UI9C 4IVZA 3FUFA 2VSOE 3ZN3A 2WQ7A 3CVQA 3QDNA 4XI0A 4JPSA 3T8MA 1RZSA 4CEMA 3FUHA 3FUMA 3GZSA 4I6UA 1NA0A 4I6TA 4HOTA 5BUZA 1E8ZA 1U3DA 3L13A 4JXTA 4AVXA 3OQOA 2FF4A 3IKOB 3MX3A 4CDNA 4YARA 5EX0A 1E8XA 3CECA 3PEUB 2CHXA 1PC2A 1E7UA 5BW8C 1Z3XA 4ANUA 1UN8A 4U8HA 2IONA 3QJZA 4LEUA 5FQ7A 4BTAA 1Y7YA 3CVWA 4LRZA 2PM7A 4N3AA 5AENA 4RG9A 4X4CA 2XQ0A 3LY9A 4MS6A 4GA2A 4PH4B 3UQ3A 4B89A 2WXGA 3SF4A 1NZNA 3LJ3A 4Z5HA 3BG0B 4WWNA 2LSVA 3PEVB 4Z5DA 3SHFA 3SI5A 3CHOA 1E8YA 3P2BA 5EKQD 4EPZA 3CVVA 3ZKCA 3ENEA 3LISA 1UN9A 1ELKA 2A5UA 1HF8A 4H7YA 4RSYA 4XKBA 3IVPA 3O9XA 2KC7A 3AU4A 3MKRA 1OUVA 5FWQA 1L1MA 3FTYA 4LUNU 2E0IA 2XCJA 4Y6WA 5AJLA 2KCLA 4E85A 3BEEA 5T4YA 2GW1A 2V4LA 4DLQA 4OVVA 1EFAA 1QP7A 2X6HA 4I6EA 2IU1A 2V0PA 1HXIA 4C9BB 3MLFA 4FJYA 4MLPA 3SBTB 1TJFA 1ZS4A 1HZ4A 3FULA 2C2LA 2LO6A 4PU8A 4UWKA 5A7LA 3HHMA 3CVXA 4I1AA 2HYZA 4GZ5A 1ZZBA 4X4HA 1CQTA 2VGXA 1U3CA 3CVUA 3MKQA 3JXDL 5D0QD 3CVPA 3TGOA 3D9LA 4XIFA 2E2EA 3EUSA 1OWNA 2VYIA 3EDTB 3FWVA 4EZJA 4JHKA 5CCLA 3D1NI 4AJWA 2LYPA 2XPIA 3FDHA 3MJWA 4BTBA 1ADRA 4CGWA 4AV7A 4ACKA 2R59A 5E76A 4FADA 1JWLA 1Z6TA 2L9BA 1AU7A 4GMJA 1PRVA 1PY1A 1SZ9A 2I1KA 4KZ0A 3URZA 3CVYA 2IOSA 5KJKA 4XE0A 2L6JA 3QWWA 1X2LA 5AIJA 4AY6A 5FZSA 2WMNA 4BT9A 2L8NA 4UI9K 4JA9A 3JXCL 3JQ0A 4GCOA 5ANRA 1JUQA 3IHVA 3PE4A 3QAQA 4KZCA 2XSDC 3FH8A 4MCXA 4PUCA 3G5GA 4KBQA 2WXKA 3HVEA 3QWGA 2XRYA 4J1XA 4AIFA 3PH0C 2WXHA 4F3VA 4JW1A 4X4BA 3QC1A 3C98A 3GZ1A 4L1BA 3LFPA 1ZPQA 4J6IA 3ONKA 4AOFA 4WUYA 5G05C 3KD7A 5KJMA 4G23A 2R63A 4CDRA 4GYYA 2D5VA 2MRIA 3L1PA 3D3MA 4FJZA 2DIWA 2A6CA 1LMB3 2KCVA 3FEXA 4FLHA 3S7DA 2XCBA 1XNFA 3JUIA 4IA8A 5JJ6A 2OFYA 1FVHA 2LSUA 5C2YA 3QNKA 4DLOA 5K98B 1YA0A 2AUWA 3B7TA 3PZDA 3OTNA 1MQSA 2PE5A 4KMOA 4L7TA 1JPLA 4OVUA 1FVFA 4CT0A 3B7SA 3HYMB 2GRLA 4CGVA 1ZZCA 2J4BA 4N5CA 4FA6A 4WNEA 1QP0A 3HVEB 4F8DA 3FMYA 1E90A 3CK8A 3JCKC 3L6AA 3ZGQA 5M72A 4FP7A 3QWVA 5LOZA 4JVSA 2R17C 3QB2A 3DNVB 4YBAA 2C0MA 3KJXA 3CSFA 4WNGA 3UX4A 2FEZA 4CT4A 5BPPA 3ZFWA 3PDNA 3F6WA 4UQXA 2AVPA 3E4BA 3APDA 4I1OB 3BD1A 1H19A 1HE8A 3SCGA 1RIOA 1B0NA 2Y3AA 2L0TB 3FYAA 4J8SA 3U3WA 5T3RA 4HOSA 2KEJA 2HO1A 4KT6B 2XHEA 3APCA 3MEKA 2XIUA 3G2UA 3R9AB 2QY7A 1XWRA 3EJNA 3RRMB 4A55A 3OMTA 3FEYA 4BX8A 4N3CA 2FJRA 1RPEL 1UG3A 3QKYA 4NURA 1IQUA 2O49A 3JYSA 4BFRA 3ASGA 2GZUA 1HFAA 3ESKA 3CROL 3ZHEB 4J0UA 1PRAA 3L16A 2X38A 2ICPA 3SFZA 5FT9A 2M63A 3CQCB 1H6KA 2AXZA 2XGSA 4AXHA 2L0IA 2XI8A 1VPWA 5EX3A 4DPRA 5BNWA 3WXXA 4GA1A 3RRNB 3CKBA 4RG6A 3AU5A 4B8AA 2WXPA 4IULA 2CHWA 4L2YA 1QNFA 4U0SA 3SCHA 3OQMA 3FUKA 4JZYA 3PNLB 4N3BA 3TG5A 3UT4A 4UQYA 1TEZA 3KAEA 3QK0A 3CGHA 3QOUA 4WWPA 1QQBA 1HH8A 2CFZA 2KATA 3TL5A 5A23A 3KS2A 1JWGA 1ZAYA 2JEKA 4V3IA 3ZHIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KZ3 A;  1ZZ6 A;  2KPJ A;  4I6R A;  2WIU B;  1UXD A;  3OP9 A;  4NDW A;  4PU7 A;  3GN5 A;  3G7D A;  5A7L A;  3KXA A;  1ZZB A;  3B7H A;  4Z58 A;  4X4H A;  1CQT A;  3TRB A;  3JXD L;  3F52 A;  3HZI B;  3EUS A;  3QQ6 A;  4YG1 A;  3D1N I;  2LYP A;  1LQC A;  1UTX A;  1ADR A;  3OQN A;  1PNR A;  2BNN A;  3PXP A;  1JWL A;  1NER A;  1AU7 A;  2GRM A;  4PU4 C;  1BDI A;  1PRV A;  2IUO A;  2LYQ A;  1DWK A;  3BS3 A;  1ZVV A;  1X2L A;  2CRO A;  4I8T A;  4IWR A;  2L8N A;  2O38 A;  2PPX A;  3QF3 A;  4O8B A;  4FBI A;  4X4G A;  3JXC L;  2EBY A;  1PER L;  3FYM A;  1YSE A;  2XSD C;  4MCX A;  2EF8 A;  2WUS R;  2AXV A;  3G5G A;  1E3O C;  2PUD A;  2XJ3 A;  3QWG A;  4J1X A;  2PUC A;  2JCG A;  1CJG A;  1Y9Q A;  1JFT A;  4X4B A;  4Y42 A;  1ZZ8 A;  4X4I A;  2B5A A;  3LFP A;  1ZPQ A;  1ZZ9 A;  2CSF A;  2LYL A;  4J1W A;  4Z5C A;  4YG7 B;  1IC8 A;  1JFS A;  1LLI A;  2LYR A;  2H8R A;  2R63 A;  1WIZ A;  2HIN A;  1S7E A;  2D5V A;  3L1P A;  1QQA A;  1UXC A;  1R69 A;  3H5T A;  2LYS A;  2A6C A;  1LMB 3;  4Z59 A;  2AW6 A;  2AXU A;  2IV1 A;  4IA8 A;  3RZZ A;  4JCX A;  2OFY A;  2AWI A;  4FN3 A;  1HF0 A;  5K98 B;  2AUW A;  1DW9 A;  2PUG A;  2PE5 A;  2OR1 L;  4JQD A;  2PUB A;  2GRL A;  4YG4 A;  4IVZ A;  4X4E A;  1ZZC A;  3SCF A;  3GN5 B;  2BNO A;  1NEQ A;  3S8Q A;  1WET A;  1QP0 A;  4F8D A;  3FMY A;  1RZS A;  1O4X A;  4JCY A;  2KEK A;  2MQK A;  3F51 A;  4I6U A;  4I6T A;  1RZR A;  3DNV B;  1POU A;  4YBA A;  3KJX A;  3QYX A;  1R63 A;  3OQO A;  2LCV A;  4YAR A;  3F6W A;  2PUE A;  1WH6 A;  3CEC A;  2IU7 A;  1OSL A;  1LCC A;  3BD1 A;  3R1F A;  3SCG A;  1B0N A;  1Y7Y A;  1RZR D;  3FYA A;  1RIO A;  3U3W A;  2KEJ A;  1ZUG A;  2XIU A;  4X4C A;  2BNM A;  2MEZ A;  1XWR A;  1X57 A;  3OMT A;  4Z5H A;  2FJR A;  2ICT A;  1RPE L;  1JH9 A;  2JVL A;  4X4D A;  4MCT A;  2R1J L;  2O49 A;  2IVB A;  2EWT A;  4Z5D A;  1SQ8 A;  2KZ8 A;  2GZU A;  3JXB C;  2LYK A;  1WH8 A;  3CRO L;  3ZKC A;  2KEI A;  1PRA A;  3LIS A;  2PIJ A;  3GBF A;  1LCD A;  2ICP A;  1ZAY A;  1PRU A;  2AXZ A;  3IVP A;  3O9X A;  2LYJ A;  2XI8 A;  1VPW A;  2IVG A;  4GHJ A;  1L1M A;  1QP4 A;  1BDH A;  4GQM A;  4X4F A;  2BJC A;  2XCJ A;  2L49 A;  3VK0 A;  1GT0 C;  2PUA A;  3UFD A;  2HSG A;  4OB4 A;  1EFA A;  1OCT C;  2IVQ A;  1QP7 A;  1QPZ A;  3SCH A;  3OQM A;  3CLC A;  2PUF A;  2O4A A;  3MLF A;  4PU3 C;  1ZS4 A;  1QQB A;  3BDN A;  3ZHM A;  1ZZ7 A;  4PU8 A;  3ZHI A; 
#chains in the Genus database with same CATH topology
 2YHE A;  3IHY A;  2WIU B;  4PU7 A;  4W9R A;  3TWX A;  3C5R A;  4OYS A;  4O1O A;  3E34 A;  3NBN B;  3L17 A;  1N4P A;  4OBM A;  4TUU A;  2B0O E;  5ENQ D;  4PU4 C;  3PRE A;  1S70 B;  4GYW A;  1ZBP A;  4AEZ C;  1KZO A;  2LNI A;  3DSV A;  4Q69 A;  3OXF A;  1PER L;  3ULE G;  2I9C A;  4UWF A;  4WND A;  2WUS R;  1E3O C;  2AXV A;  3D9P A;  2PUD A;  3EIQ C;  3ZXS A;  3GYZ A;  5CCM A;  2JCG A;  1E8W A;  3ZPJ A;  1Y9Q A;  3QFI A;  1K8K G;  3NF1 A;  1Z3Y A;  3ULQ A;  1LLI A;  3MYV A;  4U8Y D;  3VLD A;  4GMR A;  5HS0 A;  2VSN A;  3C3Q A;  3MZL B;  3RZZ A;  1OY3 D;  5BXU A;  4F1S A;  1DW9 A;  2F0Y A;  3ASD A;  1NEQ A;  3S8Q A;  3Q4A B;  2WXN A;  1O4X A;  3ZYQ A;  3VLE A;  3LKU A;  2DCP A;  3F51 A;  3AG2 E;  2WPV A;  4UWL A;  5EYL A;  3QYX A;  4XEI G;  5ITZ F;  3JXJ A;  3ZNG A;  1FPP A;  4EBA A;  4X8Q A;  4I6J A;  4RVB A;  5BV1 A;  1ZUG A;  1OWO A;  3V2O A;  2BNM A;  3FUD A;  2MEZ A;  2X6J A;  3A9Y A;  2IF4 A;  2WQ6 A;  2WXI A;  2XGO A;  1OWL A;  3D9N A;  3Q75 A;  5JJT A;  3NDB B;  1EF1 C;  1WH8 A;  1O1R A;  3RO2 A;  4HVB A;  2PM6 A;  2HR2 A;  5KWD A;  1LCD A;  2R03 A;  4GYO A;  2L49 A;  3VK0 A;  3MV2 B;  3T9K A;  1MHQ A;  1TJC A;  3CR3 A;  1D9S A;  4XKC A;  5KJL A;  5J90 A;  3IBE A;  4WAF A;  3NZU A;  1NI1 A;  2PQR A;  3ASH A;  5DTQ A;  4TXQ A;  2VGX B;  3GZD A;  1ELW A;  4PS3 A;  3KZ3 A;  3FTW A;  4GZD A;  2DZO A;  3RU0 A;  3VTY A;  1P5Q A;  2LAI A;  1HO8 A;  3ZW3 A;  1N4S A;  2LAH A;  3FTU A;  3SR4 A;  2Y4T A;  3S7B A;  2QFC A;  4I9E A;  3I3N A;  4FBI A;  4O8B A;  1H2V C;  2J49 A;  2L6B A;  3CST A;  3SD5 A;  1EDU A;  1SA4 A;  1ELR A;  1ZZ8 A;  3B7U X;  2B5A A;  4CCA A;  2LYL A;  4MKT A;  5ARG A;  3H5T A;  3IV0 A;  4GTV A;  4Z59 A;  3G2W A;  1KT0 A;  4U96 D;  3L54 A;  4HNA D;  1UJK A;  4GTP A;  2PUB A;  2JQE A;  2XXA A;  3CHP A;  4AP2 A;  1E7V A;  4EKG A;  2MQK A;  5AQ9 A;  1MZC A;  3R9M A;  1RZR A;  1HU3 A;  3NZL A;  2OV8 A;  3PVL A;  5CED B;  2P2C P;  4C0E A;  5CER B;  4G11 A;  1D8D A;  2IEJ A;  1IHG A;  2Y69 E;  3NRO A;  3UMV A;  5G2N A;  3Q5M A;  3ASF A;  4GZ3 A;  2DVW A;  4G8L A;  3UT8 A;  1S64 A;  2LYK A;  3OKZ A;  2KEI A;  3FH5 A;  2PIJ A;  3D9H A;  4U8V D;  1YMP A;  1PRU A;  2J8S D;  2IVG A;  5LFA A;  5KNH D;  5CHE E;  5EN5 D;  2IVQ A;  3CLC A;  5LP0 A;  2XZT G;  1TR4 A;  4I2Z A;  2R5S A;  5A7D B;  1W3B A;  2QYJ A;  4JL0 A;  3B13 A;  4HB5 A;  5HQ8 A;  5G55 A;  3TRB A;  3KL4 A;  5CBO A;  3QQ6 A;  1DNP A;  3FU0 A;  3ZU7 B;  4PDX A;  1OCR E;  4C0M A;  3CV0 A;  1N4Q A;  1OCZ E;  3BS3 A;  3TAX A;  4HRL A;  3DPD A;  2XEH A;  5H7P A;  3UM2 A;  2X3M A;  4GZC A;  3RO3 A;  2WB2 A;  5CBN A;  4YG7 B;  4AY5 A;  3DST A;  3G2S A;  1BPO A;  4KVM A;  4M3O A;  1HS6 A;  3NXH A;  4I9C A;  4JCX A;  3JQ1 A;  2OOE A;  2XGM A;  4HQD A;  3CHR A;  2XRZ A;  4ME2 A;  1VDY A;  3DEO A;  3CHS A;  4ABN A;  1Z5S C;  5CMW A;  2PXV A;  3ZN3 A;  3CVQ A;  4XI0 A;  4JPS A;  1RZS A;  4LG6 A;  4JXT A;  4AVX A;  2Y1L E;  3IKO B;  1Z3X A;  4N5Q A;  4U8H A;  2ODR D;  3CVW A;  3HXD A;  2P9I G;  3LY9 A;  4MS6 A;  1BU9 A;  4PH4 B;  2DYS E;  1MYO A;  2H6F A;  2LSV A;  1MFQ C;  3SI5 A;  3Q73 A;  3X2Q E;  4ER0 A;  1UN9 A;  2A5U A;  4RSY A;  4XKB A;  3IVP A;  3QOW A;  2H6H A;  4LUN U;  2KCL A;  2M4H A;  2LNM A;  4MLP A;  3UM3 A;  1TJF A;  2RFA A;  1HZ4 A;  2C2L A;  2LO6 A;  1D8E A;  3Q9N C;  3EU9 A;  3HHM A;  4ZHB A;  4I1A A;  2HYZ A;  2VGX A;  1U3C A;  3MKQ A;  5D0Q D;  3CVP A;  3HXC A;  4TXR A;  3FDH A;  1ADR A;  2EIN E;  3J5P A;  4FAD A;  3R09 A;  1Z6T A;  1TN8 A;  3LQX A;  1AU7 A;  3UIP C;  4GMJ A;  3DPY A;  1PRV A;  2I1K A;  2IOS A;  4CYM D;  5FZS A;  3DXK G;  4JA9 A;  3JQ0 A;  1JUQ A;  3PE4 A;  3QAQ A;  2XSD C;  3L9T A;  4MCX A;  2WXK A;  4J1X A;  1K1A A;  4F3V A;  4JW1 A;  3C98 A;  2AJA A;  3GZ1 A;  5D66 A;  4AOF A;  5G05 C;  1ZB1 A;  4CDR A;  1MJ0 A;  4GYY A;  4FLH A;  1XNF A;  4IA8 A;  3DWL G;  2LSU A;  4DLO A;  5K98 B;  4KMO A;  3B7T A;  1MQS A;  2PE5 A;  4OVU A;  1JPL A;  4CT0 A;  4CZ2 D;  5BXO A;  4CGV A;  2J4B A;  2VGE A;  5AN8 A;  3FMY A;  5M72 A;  3QWV A;  2ETC A;  5ENO D;  4CT4 A;  5DT2 A;  3PDN A;  3F6W A;  3APD A;  2EIK E;  2L0T B;  5T3R A;  4ZFH A;  2KEJ A;  3APC A;  2XIU A;  5B1A E;  1XWR A;  3EJN A;  4A55 A;  3OMT A;  5AAO A;  2O49 A;  1O1S A;  5JUW A;  4YDE A;  3CRO L;  3ZHE B;  4J0U A;  3B7B A;  2M63 A;  2EIJ E;  3CQC B;  1VPW A;  5EX3 A;  4DE8 A;  4RG6 A;  2CHW A;  3FUK A;  3PNL B;  1TEZ A;  3KAE A;  3QK0 A;  3CGH A;  4WWP A;  5A23 A;  3TL5 A;  2C0M A;  3ZHI A;  3AS4 A;  4BT8 A;  1HG5 A;  2I1J A;  3TXN A;  2RD0 A;  3F52 A;  3FUI A;  1S63 A;  5AJD A;  4YG1 A;  1GW6 A;  4K0R A;  2ILR A;  2V5F A;  3HXF A;  3FHE A;  4O6F A;  1H0A A;  2X6I A;  2WXO A;  2LYQ A;  2FFH A;  4TUM A;  3FTZ A;  4UQZ A;  5D2M C;  3ZPX A;  5FQ4 A;  2DZN A;  4ER7 A;  2MYO A;  3JUE A;  5JMN D;  1ZZ9 A;  4WWO A;  4K5A B;  3MKQ B;  2HIN A;  1IHB A;  4ANV A;  1NP7 A;  1UXC A;  4ILG A;  2HE0 A;  1A17 A;  2LYS A;  2OCC E;  2FO7 A;  1HF0 A;  2RFM A;  4U0Z A;  4X4E A;  1WET A;  3CLJ A;  4RLY A;  4P29 A;  5AAR A;  1N0Q A;  2I6H A;  2A4Z A;  4GML A;  4YVO A;  1LCC A;  2VQ2 A;  2BF0 X;  1RZR D;  1N54 A;  3I5P A;  4FHK A;  1ZU2 A;  4F7A A;  5LCW C;  3PS6 A;  4CDM A;  3VWS A;  2R1J L;  4BWR A;  1SQ8 A;  3IEG A;  2XPZ A;  3ESL A;  2PNN A;  2F8Y A;  5KCM A;  2V5Q C;  3TG4 A;  4DK5 A;  2KM4 A;  2PUA A;  4GQM A;  5JHB A;  3S2A A;  1OCT C;  3LYA A;  5FIO A;  3DXM G;  4PU3 C;  3PUK A;  2WXL A;  3OWQ A;  2J7U A;  4RQI A;  4ACL A;  3B7H A;  4Z58 A;  2FI7 A;  4U04 A;  4EBA G;  3P1U A;  4A3V A;  4K03 A;  4DX1 A;  1BI7 B;  2PXE A;  2X6K A;  3OQN A;  3KEZ A;  1TNZ A;  5C1D A;  1DWK A;  4HRN A;  3TFL A;  3AS8 A;  5LCW J;  1SZA A;  4EEC A;  3EHN A;  5G04 C;  4HXI A;  1G3N B;  2EBY A;  2PXD A;  3L08 A;  2P9U G;  1B89 A;  3Q9U C;  3VLF A;  4J1W A;  2PXK A;  2OVF A;  4N39 A;  3M9L A;  3O4Z A;  1L5J A;  1NA3 A;  3QAR A;  5FQ8 A;  2J7W A;  2KXP C;  4WVL A;  3ZYM A;  5EIB E;  5DBK A;  4ILH B;  4EZL A;  2VSY A;  3HIZ A;  4XI9 A;  3ASN E;  2WQH A;  4JEU A;  1V54 E;  2GRO B;  2BKK B;  3HDX A;  1R63 A;  2LCV A;  3Q7A A;  2IU7 A;  1JCQ A;  4GTS A;  3PE5 A;  3R1F A;  2ZGG A;  5GAG i;  2PXQ A;  3LXU X;  1FT1 A;  2X6F A;  2JVL A;  4HOQ A;  4MCT A;  4HFG A;  3LY8 A;  3QWP A;  3PRZ A;  3JXB C;  4WNF A;  3SGH A;  3QOX A;  2OND A;  2WM9 A;  3Q15 A;  5E75 A;  1FT2 A;  1TN7 A;  5CMY A;  3D9I A;  4X4F A;  3D9O A;  3DSW A;  4OB4 A;  2J08 A;  2WXQ A;  3D9M A;  1E96 B;  4QFV A;  1H6P A;  3K9I A;  3BDN A;  5ENT D;  4LSZ E;  4G26 A;  4EZI A;  3LVQ E;  4BSZ B;  4TRQ A;  2CFU A;  2Y4U A;  4JB8 P;  4F53 A;  3FU3 A;  1NER A;  3UKR G;  3DSS A;  3MGB A;  2XXP A;  2FUL A;  1QQE A;  5A6C A;  3L22 A;  2CRO A;  4U0U A;  3LDZ A;  2OVB A;  4BY6 A;  5T8I A;  4JA7 A;  4HS2 A;  4FU3 A;  4FLB A;  2GRN B;  2CSF A;  2C0L A;  2H8R A;  2HM8 A;  3SFY A;  3DSX A;  3HG0 D;  4EQZ A;  2V8S E;  3NZS A;  4J8D A;  2NXP A;  2AW6 A;  2IV1 A;  1IKN D;  3TEL A;  5ENN A;  4UI9 C;  3FUF A;  2VSO E;  2WQ7 A;  2NYJ A;  5BUZ A;  1E8Z A;  2FF4 A;  1E8X A;  3CEC A;  1PC2 A;  1E7U A;  5ENS D;  5BV0 A;  1N4R A;  4LEU A;  2JAB A;  3AAA C;  3A9X A;  4B89 A;  3SF4 A;  3LJ3 A;  4Z5H A;  1YYH A;  3SHF A;  4HLL A;  1E8Y A;  2H6G A;  3AU4 A;  3MKR A;  1OUV A;  5FWQ A;  5AJL A;  2V4L A;  4I6E A;  4C9B B;  1TNB A;  3SBT B;  3ASO E;  3FUL A;  3TWQ A;  4PU8 A;  4DX2 A;  3CVX A;  1CQT A;  4EK9 A;  3TGO A;  2E2E A;  3EUS A;  2VYI A;  3EDT B;  5CCL A;  3D1N I;  4AJW A;  2XPI A;  3ISM C;  2XEE A;  2R59 A;  3GZD C;  3CVY A;  2L6J A;  1X2L A;  4GCO A;  5ANR A;  4KZC A;  4GTM A;  3QWG A;  3PH0 C;  2WXH A;  2DYR E;  4DE9 A;  3QC1 A;  4J6I A;  3D3M A;  2KCV A;  3FEX A;  2XCB A;  3PZD A;  2AUW A;  4L7T A;  3B7S A;  2GRL A;  3W9G A;  4F6R D;  4WNE A;  3JCK C;  3HVE B;  4F8D A;  4A63 B;  5LOZ A;  3QB2 A;  1MX4 A;  2R17 C;  2PXB A;  5BPP A;  3SQV A;  4UQX A;  3E4B A;  3BD1 A;  2GRR B;  3FYA A;  4KT6 B;  3R9A B;  1DCE A;  2QY7 A;  4K5C A;  4BX8 A;  3EHQ A;  1UG3 A;  3QKY A;  1IQU A;  3JYS A;  2GZU A;  1HFA A;  3ESK A;  1MX6 A;  3L16 A;  2X38 A;  4TXP A;  2ZIR A;  1BD8 A;  2XGS A;  4LNU D;  1TNY A;  5BNW A;  3CKB A;  2WXP A;  1A5E A;  1QNF A;  3OQM A;  2R2L A;  3QOU A;  4EHM A;  2KAT A;  1ZZ7 A;  2WMN A;  2JEK A;  2ZIS A;  4V3I A;  3R7Q A;  4I6R A;  2VTB A;  3OP9 A;  2XEN A;  3NAW A;  2R05 A;  1DUL A;  2P58 C;  1WM5 A;  4I1M A;  3Q49 B;  3KSL A;  2P9N G;  4NAC A;  3RIB A;  5AQB A;  2CG3 A;  2HCN A;  1PNR A;  2PXU A;  3S7F A;  3DBS A;  1JCS A;  3ABL E;  3ML9 A;  3SNX A;  2DBA A;  4I8T A;  2F8X K;  4IWR A;  2PPX A;  1WAO 1;  3RRU A;  5CEA A;  4B93 B;  4U95 D;  3ZEF A;  1H2T C;  4Z5C A;  1JFS A;  5BT1 A;  3UPV A;  1IC8 A;  1WIZ A;  4GPM A;  3Q78 A;  3UUX A;  2LXM A;  4APO A;  4A3T A;  4HRM B;  4D10 C;  1BLX B;  4IRU A;  5AQA A;  5DTM A;  3DM5 A;  1TYQ G;  2WXJ A;  5JJ7 A;  1UOH A;  4JCY A;  4URK A;  4Z68 A;  3FTX A;  3ZKJ A;  2WXR A;  2DWZ A;  4XX5 A;  1WH6 A;  3C72 A;  3TWU A;  3CKC A;  2F37 A;  4J8E A;  5EIL A;  3SZ7 A;  4GPK A;  1X57 A;  4QQI A;  1JH9 A;  4X4D A;  3BUA A;  4LCT A;  2IVB A;  2EWT A;  2J09 A;  5KBA A;  3SY2 A;  2J07 A;  4GB9 A;  3R7R A;  3EUV A;  2LYJ A;  4ILI A;  4G2V A;  4MBG A;  1H2U A;  4Q96 A;  4FHJ A;  3C3R A;  3CHQ A;  1QYM A;  3FTS A;  1OWM A;  4HOR A;  4BX9 A;  1QPZ A;  3G2T A;  2GRP B;  3FFL A;  3I4R B;  3VTX A;  2P9L G;  1XGW A;  1N0R A;  3GW4 A;  4FC8 A;  2JLB A;  4E6H A;  4B0Z A;  3BQO A;  4GCN A;  4H7X A;  1UW4 B;  1LQC A;  5HI7 A;  1UTX A;  3U66 A;  2BUG A;  3EHR A;  4GU5 A;  1BDI A;  2IUO A;  3UM0 A;  1DCQ A;  3WG7 E;  3ML8 A;  4G25 A;  4IYP A;  3QF3 A;  2LLW A;  1YSE A;  1HQ1 A;  2A5E A;  2MHK A;  3CEQ A;  4LER A;  5J08 A;  1INZ A;  5KJN A;  1N11 A;  1O5M A;  1IXV A;  3UT7 A;  3CVL A;  1JFT A;  2UY1 B;  3LCA A;  2BTD A;  2P9S G;  4ATG A;  4BET A;  4JQD A;  1X5B A;  4UI9 J;  3PZ2 A;  3NOG D;  2KEK A;  4GZ6 A;  3MV3 B;  4R7L A;  4U7E B;  3DEP A;  2WVI A;  5EID A;  1OSL A;  3B95 A;  4ER6 A;  4UUC A;  4JEH A;  1SQM A;  1PAQ A;  4PS7 A;  2J9Q A;  1K1B A;  5G04 J;  4DUI A;  2BKG A;  2B6C A;  2KZ8 A;  2PQN A;  2MOW A;  3TXM A;  1SW6 A;  2NC9 A;  5IY5 E;  1DVP A;  3ZRH A;  3UFD A;  2XZD G;  2HSG A;  4BSX A;  2RG8 A;  4I6G A;  2PUF A;  4APF A;  3N71 A;  4NQ0 A;  5FJY A;  4F1P A;  5B1B E;  3LS8 A;  1ZZ6 A;  2KPJ A;  2FBN A;  1UXD A;  3J5Q B;  3GN5 A;  3SBS A;  5EDS A;  3KXA A;  1N52 A;  3APF A;  3HZI B;  4DI3 A;  2ZU6 B;  3AG3 E;  2LUH A;  4YVQ C;  2PXT A;  3LY7 A;  5FZQ A;  2PZI A;  2OEV A;  1Y6I A;  2YIN A;  2O38 A;  3UXG A;  4X4G A;  2IOL A;  2PL2 A;  3MA5 A;  2EF8 A;  4C48 B;  1MX2 A;  2PUC A;  2VSX E;  4Y42 A;  3HRA A;  2IFU A;  3FUE A;  3TWT A;  2NSZ A;  2LYR A;  3Q47 B;  1Q2Z A;  1S7E A;  1QQA A;  3NOC D;  2XEV A;  1AWC B;  4JD2 G;  5DIZ A;  1KLX A;  2QC9 A;  4ANW A;  1S0P A;  2EQX A;  4O60 A;  5DRY A;  3AS5 A;  2OR1 L;  3ZXP A;  3PNT B;  2GRQ B;  3E32 A;  1H6O A;  3QDN A;  4OAU C;  4I6U A;  1NA0 A;  4I6T A;  4HOT A;  5HKP A;  1U3D A;  3L13 A;  3GZC A;  3OQO A;  1RZ4 A;  2IO3 C;  5EX0 A;  2CHX A;  3NB2 A;  4DRX E;  4LNB A;  4ANU A;  3ZUV B;  2ION A;  3QJZ A;  5FQ7 A;  1QBQ A;  2PM7 A;  5AEN A;  1NW3 A;  2XQ0 A;  4GA2 A;  1NZN A;  2H6I A;  4WWN A;  3PEV B;  4Z5D A;  4HBD A;  3CHO A;  4EPZ A;  3CVV A;  3ZKC A;  3LIS A;  4H7Y A;  1HF8 A;  3O9X A;  1OXJ A;  3FTY A;  4YDW A;  1OT8 A;  2E0I A;  2XCJ A;  4ER5 A;  4Y6W A;  4E85 A;  3BEE A;  1EFA A;  2V0P A;  1HXI A;  4FJY A;  1X81 A;  3UM1 A;  1ZS4 A;  2EIM E;  5A7L A;  1KPS B;  4GZ5 A;  1BI8 B;  4J7W A;  3CVU A;  5GAH i;  3D9L A;  4EZJ A;  1OWN A;  3FWV A;  4CGW A;  1JWL A;  2L9B A;  1N94 A;  4J8Y A;  5JA4 D;  1PY1 A;  1SZ9 A;  3URZ A;  5KJK A;  4AY6 A;  3QWW A;  4BT9 A;  2L8N A;  3HXB A;  3JXC L;  3PZ3 A;  3IHV A;  4PUC A;  4KBQ A;  2XS1 A;  3HVE A;  2XRY A;  3GUU A;  3PZ4 A;  4L1B A;  3LFP A;  1ZPQ A;  3ONK A;  3V2X A;  4WUY A;  2R63 A;  2MRI A;  3L1P A;  4FJZ A;  2DIW A;  1LMB 3;  5C2Y A;  1N9A A;  1YA0 A;  3OTN A;  1FVF A;  3E30 A;  3V30 A;  1ZZC A;  4EKI A;  1QP0 A;  5B3S E;  3ZGQ A;  4FP7 A;  1JCR A;  5FIN A;  3DNV B;  3CSF A;  1OCC E;  4YDO A;  1H19 A;  1HE8 A;  2Y3A A;  1RIO A;  4J8S A;  3Q79 A;  2HO1 A;  3MEK A;  1O1T A;  3FEY A;  4N3C A;  2FJR A;  4BFR A;  5CEC B;  2BED A;  2ICP A;  5FT9 A;  1H6K A;  2AXZ A;  4M7C A;  2XXQ A;  4DPR A;  4GTQ A;  3RRN B;  3AU5 A;  4B8A A;  4IUL A;  5DTR A;  4U0S A;  3TG5 A;  4N3B A;  3UT4 A;  4UQY A;  1QQB A;  3V31 A;  2CFZ A;  1ZAY A;  4NDW A;  4U07 A;  4JHJ A;  2YBD A;  1SVX A;  3TJP A;  3ZYL A;  5EYP F;  5KNG A;  3CK9 A;  4ANX A;  4JHR A;  3ZIM A;  4TV3 A;  2Q7F A;  3ZVV A;  3ONL A;  4A1S A;  3FYM A;  2LLV A;  5ANL A;  4X4I A;  3RK6 A;  2HFZ A;  3CVN A;  3RKV A;  3FU5 A;  5G05 J;  1KT1 A;  1R69 A;  4HI8 A;  3EHM A;  3OXL A;  2GGF A;  4ATZ D;  2AWI A;  1JWG A;  3L82 A;  2CHZ A;  2PUG A;  1TN6 A;  3DSU A;  2WXF A;  3C3O A;  3SCF A;  2I2O A;  2BNO A;  1QZ2 A;  2VTB B;  4CRW A;  4I17 A;  4LNG A;  4FUL A;  1POU A;  4YND A;  2PUE A;  2CG2 A;  5ENP D;  5JHA A;  4DX5 D;  3PUJ A;  3ZYK A;  1WY6 A;  1YCS B;  4HLE A;  3IXE A;  4MRU A;  2ICT A;  2KZT B;  3TWW A;  1DC2 A;  2RKK A;  5FZR A;  3GBF A;  2UY1 A;  3KEA A;  4N2S A;  3SX0 A;  5DSX A;  3O48 A;  4BEP A;  4KYO B;  3BU8 A;  4GHJ A;  4UWG A;  1QP4 A;  2BJC A;  1Y8M A;  3S7J A;  3T5X A;  2PXP A;  2XPY A;  3B7R L;  2UWJ G;  4GAA A;  1TNO A;  4GTR A;  3ULY A;  5CRV A;  4L23 A;  4EQF A;  4G24 A;  3U9W A;  1JWF A;  2MXD A;  2ETA A;  4G8K A;  4NIK A;  1EPU A;  3TWR A;  3LEW A;  1EYH A;  3FUJ A;  2GRM A;  2VJ8 A;  3CQG B;  4DX6 D;  1LF8 A;  1WG0 A;  3I4G A;  3FU6 A;  3T5V A;  3CHM A;  1QB2 A;  1QZX A;  4U63 A;  4GA0 A;  1WDY A;  1N95 A;  3E37 A;  2YQ8 A;  2V3C C;  5LX8 A;  3GZ2 A;  4B8C B;  3LPZ A;  3D9K A;  4G1T A;  3ABM E;  4DJA A;  5AYW D;  3NQP A;  2ZXW E;  3GN5 B;  3U64 A;  1UJJ A;  4B94 A;  3OAW A;  3OXG A;  3DRA A;  1HG2 A;  3PZ1 A;  4UWH A;  3D9J A;  4EZK A;  1OCO E;  4L2L A;  4DX7 D;  3FTV A;  4IN3 B;  4J8F A;  1TNU A;  3JXI A;  3UIO C;  2L1P A;  4Y6C A;  4Q94 A;  1OWP A;  3AG1 E;  4I43 A;  2P9K G;  1U2V G;  3TWV A;  3ZHE A;  4NRH B;  2IQC A;  5ARF A;  2KZT A;  3G0T A;  3CK7 A;  2VEO A;  4KVO A;  5CRU A;  1IQR A;  3FUN A;  1RW2 A;  1BDH A;  1GT0 C;  3RAU A;  3F6Q A;  3AJI A;  2YHC A;  2O4A A;  3CIA A;  3V79 K;  3BG1 B;  4N2Q A;  3FH7 A;  5FTP A;  3ZHM A;  2YNQ A;  4L9P A;  4PS8 A;  4XZ4 A;  1LD7 A;  3MCX A;  4O1P A;  2QZA A;  3FP3 A;  3G7D A;  3U4T A;  2LXL A;  5FQ6 A;  4KXK B;  3G2V A;  3PE3 A;  5ENR D;  2BNN A;  3PXP A;  1KZP A;  2XS8 A;  1HX8 A;  1ZVV A;  2IY0 C;  3RJV A;  2WMO A;  1FCH A;  4DI4 A;  4I2W A;  2J4D A;  4AM9 A;  4HOU A;  4A1G A;  2XJ3 A;  2IJG X;  4HRA A;  1IYG A;  3EIJ A;  1CJG A;  3ME5 A;  3FY4 A;  5D0O D;  2EIL E;  4JC8 A;  2WXM A;  2XCC A;  2VGY A;  5DRT A;  4YDY A;  2AXU A;  4FN3 A;  3LVR E;  2KCK A;  4K5B A;  4YG4 A;  4IVZ A;  3E33 A;  2IO2 C;  3T8M A;  4CEM A;  3FUH A;  3FUM A;  3GZS A;  3UWP A;  2P9P G;  3MX3 A;  4CDN A;  4YAR A;  3PEU B;  5BW8 C;  1UN8 A;  4BTA A;  4BER A;  1Y7Y A;  4LRZ A;  4N3A A;  2PXL A;  4RG9 A;  3MEJ A;  4X4C A;  3UQ3 A;  2WXG A;  2Y0B G;  3BG0 B;  3P2B A;  5EKQ D;  3ENE A;  1LTX A;  4ER3 A;  4Q2J A;  1ELK A;  3SO8 A;  2KC7 A;  3RSE G;  3UI2 A;  1L1M A;  5T4Y A;  4DLQ A;  2GW1 A;  4OVV A;  1QP7 A;  2X6H A;  2IU1 A;  3ABK E;  3MLF A;  3Q7F A;  1NL4 A;  2R02 A;  4UWK A;  4GTT A;  1ZZB A;  4X4H A;  3JXD L;  4XIF A;  2KBX A;  4JHK A;  2LYP A;  3MJW A;  4BTB A;  4AV7 A;  4ACK A;  5E76 A;  3A9Z A;  3EU5 A;  4KZ0 A;  4XE0 A;  5AIJ A;  1U2Z A;  3T8K A;  1K3Z D;  4UI9 K;  3FH8 A;  3G5G A;  4AIF A;  4OAV B;  4X4B A;  3SFX A;  3TEP A;  3KD7 A;  5KJM A;  4G23 A;  2D5V A;  2A6C A;  3S7D A;  3UTM A;  3JUI A;  5JJ6 A;  2OFY A;  1FVH A;  3QNK A;  2FO1 E;  2V4H C;  5AQ7 A;  4GTO A;  5HRY A;  3HYM B;  3TWS A;  4N5C A;  4FA6 A;  3AG4 E;  1E90 A;  3CK8 A;  3L6A A;  1AP7 A;  3UIN C;  4JVS A;  4WNG A;  4YBA A;  3UX4 A;  3KJX A;  2OEW A;  2FEZ A;  3ZFW A;  3HXE A;  4HI9 A;  2AVP A;  4I1O B;  3KSQ A;  3SCG A;  1B0N A;  3U3W A;  4HOS A;  1NFI E;  2XHE A;  3G2U A;  3W9F A;  3RRM B;  1RPE L;  2QYU A;  4NUR A;  3ASG A;  2ETB A;  1PRA A;  3SFZ A;  1LD8 A;  2PXF A;  4AXH A;  2L0I A;  1V55 E;  2XI8 A;  3WXX A;  4GA1 A;  4BES A;  2HCS A;  4L2Y A;  3SCH A;  4JZY A;  1SA5 A;  3UKU G;  1HH8 A;  2ZGD A;  3KS2 A;  3LJN A; 
#chains in the Genus database with same CATH homology
 2YHE A;  3R7Q A;  4NDW A;  3IHY A;  4I6R A;  2WIU B;  4PU7 A;  3OP9 A;  2VTB A;  3AS4 A;  4U07 A;  4W9R A;  4BT8 A;  1HG5 A;  2I1J A;  4OYS A;  4JHJ A;  3TXN A;  2P58 C;  2RD0 A;  1WM5 A;  4I1M A;  3Q49 B;  3F52 A;  4NAC A;  3FUI A;  3RIB A;  3TJP A;  5AJD A;  3ZYL A;  4YG1 A;  1GW6 A;  4K0R A;  2CG3 A;  2ILR A;  2V5F A;  3L17 A;  5JHB A;  3FHE A;  4O6F A;  1PNR A;  3CK9 A;  3S7F A;  4TUU A;  1H0A A;  3DBS A;  4ANX A;  4PU4 C;  2X6I A;  3PRE A;  4JHR A;  2WXO A;  2LYQ A;  3ML9 A;  1ZBP A;  4GYW A;  4AEZ C;  2LNI A;  3ZIM A;  4TV3 A;  3SNX A;  4Q69 A;  2Q7F A;  2DBA A;  4I8T A;  4IWR A;  2PPX A;  1WAO 1;  3OXF A;  3RRU A;  3ZVV A;  3ONL A;  1PER L;  3FTZ A;  2I9C A;  4A1S A;  3FYM A;  4UWF A;  4WND A;  5LCW J;  2WUS R;  1E3O C;  2AXV A;  3D9P A;  2PUD A;  3EIQ C;  3ZXS A;  4UQZ A;  3GYZ A;  5CCM A;  3ZEF A;  2JCG A;  1H2T C;  1E8W A;  5ANL A;  5FQ4 A;  3ZPJ A;  1Y9Q A;  4X4I A;  3RK6 A;  3NF1 A;  4Z5C A;  1JFS A;  1Z3Y A;  1ZZ9 A;  5BT1 A;  3UPV A;  4WWO A;  1IC8 A;  3CVN A;  1LLI A;  3ULQ A;  3RKV A;  3MKQ B;  3MYV A;  1WIZ A;  3FU5 A;  2HIN A;  5G05 J;  4ANV A;  3VLD A;  1KT1 A;  1NP7 A;  1UXC A;  1R69 A;  4ILG A;  1A17 A;  2VSN A;  2LYS A;  3EHM A;  3MZL B;  3UUX A;  3RZZ A;  3OXL A;  4APO A;  2FO7 A;  2GGF A;  2AWI A;  4A3T A;  1HF0 A;  2CHZ A;  4D10 C;  4F1S A;  1DW9 A;  2PUG A;  4U0Z A;  2WXF A;  4IRU A;  4X4E A;  3ASD A;  3SCF A;  2I2O A;  2BNO A;  1NEQ A;  3S8Q A;  1WET A;  1QZ2 A;  2WXJ A;  3CLJ A;  3Q4A B;  4CRW A;  5JJ7 A;  2WXN A;  1O4X A;  4JCY A;  4I17 A;  3VLE A;  3LKU A;  3FTX A;  3ZYQ A;  2DCP A;  3F51 A;  2WXR A;  4FUL A;  4P29 A;  4XX5 A;  1POU A;  4YND A;  2I6H A;  2WPV A;  2A4Z A;  4UWL A;  3QYX A;  2PUE A;  1WH6 A;  2CG2 A;  4GML A;  4YVO A;  5JHA A;  1LCC A;  3CKC A;  2VQ2 A;  3PUJ A;  2BF0 X;  4EBA A;  1RZR D;  1N54 A;  1WY6 A;  3I5P A;  4FHK A;  3ZYK A;  1ZU2 A;  4I6J A;  4RVB A;  4J8E A;  4F7A A;  5BV1 A;  1ZUG A;  3SZ7 A;  1OWO A;  4HLE A;  5LCW C;  4GPK A;  2BNM A;  3FUD A;  2MEZ A;  2X6J A;  3PS6 A;  1X57 A;  2IF4 A;  4MRU A;  2WQ6 A;  4CDM A;  2ICT A;  2WXI A;  1JH9 A;  4X4D A;  2KZT B;  4LCT A;  2R1J L;  2XGO A;  1OWL A;  2IVB A;  2EWT A;  3D9N A;  4BWR A;  1SQ8 A;  5JJT A;  1EF1 C;  2J09 A;  1WH8 A;  4HVB A;  3RO2 A;  2PM6 A;  3IEG A;  2XPZ A;  2HR2 A;  3ESL A;  5FZR A;  1LCD A;  3GBF A;  2J07 A;  2UY1 A;  4N2S A;  5KCM A;  4GB9 A;  3R7R A;  3TG4 A;  3O48 A;  2LYJ A;  4DK5 A;  4ILI A;  4KYO B;  4G2V A;  2KM4 A;  4GHJ A;  4GYO A;  4UWG A;  1QP4 A;  2PUA A;  4GQM A;  2BJC A;  2L49 A;  3VK0 A;  1H2U A;  1Y8M A;  3MV2 B;  4FHJ A;  1MHQ A;  1TJC A;  3CHQ A;  3CR3 A;  4Q96 A;  3S7J A;  4XKC A;  1OCT C;  1OWM A;  3FTS A;  3T5X A;  5KJL A;  5J90 A;  2XPY A;  1QPZ A;  3B7R L;  3LYA A;  4BX9 A;  4HOR A;  2UWJ G;  3G2T A;  3FFL A;  3IBE A;  4GAA A;  3NZU A;  4WAF A;  4PU3 C;  3PUK A;  2WXL A;  2PQR A;  3ASH A;  3I4R B;  3VTX A;  1XGW A;  2VGX B;  1ELW A;  4L23 A;  3GW4 A;  4G24 A;  4PS3 A;  4EQF A;  3U9W A;  3KZ3 A;  1JWF A;  3FTW A;  4FC8 A;  4ACL A;  4GZD A;  2JLB A;  4E6H A;  3RU0 A;  4B0Z A;  3B7H A;  4Z58 A;  2FI7 A;  4U04 A;  4EBA G;  3VTY A;  3T5V A;  4GCN A;  3P1U A;  1P5Q A;  4H7X A;  1EPU A;  4A3V A;  1UW4 B;  3LEW A;  2LAI A;  1HO8 A;  4K03 A;  1LQC A;  5HI7 A;  3ZW3 A;  1UTX A;  3U66 A;  2LAH A;  2BUG A;  2X6K A;  3OQN A;  3FTU A;  3KEZ A;  1EYH A;  3FUJ A;  4GU5 A;  2GRM A;  3S2A A;  1BDI A;  5C1D A;  2IUO A;  2VJ8 A;  1DWK A;  3CQG B;  3AS8 A;  3ML8 A;  2Y4T A;  4G25 A;  1LF8 A;  1SZA A;  2QFC A;  3S7B A;  3I4G A;  3EHN A;  4IYP A;  4I9E A;  4FBI A;  4O8B A;  3QF3 A;  1H2V C;  2J49 A;  3CST A;  3FU6 A;  3CHM A;  2EBY A;  3I3N A;  4HXI A;  4EEC A;  4U63 A;  1YSE A;  2MHK A;  3CEQ A;  3L08 A;  1EDU A;  4GA0 A;  4LER A;  1B89 A;  5J08 A;  1ELR A;  1INZ A;  5KJN A;  3UT7 A;  3CVL A;  1JFT A;  3VLF A;  1ZZ8 A;  2YQ8 A;  2UY1 B;  3B7U X;  2B5A A;  4J1W A;  4CCA A;  2LYL A;  5LX8 A;  3LCA A;  2OVF A;  2BTD A;  4N39 A;  4MKT A;  3GZ2 A;  4B8C B;  3O4Z A;  4ATG A;  5ARG A;  1L5J A;  3H5T A;  1NA3 A;  3IV0 A;  3QAR A;  4Z59 A;  3G2W A;  1KT0 A;  3L54 A;  3LPZ A;  5FQ8 A;  1UJK A;  3D9K A;  4G1T A;  3ZYM A;  4JQD A;  4DJA A;  5AYW D;  2PUB A;  1X5B A;  5DBK A;  3NQP A;  3GN5 B;  2VTB B;  4ILH B;  4EZL A;  4UI9 J;  2VSY A;  3HIZ A;  4XI9 A;  3CHP A;  3U64 A;  1E7V A;  4AP2 A;  2KEK A;  2MQK A;  2WQH A;  4JEU A;  4GZ6 A;  3MV3 B;  1UJJ A;  1RZR A;  4R7L A;  4B94 A;  3OAW A;  3OXG A;  1HU3 A;  2OV8 A;  2WVI A;  3HDX A;  3PVL A;  1R63 A;  2LCV A;  1HG2 A;  2IU7 A;  1OSL A;  4UWH A;  3D9J A;  4C0E A;  4EZK A;  4L2L A;  3FTV A;  3R1F A;  4IN3 B;  4G11 A;  4JEH A;  4J8F A;  1SQM A;  1IHG A;  1PAQ A;  4PS7 A;  3UMV A;  5G2N A;  3Q5M A;  4Y6C A;  3LXU X;  4Q94 A;  2J9Q A;  1OWP A;  4I43 A;  2X6F A;  3ASF A;  4GZ3 A;  2JVL A;  3ZHE A;  5G04 J;  4HOQ A;  4MCT A;  4NRH B;  2IQC A;  3LY8 A;  3QWP A;  4HFG A;  3UT8 A;  3PRZ A;  2KZ8 A;  3JXB C;  4WNF A;  2LYK A;  5ARF A;  3SGH A;  2KZT A;  2PQN A;  2MOW A;  2OND A;  2WM9 A;  3TXM A;  2KEI A;  3FH5 A;  3Q15 A;  5E75 A;  3CK7 A;  4KVO A;  2PIJ A;  5G04 C;  1IQR A;  1PRU A;  2NC9 A;  1DVP A;  5CMY A;  2IVG A;  3D9I A;  3FUN A;  1BDH A;  4X4F A;  3ZRH A;  1GT0 C;  5LFA A;  5BV0 A;  5CHE E;  3UFD A;  3D9O A;  2HSG A;  4BSX A;  4OB4 A;  2J08 A;  2WXQ A;  2IVQ A;  2RG8 A;  3D9M A;  2YHC A;  3CLC A;  1E96 B;  2PUF A;  4I6G A;  2O4A A;  4QFV A;  3CIA A;  4APF A;  5LP0 A;  3N71 A;  3BG1 B;  3K9I A;  4NQ0 A;  4N2Q A;  4I2Z A;  5FJY A;  3FH7 A;  3BDN A;  3LS8 A;  5FTP A;  2R5S A;  5A7D B;  1W3B A;  3ZHM A;  2YNQ A;  4PS8 A;  4XZ4 A;  4G26 A;  1ZZ6 A;  2KPJ A;  2FBN A;  3MCX A;  1UXD A;  4JL0 A;  3GN5 A;  3G7D A;  3FP3 A;  3U4T A;  3SBS A;  3LVQ E;  5EDS A;  3KXA A;  3B13 A;  1N52 A;  3APF A;  4TRQ A;  5HQ8 A;  5G55 A;  3TRB A;  3HZI B;  2CFU A;  5FQ6 A;  4DI3 A;  2ZU6 B;  2Y4U A;  3QQ6 A;  1DNP A;  3FU0 A;  4KXK B;  4PDX A;  3G2V A;  3PE3 A;  4C0M A;  2BNN A;  3PXP A;  4YVQ C;  3FU3 A;  1NER A;  3LY7 A;  4F53 A;  3CV0 A;  5FZQ A;  1HX8 A;  2PZI A;  3MGB A;  3SD5 A;  1ZVV A;  3BS3 A;  3RJV A;  3TAX A;  2WMO A;  1FCH A;  4DI4 A;  2FUL A;  1QQE A;  1Y6I A;  2J4D A;  3L22 A;  1ZZ7 A;  2CRO A;  4I2W A;  5A6C A;  4U0U A;  4AM9 A;  2YIN A;  2O38 A;  3LDZ A;  2OVB A;  4X4G A;  2IOL A;  3DPD A;  4HOU A;  2PL2 A;  4BY6 A;  3MA5 A;  2X3M A;  4GZC A;  5T8I A;  2EF8 A;  4A1G A;  4JA7 A;  3RO3 A;  2XJ3 A;  2IJG X;  4FU3 A;  2PUC A;  4HS2 A;  1IYG A;  3EIJ A;  1CJG A;  2WB2 A;  4FLB A;  2VSX E;  4Y42 A;  2IFU A;  3FUE A;  4YG7 B;  3FY4 A;  2CSF A;  5D0O D;  2C0L A;  2NSZ A;  4AY5 A;  2LYR A;  2H8R A;  3Q47 B;  2HM8 A;  1S7E A;  4JC8 A;  1QQA A;  2WXM A;  2XCC A;  3G2S A;  2VGY A;  1BPO A;  2XEV A;  4KVM A;  4M3O A;  2V8S E;  1HS6 A;  3NZS A;  2NXP A;  4J8D A;  2AW6 A;  2AXU A;  2IV1 A;  1KLX A;  4I9C A;  4JCX A;  5DIZ A;  3JQ1 A;  4ANW A;  4FN3 A;  1S0P A;  2OOE A;  2XGM A;  3CHR A;  2EQX A;  2XRZ A;  4ME2 A;  1VDY A;  3AS5 A;  3LVR E;  3CHS A;  2OR1 L;  2KCK A;  3PNT B;  4ABN A;  4URK A;  5ENN A;  5CMW A;  4YG4 A;  4UI9 C;  4IVZ A;  3FUF A;  2VSO E;  3ZN3 A;  2WQ7 A;  3CVQ A;  3QDN A;  4XI0 A;  4JPS A;  3T8M A;  1RZS A;  4CEM A;  3FUH A;  3FUM A;  3GZS A;  4I6U A;  1NA0 A;  4I6T A;  4HOT A;  5BUZ A;  1E8Z A;  1U3D A;  3L13 A;  4JXT A;  4AVX A;  3OQO A;  2FF4 A;  3IKO B;  3MX3 A;  4CDN A;  4YAR A;  5EX0 A;  1E8X A;  3CEC A;  3PEU B;  2CHX A;  1PC2 A;  1E7U A;  5BW8 C;  1Z3X A;  4ANU A;  1UN8 A;  4U8H A;  2ION A;  3QJZ A;  4LEU A;  5FQ7 A;  4BTA A;  1Y7Y A;  3CVW A;  4LRZ A;  2PM7 A;  4N3A A;  5AEN A;  4RG9 A;  4X4C A;  2XQ0 A;  3LY9 A;  4MS6 A;  4GA2 A;  4PH4 B;  3UQ3 A;  4B89 A;  2WXG A;  3SF4 A;  1NZN A;  3LJ3 A;  4Z5H A;  3BG0 B;  4WWN A;  2LSV A;  3PEV B;  4Z5D A;  3SHF A;  3SI5 A;  3CHO A;  1E8Y A;  3P2B A;  5EKQ D;  4EPZ A;  3CVV A;  3ZKC A;  3ENE A;  3LIS A;  1UN9 A;  1ELK A;  2A5U A;  1HF8 A;  4H7Y A;  4RSY A;  4XKB A;  3IVP A;  3O9X A;  2KC7 A;  3AU4 A;  3MKR A;  1OUV A;  5FWQ A;  1L1M A;  3FTY A;  4LUN U;  2E0I A;  2XCJ A;  4Y6W A;  5AJL A;  2KCL A;  4E85 A;  3BEE A;  5T4Y A;  2GW1 A;  2V4L A;  4DLQ A;  4OVV A;  1EFA A;  1QP7 A;  2X6H A;  4I6E A;  2IU1 A;  2V0P A;  1HXI A;  4C9B B;  3MLF A;  4FJY A;  4MLP A;  3SBT B;  1TJF A;  1ZS4 A;  1HZ4 A;  3FUL A;  2C2L A;  2LO6 A;  4PU8 A;  4UWK A;  5A7L A;  3HHM A;  3CVX A;  4I1A A;  2HYZ A;  4GZ5 A;  1ZZB A;  4X4H A;  1CQT A;  2VGX A;  1U3C A;  3CVU A;  3MKQ A;  3JXD L;  5D0Q D;  3CVP A;  3TGO A;  3D9L A;  4XIF A;  2E2E A;  3EUS A;  1OWN A;  2VYI A;  3EDT B;  3FWV A;  4EZJ A;  4JHK A;  5CCL A;  3D1N I;  4AJW A;  2LYP A;  2XPI A;  3FDH A;  3MJW A;  4BTB A;  1ADR A;  4CGW A;  4AV7 A;  4ACK A;  2R59 A;  5E76 A;  4FAD A;  1JWL A;  1Z6T A;  2L9B A;  1AU7 A;  4GMJ A;  1PRV A;  1PY1 A;  1SZ9 A;  2I1K A;  4KZ0 A;  3URZ A;  3CVY A;  2IOS A;  5KJK A;  4XE0 A;  2L6J A;  3QWW A;  1X2L A;  5AIJ A;  4AY6 A;  5FZS A;  2WMN A;  4BT9 A;  2L8N A;  4UI9 K;  4JA9 A;  3JXC L;  3JQ0 A;  4GCO A;  5ANR A;  1JUQ A;  3IHV A;  3PE4 A;  3QAQ A;  4KZC A;  2XSD C;  3FH8 A;  4MCX A;  4PUC A;  3G5G A;  4KBQ A;  2WXK A;  3HVE A;  3QWG A;  2XRY A;  4J1X A;  4AIF A;  3PH0 C;  2WXH A;  4F3V A;  4JW1 A;  4X4B A;  3QC1 A;  3C98 A;  3GZ1 A;  4L1B A;  3LFP A;  1ZPQ A;  4J6I A;  3ONK A;  4AOF A;  4WUY A;  5G05 C;  3KD7 A;  5KJM A;  4G23 A;  2R63 A;  4CDR A;  4GYY A;  2D5V A;  2MRI A;  3L1P A;  3D3M A;  4FJZ A;  2DIW A;  2A6C A;  1LMB 3;  2KCV A;  3FEX A;  4FLH A;  3S7D A;  2XCB A;  1XNF A;  3JUI A;  4IA8 A;  5JJ6 A;  2OFY A;  1FVH A;  2LSU A;  5C2Y A;  3QNK A;  4DLO A;  5K98 B;  1YA0 A;  2AUW A;  3B7T A;  3PZD A;  3OTN A;  1MQS A;  2PE5 A;  4KMO A;  4L7T A;  1JPL A;  4OVU A;  1FVF A;  4CT0 A;  3B7S A;  3HYM B;  2GRL A;  4CGV A;  1ZZC A;  2J4B A;  4N5C A;  4FA6 A;  4WNE A;  1QP0 A;  3HVE B;  4F8D A;  3FMY A;  1E90 A;  3CK8 A;  3JCK C;  3L6A A;  3ZGQ A;  5M72 A;  4FP7 A;  3QWV A;  5LOZ A;  4JVS A;  2R17 C;  3QB2 A;  3DNV B;  4YBA A;  2C0M A;  3KJX A;  3CSF A;  4WNG A;  3UX4 A;  2FEZ A;  4CT4 A;  5BPP A;  3ZFW A;  3PDN A;  3F6W A;  4UQX A;  2AVP A;  3E4B A;  3APD A;  4I1O B;  3BD1 A;  1H19 A;  1HE8 A;  3SCG A;  1RIO A;  1B0N A;  2Y3A A;  2L0T B;  3FYA A;  4J8S A;  3U3W A;  5T3R A;  4HOS A;  2KEJ A;  2HO1 A;  4KT6 B;  2XHE A;  3APC A;  3MEK A;  2XIU A;  3G2U A;  3R9A B;  2QY7 A;  1XWR A;  3EJN A;  3RRM B;  4A55 A;  3OMT A;  3FEY A;  4BX8 A;  4N3C A;  2FJR A;  1RPE L;  1UG3 A;  3QKY A;  4NUR A;  1IQU A;  2O49 A;  3JYS A;  4BFR A;  3ASG A;  2GZU A;  1HFA A;  3ESK A;  3CRO L;  3ZHE B;  4J0U A;  1PRA A;  3L16 A;  2X38 A;  2ICP A;  3SFZ A;  5FT9 A;  2M63 A;  3CQC B;  1H6K A;  2AXZ A;  2XGS A;  4AXH A;  2L0I A;  2XI8 A;  1VPW A;  5EX3 A;  4DPR A;  5BNW A;  3WXX A;  4GA1 A;  3RRN B;  3CKB A;  4RG6 A;  3AU5 A;  4B8A A;  2WXP A;  4IUL A;  2CHW A;  4L2Y A;  1QNF A;  4U0S A;  3SCH A;  3OQM A;  3FUK A;  4JZY A;  3PNL B;  4N3B A;  3TG5 A;  3UT4 A;  4UQY A;  1TEZ A;  3KAE A;  3QK0 A;  3CGH A;  3QOU A;  4WWP A;  1QQB A;  1HH8 A;  2CFZ A;  2KAT A;  3TL5 A;  5A23 A;  3KS2 A;  1JWG A;  1ZAY A;  2JEK A;  4V3I A;  3ZHI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...