2AXVA

Structure of prgx y153c mutant
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
302
structure length
302
Chain Sequence
b'FKIGSVLKQIRQELNYHQIDLYSGIMSKSVYIKVEADSRPISVEELSKFSERLGVNFFEILNRAGMNTKSVNETGKEKLLISKIFTNPDLFDKNFQRIEPKRLTSLQYFSIYLGYISIAHHYNIEVPTFNKTITSDLKHLYDKRTTFFGIDCEIVSNLLNVLPYEEVSSIIKPMYPIVDSFGKDYDLTIQTVLKNALTISIMNRNLKEAQYYINQFEHLKTIKNISINGYYDLEINYLKQIYQFLTDKNIDSYLNAVNIINIFKIIGKEDIHRSLVEELTKISAKEKFTPPKEVTMYYENYV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PrgX
publication title Structure of peptide sex pheromone receptor PrgX and PrgX/pheromone complexes and regulation of conjugation in Enterococcus faecalis.
pubmed doi rcsb
source organism Enterococcus faecalis
molecule tags Transcription
total genus 118
structure length 302
sequence length 302
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01381 HTH_3 Helix-turn-helix
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 2axvA01
1.25.40.400 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2axvA02
3GN5A 2IUOA 1O4XA 2B5AA 2HSGA 2LYQA 3IVPA 1X57A 4X4GA 1JH9A 3TRBA 4MCTA 1UTXA 3ZKCA 3KJXA 1RZRD 2EF8A 1BDHA 3OQMA 3QF3A 3FMYA 3LISA 4FN3A 3FYMA 4Z5CA 2LYLA 1YSEA 3B7HA 2IVBA 1CJGA 1LCCA 2JVLA 3SCFA 3PXPA 1ZVVA 3EUSA 1ZZ9A 2BNOA 2AUWA 2R63A 2CSFA 4NDWA 2AXVA 2ICTA 3S8QA 1XWRA 1HF0A 3BS3A 1ZS4A 3SCHA 4X4EA 1NEQA 4JCYA 2IV1A 3SCGA 3G5GA 2L49A 4I6RA 3RZZA 1JFTA 1BDIA 3GN5B 1CQTA 1WH8A 3QQ6A 4Y42A 3DNVB 5A7LA 4Z59A 2EWTA 2O38A 4X4HA 1S7EA 1R63A 3QWGA 3OP9A 1RPEL 3KXAA 1QP0A 4I8TA 1JWLA 1ZZCA 4X4CA 4Z5DA 4O8BA 1B0NA 2KEJA 4I6UA 3D1NI 2PPXA 4YG4A 3OQOA 1UXDA 1RIOA 3O9XA 1NERA 1QP7A 4I6TA 4OB4A 1E3OC 2PUEA 3HZIB 4JCXA 2O49A 1UXCA 3BDNA 4YBAA 1RZRA 3L1PA 1PERL 2HINA 3H5TA 5K98B 2EBYA 3OMTA 3JXBC 4Z58A 1PNRA 2PUCA 4JQDA 3LFPA 1GT0C 2IU7A 2AWIA 1QPZA 4GHJA 1Y7YA 2FJRA 4PU3C 1QP4A 3GBFA 2LYSA 2XJ3A 3MLFA 2AXUA 2KEKA 2D5VA 1X2LA 2PUGA 2LCVA 2IVQA 3BD1A 1ZPQA 3UFDA 2PUDA 2O4AA 1ZUGA 1Y9QA 1ZZ8A 1EFAA 2JCGA 1POUA 1WETA 1LMB3 4IWRA 3CECA 4X4BA 1IC8A 1LCDA 3FYAA 2XCJA 1QQAA 2XIUA 4J1XA 2H8RA 3VK0A 2XSDC 2R1JL 4J1WA 2ICPA 3F6WA 2LYKA 1AU7A 3QYXA 2BNMA 1DWKA 2MQKA 1WH6A 1OCTC 2PUAA 3R1FA 2KPJA 4PU4C 3G7DA 3JXCL 1SQ8A 3U3WA 1WIZA 4X4FA 2IVGA 1LLIA 4X4DA 4X4IA 1LQCA 2PUBA 2BJCA 3ZHMA 2LYJA 1QQBA 2XI8A 1PRVA 1OSLA 3ZHIA 1RZSA 2GRMA 4IA8A 2OR1L 2OFYA 2LYPA 1L1MA 2KEIA 2KZ8A 1ZZ6A 3JXDL 3KZ3A 1PRAA 2LYRA 1PRUA 1ADRA 4YG7B 2GRLA 2CROA 3F51A 3CROL 2GZUA 4F8DA 1ZZBA 1ZZ7A 4YARA 4Z5HA 3CLCA 2PE5A 2BNNA 2A6CA 1JFSA 1VPWA 2PIJA 1ZAYA 2L8NA 4GQMA 1DW9A 2AXZA 2WIUB 4MCXA 4IVZA 4FBIA 4YG1A 3OQNA 1R69A 2AW6A 2PUFA 2WUSR 3F52A 4PU7A 2MEZA 4PU8A
chains in the Genus database with same CATH superfamily
3SFYA 2QFCA 2X6KA 3UM3A 1A5EA 3F6QA 1X57A 3AS5A 3ZKCA 4ER0A 5AN8A 1HU3A 4BEPA 3UI2A 1SZAA 2J07A 3QAQA 2AUWA 4ANUA 3NB2A 2IV1A 1WH8A 4FJZA 5T8IA 4HI8A 3OAWA 3OP9A 5JHBA 5EX0A 2L0TB 2DZNA 2J7WA 3PNTB 5CERB 4G11A 3SBSA 1QNFA 2H6IA 4JCXA 3BEEA 4JD2G 2KXPC 5AJDA 2FFHA 2IU7A 2PXPA 5CRUA 1Y7YA 3FEYA 3TJPA 3L54A 3MCXA 4YVOA 4LCTA 4N3AA 1INZA 2IVQA 3BD1A 1ZZ8A 3D9KA 2JCGA 5AJLA 2C0LA 1QZ2A 4LSZE 3JXIA 3IV0A 3LVRE 2XCJA 4RSYA 3K9IA 4Y6CA 4JC8A 4BSXA 1OCRE 2IVGA 2KZTA 2ILRA 4X4IA 1N9AA 4G2VA 2I6HA 3AU5A 3JCKC 4O1OA 1H19A 4JEHA 2LYPA 5T3RA 1BU9A 4LNBA 1Y6IA 1DCQA 2HE0A 3A9YA 3DPDA 2GZUA 3HG0D 2YBDA 1HS6A 3GZDA 3AU4A 2RFMA 3ESKA 2HFZA 1BDHA 3TXNA 2IOSA 2VYIA 2Y0BG 1JH9A 2IY0C 3AS8A 2J08A 2XS8A 4Q96A 1MX2A 3LISA 4I2WA 4XI0A 1BD8A 3ONLA 2L9BA 5HKPA 4NDWA 3S8QA 1TJFA 3SCHA 1BI8B 5DIZA 2IJGX 1DULA 1MHQA 3IHVA 1CQTA 1HO8A 1D8DA 1DVPA 2C2LA 3UKUG 5FTPA 2WMOA 1JCRA 3RSEG 4I9EA 2V5QC 5JA4D 4J8DA 1KT1A 3FFLA 5FQ4A 3PE3A 3QNKA 3VLFA 3GBFA 2H6GA 2IU1A 5AYWD 2DCPA 3A9ZA 4ER5A 3DWLG 4RG9A 2P9UG 3CVYA 3CECA 2MRIA 2PXKA 5CBNA 2XSDC 3P2BA 4JZYA 2LYKA 5EYLA 4V3IA 3BG0B 4U0SA 4MKTA 3LY9A 4ATGA 2LLWA 4X4DA 4OBMA 4DLQA 2QYUA 1LQCA 2VSOE 4K5AB 2HCNA 3ZHIA 1TNUA 3PS6A 3DXMG 4RVBA 2ZISA 3SR4A 4HOQA 4AY5A 3Q79A 2XPIA 2LO6A 3F51A 2PE5A 5AQ7A 4JVSA 3R7RA 5HQ8A 5KJMA 2M63A 2L8NA 3DSTA 4AVXA 4FADA 3OXGA 4HS2A 3ZPJA 1OWNA 3IXEA 3CK9A 1O4XA 1E7VA 3MX3A 3FTUA 3G2TA 3AS4A 1WDYA 2VSYA 1OXJA 3RK6A 2AXVA 3Q7AA 4CT0A 3G5GA 4I6RA 1JFTA 1QYMA 1E8WA 3FTWA 3RO2A 3U64A 3C72A 2O38A 4U63A 3QWGA 1RW2A 2GGFA 2MHKA 4XIFA 2UWJG 1TN6A 4PH4B 1B0NA 2KEJA 4I43A 4EKGA 4GTTA 4KVOA 3OQOA 3O9XA 3N71A 2QC9A 1E3OC 3NBNB 3VLDA 1HFAA 2F37A 4N3BA 4AOFA 4CDRA 5BUZA 2CG3A 3SQVA 2IF4A 3CGHA 3FH5A 5ENRD 4F3VA 2PUGA 2H6FA 2X6FA 4Q94A 3UT8A 4X4BA 3FYAA 3GZDC 2OEWA 2XPYA 4UQZA 1N4QA 3A9XA 1DWKA 1HG5A 2E0IA 2VGXB 3L9TA 2B0OE 2QZAA 4IA8A 1SA4A 5BW8C 2YINA 1O1RA 4BESA 4AXHA 2LLVA 3L08A 4LNUD 3SI5A 1N0RA 1ZZ7A 5CBOA 1E96B 3V31A 2X38A 1HXIA 1R69A 2AW6A 3UIPC 5FJYA 3EHQA 4BT8A 2YHEA 4XE0A 2B5AA 4L23A 3L13A 3RRMB 3CVPA 4L9PA 3LDZA 4MLPA 4ANXA 4GMRA 3PXPA 1ZVVA 4NRHB 4HXIA 3TWTA 4D10C 3CVNA 1TJCA 3NZLA 1N52A 1BDIA 1TN8A 3GZ2A 1TNBA 1NA3A 1R63A 3I3NA 1OWPA 1WAO1 1YMPA 3CHQA 3RU0A 1U3CA 4U95D 4ZFHA 1MJ0A 5GAHi 3DEOA 4DX7D 3DXKG 2EIJE 5ENTD 4YG4A 1IKND 2V0PA 1UXCA 2J49A 2RG8A 2VSXE 1MQSA 4TXRA 4G25A 1K1BA 2XJ3A 3MLFA 2VGXA 4G8LA 3FP3A 3GZ1A 4R7LA 3Q9UC 3RJVA 4F6RD 3NDBB 2L6BA 2O4AA 1Y9QA 4JHRA 1WETA 5ARGA 2LAIA 1N94A 2F8XK 3BG1B 2MQKA 3FUMA 4FLHA 4WAFA 5FQ7A 3TWRA 3MKRA 5EX3A 4KMOA 1N4RA 2BJCA 1EPUA 3TAXA 2VQ2A 4ME2A 4ATZD 3CQGB 3CR3A 4AM9A 2WXLA 2BKGA 1W3BA 3TWVA 4DRXE 4EBAG 2KCKA 4H7YA 4G24A 4F8DA 2A6CA 1TYQG 2IEJA 2GRRB 4IVZA 4YG1A 5A23A 1OWLA 2XHEA 2IUOA 3GYZA 3O4ZA 3WXXA 2LNMA 2I1JA 4UQXA 3PZ3A 4IN3B 3NQPA 3EHNA 1GW6A 2BKKB 2DZOA 3KL4A 1HQ1A 4DK5A 3Q9NC 2KCVA 3B95A 4X4EA 3TL5A 4JCYA 5EN5D 2L49A 3ML8A 4CYMD 3D9PA 4IULA 3FUDA 3ZUVB 3ZPXA 4BETA 2P9PG 4CRWA 2WPVA 3ZRHA 4WUYA 4XKBA 4RLYA 3ESLA 2ZXWE 3Q7FA 4F53A 3Q4AB 3T8MA 1QP7A 2YHCA 1H0AA 1OCZE 3PE5A 3EIQC 3FU0A 4UUCA 3PRZA 3OXLA 5CMWA 4K5CA 3AG1E 4UWKA 1MX4A 4Q69A 2HYZA 3ZEFA 5A6CA 2BEDA 3LXUX 1O1SA 3G2WA 2XZDG 2M4HA 4XZ4A 2X6IA 4J1WA 1E8XA 4I2ZA 3ASOE 2BNMA 3NOCD 1SVXA 2IOLA 3DPYA 3UWPA 3U3WA 4XEIG 3V2XA 2GRNB 1N4PA 1H6PA 4DUIA 3KZ3A 5KJNA 1DCEA 4N39A 4J8FA 2R2LA 2LSVA 2RKKA 3J5PA 4ILGA 3CHOA 3DSWA 3S2AA 3L17A 3D9HA 4ZHBA 5DSXA 2EILE 2A5UA 4GTMA 3FTSA 2OEVA 3UUXA 2CFZA 3HXBA 3RKVA 2Q7FA 4MCTA 5FWQA 2HM8A 1N11A 3CIAA 2WXPA 4A1SA 3B7HA 2IVBA 1LCCA 4GYOA 3AG3E 4QFVA 2L6JA 2XEHA 3D9IA 2AVPA 1NEQA 4BSZB 3TGOA 1HF8A 4Y42A 2JABA 5G05J 1QBQA 5DTRA 3LPZA 3ASFA 1QP0A 1U2VG 2YQ8A 4PUCA 1NW3A 4A63B 3E4BA 1RIOA 1ELWA 3R9MA 5DTQA 3BDNA 1MYOA 3NZUA 3H5TA 4PS7A 3ZU7B 4E6HA 3CVQA 3B7UX 4BERA 1N54A 3APCA 2LYSA 4UWHA 2KEKA 3E30A 2PXLA 4U7EB 2PXUA 4B89A 4FC8A 3SX0A 3S7JA 3C3QA 1XGWA 3IEGA 2R1JL 2EIKE 2JEKA 3F6WA 3Q15A 3PDNA 3LVQE 4A55A 3S7DA 4DJAA 3E33A 3EDTB 3ZNGA 3QK0A 2OVBA 1FT1A 1UN8A 2RD0A 4JHJA 3W9GA 2OR1L 3G2SA 1L5JA 3QFIA 5FQ8A 1U3DA 2IONA 4M3OA 1ZZ6A 1PY1A 4HB5A 4HNAD 5AARA 2V8SE 2BNNA 4I6GA 4O1PA 3CVLA 1HX8A 1MZCA 1QPZA 2WIUB 3FTVA 3LCAA 2P9SG 5AAOA 3V30A 4X4GA 1SZ9A 4WNEA 4OVUA 2IFUA 4ANWA 3KJXA 3TG5A 4EHMA 4J6IA 2C0MA 2J4BA 3DM5A 3AG4E 1EYHA 4EZKA 2LYLA 3FTXA 3CKBA 1XWRA 2FULA 4FA6A 5GAGi 2EINE 2FBNA 3R09A 2I1KA 3UM1A 4AEZC 2XEVA 4F1PA 4CGVA 2JQEA 1RZ4A 4UI9J 1UG3A 1E7UA 4JHKA 5C1DA 4YVQC 4U8HA 3BU8A 4Z5DA 3ZW3A 3D1NI 4HRNA 2PPXA 1PC2A 3LY7A 4UWFA 3RAUA 2FI7A 3JXBC 3LY8A 5BT1A 1FCHA 4DPRA 4LRZA 4HRLA 4DX6D 4GYYA 4L7TA 1LTXA 2FF4A 3UM0A 4PS3A 1B89A 4UWLA 3B13A 3TXMA 5FQ6A 4BTBA 5EYPF 4NQ0A 2WQHA 5AQ9A 4H7XA 4P29A 3ZYQA 4X4FA 2P9NG 2LUHA 3E37A 3ZGQA 2WXHA 2KZ8A 3JXDL 4WWPA 4J0UA 4N5CA 5JJ6A 5FINA 1TNZA 2CHXA 2FEZA 2WUSR 4Z68A 3FUKA 3OTNA 3ULEG 2J4DA 4ABNA 4CCAA 3MGBA 1RZRD 3QF3A 3MZLB 2JVLA 3SCFA 2PXVA 5EKQD 3EUSA 2R63A 4AV7A 4I1MA 4N5QA 4FHKA 2KBXA 3HHMA 3GN5B 2YNQA 4Z59A 3L82A 3FUNA 2KCLA 3FHEA 1RPEL 5ANLA 4EZIA 1UW4B 2X3MA 5KJLA 5CCMA 1S63A 5FZQA 1JCQA 2XEEA 5G04J 4U96D 2HINA 4TXQA 4Z58A 4JQDA 2LNIA 5ARFA 3TELA 4URKA 3KAEA 3HVEB 4PDXA 3HXCA 2ODRD 1WY6A 5D0OD 3SBTB 3PREA 1XNFA 1BPOA 1QQAA 3OXFA 3CKCA 3CHRA 5EILA 2ICPA 4M7CA 3JXJA 3J5QB 1KLXA 2DVWA 5EIBE 3PE4A 1DC2A 3QOXA 2DWZA 4YDEA 1NZNA 4K0RA 2P9IG 2LXMA 4Y6WA 2PXDA 5G05C 5CEDB 1KZPA 3NZSA 5D66A 4OVVA 3FUEA 4ER7A 1FPPA 4GQMA 4MCXA 3PZ1A 3F52A 5ENPD 3GN5A 5E76A 2WQ6A 1E8YA 1ELRA 3ABKE 2WXMA 2A5EA 1KT0A 2I9CA 5DRYA 5DT2A 3ZN3A 4NURA 3W9FA 2ETBA 4C0MA 3V79K 3HXFA 5C2YA 4AP2A 4DE8A 4KBQA 3CVUA 3Q75A 1S7EA 3PNLB 1LD7A 3WG7E 3HVEA 3VLEA 2XS1A 1FVFA 4I8TA 4TUUA 4BWRA 3JUEA 4I6UA 4X8QA 4CEMA 1UXDA 1OCOE 3CLJA 2L1PA 3ZVVA 1PNRA 3KEZA 3LFPA 1E8ZA 2FJRA 3PEUB 4G1TA 2D5VA 5G2NA 1AP7A 4J7WA 3TWQA 1OY3D 5ENOD 4FP7A 4J8SA 2PNNA 3PZDA 5T4YA 3T9KA 1LMB3 3DSVA 2E2EA 1K3ZD 1ELKA 3HIZA 2PUAA 3KSLA 3UX4A 4BT9A 3FUHA 5DRTA 2WXGA 4I17A 4BY6A 4J8EA 3ZXPA 2PM7A 4DX5D 1MX6A 4RQIA 2QY7A 4UI9C 3KSQA 2VGEA 2WVIA 2GRLA 4A3VA 3SGHA 4DI3A 1YA0A 4MS6A 3ULQA 4OAVB 3UIOC 3TEPA 2AXZA 4LG6A 2MYOA 3SFXA 4LUNU 3R1FA 3ISMC 4B94A 3D9LA 2BUGA 4HVBA 5KJKA 4MRUA 4HI9A 3FDHA 5D0QD 5KNGA 2DIWA 4UQYA 5B3SE 3FMYA 4GAAA 2JLBA 1CJGA 3L6AA 3MEJA 3B7BA 3CK8A 3FUIA 3ZKJA 3ZYMA 3E32A 3SCGA 2UY1B 2WXFA 3DSXA 3RRNB 3DNVB 3KD7A 4UI9K 2EWTA 4FHJA 2LSUA 3TG4A 3D9JA 4IRUA 5ANRA 2I2OA 1X81A 1QQEA 4GU5A 3C3RA 3LS8A 2CHWA 3LYAA 3VWSA 3RO3A 2WXOA 5M72A 2EBYA 1OT8A 1G3NB 5LFAA 3I4RB 1GT0C 3AG2E 3FUFA 4PU3C 2R59A 5LOZA 4GZDA 3VTYA 3HYMB 2PUDA 1ZU2A 2XZTG 1H2UA 5A7DB 3P1UA 1FVHA 2H8RA 3VK0A 3ASGA 3SF4A 1OCTC 4PU4C 4EK9A 3T5VA 1WIZA 2PXFA 2GW1A 2F8YA 3NF1A 3S7BA 1S64A 4U8YD 4UWGA 3JQ1A 5AQAA 1S0PA 4TV3A 3G2UA 1TR4A 2PQRA 1H6OA 1PRUA 1ZB1A 3G2VA 3HRAA 2XENA 3UINC 1D8EA 4YARA 3FUJA 4AJWA 5G04C 1DW9A 2UY1A 3C5RA 4ER6A 4ILHB 4WNDA 5FZRA 3FU3A 5B1AE 3I4GA 4NACA 3U4TA 4GZ3A 4I6EA 4A1GA 4RG6A 4ILIA 4PS8A 3S7FA 2NXPA 3CK7A 1DNPA 5DTMA 1H2TC 3BUAA 3C3OA 2EIME 5A7LA 3FH8A 3SO8A 4GCNA 4HLLA 4CDNA 2NC9A 3FY4A 3ZYKA 3JYSA 4BX9A 5LCWJ 1NA0A 2OVFA 3UPVA 1IQUA 1JWLA 1MFQC 3UTMA 4O8BA 1V55E 1Z3YA 4GYWA 4U0ZA 3HZIB 2ZGGA 3OMTA 3TWXA 2GRQB 4GTOA 4U07A 4AIFA 3MV3B 2AWIA 4GHJA 1V54E 4CT4A 2ETAA 4ANVA 4C9BB 4JL0A 2LCVA 4F1SA 3UFDA 3CEQA 2V4HC 4HRMB 2Y4UA 1IC8A 1LCDA 4U8VD 3APDA 2DYRE 2R05A 1IHGA 3DEPA 3IHYA 1WH6A 2J09A 1IXVA 2KPJA 4B8AA 4E85A 3CV0A 5EIDA 3QWWA 2WM9A 1A17A 3ZHMA 5BV1A 1K1AA 2LYJA 3Q47B 1L1MA 3FU6A 5IY5E 1UN9A 2MOWA 3UT7A 3EJNA 2V5FA 3SFZA 3CROL 4I1OB 5FIOA 2CHZA 2PIJA 3QOUA 4HOUA 2DYSE 4X4HA 4PU7A 1S70B 2HSGA 5KWDA 2R17C 4G23A 3T5XA 1EDUA 2WXJA 4HBDA 5LX8A 5CHEE 3OWQA 3UKRG 4J8YA 4B0ZA 1Z3XA 3UM2A 3BS3A 1N0QA 1ZS4A 2V4LA 4EECA 3ASDA 4GPKA 3RZZA 3QQ6A 4KXKB 1UJJA 3FTYA 1HZ4A 4DX1A 3EU5A 3QDNA 3U66A 4NIKA 2VTBB 4U0UA 2ZU6B 1ZZCA 5CCLA 3U9WA 4YDOA 3HXEA 4BFRA 1RZRA 2KATA 3L1PA 5K98B 3Q5MA 3CVXA 5CRVA 5FZSA 3IBEA 3NXHA 4CZ2D 4QQIA 2XXQA 2VJ8A 1Q2ZA 1QZXA 2XQ0A 3UT4A 1OWMA 4N2QA 4FULA 1JWGA 2XIUA 3MEKA 1NL4A 3QYXA 1H6KA 2PXQA 4I9CA 3DRAA 4JW1A 3JXCL 5AENA 3CSFA 2IO3C 2PL2A 4C48B 1SQMA 4OYSA 1RZSA 1KPSB 4FU3A 3C98A 1Z6TA 3NOGD 2P58C 3FWVA 4EBAA 1HG2A 4F7AA 3FULA 3CHPA 2XGSA 3PEVB 2F0YA 3MJWA 1NFIE 1O1TA 4WWOA 3DBSA 4HLEA 2QYJA 2P2CP 5HI7A 5HRYA 5CECB 2Y3AA 3QC1A 1TEZA 3JUIA 1UOHA 1P5QA 2J8SD 2WXRA 2VTBA 1K8KG 4Z5CA 1WM5A 3FYMA 1OCCE 4N2SA 3EHMA 4IYPA 5JMND 2VSNA 3SY2A 2GROB 4GZCA 2PXBA 3NROA 1X5BA 4KVMA 3UMVA 1FT2A 3GZCA 3AAAC 3R7QA 4JA7A 5KNHD 1LF8A 2J9QA 4DLOA 3LQXA 1ZBPA 4GTPA 4BX8A 1AWCB 3ZYLA 4KYOB 3ASNE 4HOTA 3I5PA 1X2LA 5ENNA 1IHBA 4DE9A 2L0IA 4KZCA 5FT9A 5BNWA 3APFA 1VDYA 2ZGDA 5B1BE 4ACLA 3QWVA 5J90A 2R5SA 4CGWA 2XRZA 3SHFA 3L16A 4B8CB 3D3MA 4L2YA 3LJ3A 4WWNA 2PUBA 3KEAA 2V3CC 4GPMA 1TNYA 4GTQA 3V2OA 3X2QE 5HS0A 1HE8A 5D2MC 2KEIA 2B6CA 4FJYA 5LCWC 3DSUA 3EIJA 1Z5SC 2FO7A 3EHRA 2OCCE 2P9LG 5ENSD 1NP7A 1JFSA 1VPWA 2Y69E 3D9NA 3OQNA 3ML9A 4MBGA 2OV8A 3URZA 2XXAA 3IVPA 3B7TA 1UTXA 1JUQA 4ER3A 5CEAA 3ONKA 5JJ7A 2ONDA 3B7SA 1YSEA 2KM4A 5H7PA 2ETCA 2WXIA 3NAWA 3AJIA 3CVVA 3ZHEB 4DX2A 4LNGA 4BTAA 4GTVA 3TWUA 3T8KA 3GUUA 2DBAA 3ZIMA 3BQOA 4C0EA 2BF0X 4G8KA 1YYHA 2BTDA 2WB2A 4LERA 4G26A 3Q78A 1OUVA 2GRPB 2XRYA 4AY6A 2XGMA 3RIBA 4LEUA 4O60A 3PUKA 2O49A 3TWWA 2CFUA 3PZ4A 3RRUA 2PUCA 3MA5A 5JHAA 5E75A 4K03A 2AXUA 1JWFA 2VGYA 3PH0C 4OAUC 4HORA 1ZUGA 4Q2JA 4XKCA 2XPZA 4YDYA 4GTSA 3FEXA 4FLBA 4I1AA 4TUMA 1AU7A 2LXLA 4WNFA 4TXPA 4EPZA 3O48A 1TNOA 4XI9A 3JQ0A 3E34A 3ASHA 3FTZA 4GA2A 1SW6A 4WNGA 1QQBA 3TFLA 1PRVA 4B93B 2XCCA 5KBAA 2CG2A 2XGOA 5AIJA 3ULYA 2Y1LE 1PRAA 1ADRA 2WXNA 2EQXA 2KC7A 3IKOB 5EDSA 2FO1E 1JCSA 1OWOA 3ZHEA 4HOSA 1ZAYA 1N4SA 4W9RA 2PXTA 3ABME 1QB2A 4FBIA 2PUFA 4PU8A 4EQFA 1KZOA 3ME5A 3TRBA 3ZFWA 2NYJA 4KT6B 3LKUA 4WVLA 3UQ3A 2X6JA 2HR2A 4FN3A 4EKIA 2WQ7A 1HF0A 1H2VC 1LD8A 4O6FA 5CMYA 3SZ7A 3CSTA 4XX5A 1O5MA 3GW4A 4JPSA 3HXDA 4APFA 3KXAA 4GZ6A 2WMNA 2XCBA 4CDMA 1IYGA 4YDWA 2OOEA 4L2LA 3FH7A 4I6TA 4OB4A 1PERL 3GZSA 4GMJA 2HO1A 4ACKA 2IO2C 3OKZA 2AJAA 2RFAA 1NI1A 1QP4A 1UJKA 3QARA 3D9MA 3Q49B 4JA9A 3SD5A 4I6JA 1ZPQA 1EFAA 2PZIA 1POUA 4IWRA 4GCOA 4JEUA 2HCSA 3CQCB 3ZXSA 3HDXA 4GB9A 1JPLA 2ZIRA 1SQ8A 5DBKA 1WG0A 3QB2A 3Q73A 4U04A 3QWPA 1BLXB 3PUJA 3QJZA 4JB8P 2OFYA 4JXTA 5G55A 3CHSA 5JUWA 2J7UA 4YG7B 3MV2B 2CROA 4GZ5A 1ZZBA 5KCMA 3G0TA 4N3CA 3EU9A 3PVLA 2LAHA 1N95A 4YBAA 4GA0A 2LYQA 1PAQA 3EUVA 4EZJA 3D9OA 2EF8A 3MKQB 4GMLA 3OQMA 1YCSB 4YNDA 4DI4A 4TRQA 1ZZ9A 2BNOA 2CSFA 3PZ2A 2ICTA 3SNXA 3L22A 4APOA 3TWSA 4GA1A 1U2ZA 2P9KG 4L1BA 5AQBA 1Y8MA 2PM6A 5BPPA 3LJNA 5JJTA 2PXEA 4X4CA 3MYVA 3ENEA 1NERA 2PUEA 2MXDA 3M9LA 5BV0A 4HFGA 4HRAA 2WXQA 1D9SA 3CVWA 2X6HA 5BXUA 2VEOA 1HH8A 3R9AB 1SA5A 4EZLA 2Y4TA 3UXGA 3KS2A 3LEWA 4J1XA 3QKYA 3ABLE 1E90A 2IQCA 4GTRA 3G7DA 5ITZF 1LLIA 4K5BA 5LP0A 4KZ0A 4A3TA 2A4ZA 4HQDA 3QOWA 3B7RL 1IQRA 2XI8A 2GRMA 2PQNA 2WXKA 3DSSA 1TN7A 1BI7B 3MKQA 4EQZA 2LYRA 2R02A 5ENQD 1EF1C 2NSZA 2H6HA 4Z5HA 3CLCA 3CHMA 2KZTB 5BXOA 1OSLA 2R03A 5J08A 2MEZA 3VTXA 2XXPA 3FU5A
chains in the Genus database with same CATH topology
2XHEA 3GN5A 2IUOA 2QFCA 2X6KA 3GYZA 3QC1A 5E76A 2WQ6A 3O4ZA 1TEZA 1X57A 3JUIA 3WXXA 1P5QA 1E8YA 3AS5A 3ZKCA 2I1JA 1ELRA 2WXRA 2WXMA 4UQXA 4Z5CA 1KT0A 3FYMA 1WM5A 2I9CA 1HU3A 2VTBA 4IN3B 3NQPA 1SZAA 3EHNA 4N2SA 2J07A 1GW6A 3EHMA 3QAQA 4IYPA 2AUWA 3ZN3A 4NURA 4C0MA 4ANUA 2VSNA 4DK5A 4GZCA 2KCVA 5C2YA 4X4EA 3TL5A 4JCYA 4AP2A 2IV1A 2L49A 3ML8A 1X5BA 4KVMA 3D9PA 4KBQA 1WH8A 3FUDA 4IULA 3CVUA 4FJZA 5T8IA 1S7EA 3OAWA 3PNLB 3UMVA 3HVEA 3VLEA 5KJMA 3OP9A 2WPVA 4CRWA 1FVFA 3R7QA 4I8TA 4JA7A 4TUUA 3ZRHA 5JHBA 4BWRA 4WUYA 1LF8A 4XKBA 2J9QA 3ESLA 2L0TB 5EX0A 4DLOA 4I6UA 3PNTB 4F53A 1ZBPA 3Q4AB 4G11A 1UXDA 3T8MA 4BX8A 4CEMA 1QP7A 3SBSA 1QNFA 4APFA 2YHCA 4JCXA 1H0AA 3CLJA 3EIQC 3FU0A 3BEEA 5AJDA 3ZVVA 1PNRA 3PRZA 3KEZA 3ZYLA 3LFPA 1E8ZA 3OXLA 2IU7A 5CMWA 1Y7YA 2FJRA 4KYOB 4UWKA 3FEYA 3TJPA 4HOTA 3PEUB 3L54A 3MCXA 3I5PA 4G1TA 4YVOA 2D5VA 1X2LA 5G2NA 4Q69A 4LCTA 4N3AA 1INZA 2HYZA 2IVQA 3BD1A 4TRQA 4FP7A 4J8SA 5ENNA 3ZEFA 1ZZ8A 3D9KA 3PZDA 5T4YA 2JCGA 5A6CA 5AJLA 3LXUX 2C0LA 1QZ2A 1LMB3 2L0IA 3IV0A 3G2WA 2XCJA 3LVRE 4RSYA 2E2EA 4KZCA 3K9IA 5FT9A 5BNWA 4XZ4A 2X6IA 1ELKA 4J1WA 1E8XA 3APFA 1VDYA 4Y6CA 4I2ZA 4JC8A 4HOSA 4ACLA 3HIZA 3QWVA 5J90A 2BNMA 2R5SA 2PUAA 4BSXA 3UX4A 2IOLA 4CGWA 4BT9A 3U3WA 3SHFA 2XRZA 3L16A 2IVGA 4B8CB 3D3MA 4L2YA 2KZTA 3FUHA 2ILRA 4X4IA 3LJ3A 4WWNA 2PUBA 2WXGA 4I17A 4BY6A 4G2VA 2I6HA 4J8EA 3AU5A 2PM7A 3JCKC 1HE8A 1H19A 4JEHA 2LYPA 5T3RA 2KEIA 2QY7A 4UI9C 4FJYA 5LCWC 3KZ3A 3EIJA 1Y6IA 5KJNA 2FO7A 2WVIA 2GRLA 4N39A 4A3VA 3SGHA 4J8FA 3DPDA 4DI3A 1YA0A 2GZUA 2LSVA 4ILGA 1HS6A 1NP7A 3CHOA 1JFSA 4MS6A 1VPWA 3ULQA 3S2AA 3AU4A 3L17A 2AXZA 3D9NA 3OQNA 3ML9A 4LUNU 3R1FA 3ESKA 1BDHA 2A5UA 2OV8A 3FTSA 2IOSA 2VYIA 3D9LA 2BUGA 3TXNA 3URZA 3UUXA 4AJWA 4HVBA 5KJKA 3IVPA 2CFZA 1JH9A 3B7TA 4MRUA 3FDHA 2Q7FA 3RKVA 4MCTA 1UTXA 1JUQA 2J08A 2HM8A 3AS8A 3ONKA 4Q96A 5D0QD 2DIWA 3CIAA 2ONDA 5JJ7A 4UQYA 2WXPA 3FMYA 3LISA 4GAAA 4I2WA 4XI0A 2JLBA 3B7SA 1YSEA 3B7HA 2IVBA 1CJGA 1LCCA 2KM4A 2L9BA 2WXIA 3ONLA 3L6AA 4GYOA 3CK8A 3FUIA 4NDWA 3S8QA 4QFVA 2L6JA 1TJFA 3CVVA 3ZHEB 4BTAA 3ZYMA 3D9IA 3SCHA 2AVPA 5DIZA 1NEQA 2IJGX 3SCGA 2DBAA 3ZIMA 3TGOA 1MHQA 2UY1B 2WXFA 3IHVA 1HF8A 4C0EA 1CQTA 3RRNB 4Y42A 3DNVB 1HO8A 2BF0X 3KD7A 4UI9K 2EWTA 5G05J 1DVPA 2BTDA 2WB2A 4FHJA 2LSUA 2C2LA 4LERA 3D9JA 3LPZA 3ASFA 4G26A 1QP0A 4IRUA 5ANRA 3TG4A 2I2OA 1OUVA 2XRYA 4AY6A 2XGMA 2YQ8A 1QQEA 4GU5A 4PUCA 3LS8A 3RIBA 2CHWA 3E4BA 4LEUA 3PUKA 1RIOA 1ELWA 2WMOA 3LYAA 5FTPA 2O49A 3BDNA 4I9EA 2CFUA 3NZUA 3RO3A 3H5TA 2WXOA 4PS7A 2EBYA 3RRUA 4E6HA 4J8DA 1KT1A 3FFLA 3CVQA 5M72A 2PUCA 3B7UX 5FQ4A 3PE3A 3I4RB 3MA5A 1GT0C 5LFAA 5JHAA 1N54A 3APCA 5E75A 3FUFA 4PU3C 2R59A 3GBFA 3QNKA 5LOZA 3VLFA 2LYSA 2IU1A 4GZDA 4K03A 2AXUA 2DCPA 4UWHA 2KEKA 5AYWD 3VTYA 1JWFA 2VGYA 3HYMB 4FC8A 4B89A 2PUDA 1ZU2A 3PH0C 1H2UA 3S7JA 4HORA 1ZUGA 4XKCA 2XPZA 4RG9A 1XGWA 3IEGA 3CECA 3P1UA 5A7DB 4A1SA 3CVYA 2MRIA 1FVHA 3FEXA 4FLBA 2H8RA 3VK0A 2XSDC 2R1JL 3ASGA 3P2BA 4I1AA 4JZYA 3SF4A 2JEKA 3F6WA 2LYKA 1AU7A 3Q15A 3PDNA 4V3IA 1OCTC 3BG0B 4U0SA 4PU4C 4MKTA 3LVQE 4WNFA 4A55A 3LY9A 3S7DA 3O48A 4ATGA 1WIZA 4DJAA 4XI9A 4EPZA 3JQ0A 3T5VA 4X4DA 3ASHA 3EDTB 3FTZA 4DLQA 2GW1A 3NF1A 1LQCA 2VSOE 3QK0A 4GA2A 2OVBA 4WNGA 1QQBA 3S7BA 1PRVA 3ZHIA 1UN8A 2RD0A 4JHJA 2XCCA 2OR1L 3G2SA 3PS6A 1L5JA 2CG2A 2XGOA 4UWGA 1U3DA 4RVBA 2IONA 4M3OA 5FQ8A 4HOQA 3JQ1A 5AIJA 1ZZ6A 1PY1A 1S0PA 4TV3A 4AY5A 1PRAA 2XPIA 2PQRA 3G2UA 1PRUA 1ADRA 3G2VA 2LO6A 2WXNA 3F51A 2EQXA 2KC7A 3IKOB 4YARA 5EDSA 2PE5A 2BNNA 2V8SE 3FUJA 4I6GA 4JVSA 1OWOA 3CVLA 3R7RA 3ZHEA 1HX8A 1ZAYA 2M63A 4W9RA 2L8NA 5G04C 1QPZA 1DW9A 2WIUB 4AVXA 4FADA 4FBIA 2PUFA 3FTVA 3OXGA 4HS2A 3ZPJA 1OWNA 4PU8A 3LCAA 2UY1A 3CK9A 4EQFA 4ILHB 4WNDA 1O4XA 5FZRA 1E7VA 4X4GA 1SZ9A 3TRBA 3FU3A 4WNEA 4OVUA 2IFUA 3ZFWA 4ANWA 3KJXA 3I4GA 3MX3A 3FTUA 3G2TA 4NACA 3LKUA 4KT6B 4GZ3A 4J6IA 2C0MA 4I6EA 2J4BA 3UQ3A 2X6JA 2HR2A 4FN3A 3AS4A 4RG6A 1EYHA 4A1GA 2LYLA 2VSYA 4EZKA 5LCWJ 3FTXA 3CKBA 4ILIA 4PS8A 3RK6A 2WQ7A 1HF0A 3U4TA 2AXVA 1H2VC 1XWRA 3S7FA 2FULA 2NXPA 4O6FA 4FA6A 3CK7A 2FBNA 1DNPA 4CT0A 5CMYA 3G5GA 3SZ7A 4I6RA 1JFTA 1H2TC 2I1KA 3CSTA 4XX5A 4AEZC 1E8WA 3FTWA 3RO2A 3U64A 5A7LA 3FH8A 3ZYKA 2O38A 4GCNA 2XEVA 3GW4A 4B94A 4JPSA 4BX9A 4CDNA 4U63A 3QWGA 4CGVA 2NC9A 2GGFA 3FY4A 4UI9J 1UG3A 1E7UA 2MHKA 3KXAA 3JYSA 1NA0A 2OVFA 4JHKA 4XIFA 4GZ6A 2UWJG 4U8HA 4YVQC 1IQUA 2WMNA 2XCBA 1JWLA 4Z5DA 4CDMA 1IYGA 4PH4B 4O8BA 3ZW3A 1B0NA 2KEJA 4I43A 3D1NI 4KVOA 2PPXA 1PC2A 2OOEA 1Z3YA 3OQOA 4GYWA 4L2LA 3O9XA 3FH7A 4U0ZA 3N71A 3LY7A 4UWFA 4I6TA 4OB4A 1E3OC 3HZIB 3VLDA 1PERL 1HFAA 3GZSA 2FI7A 4GMJA 2HO1A 3OMTA 4ACKA 3JXBC 3LY8A 4N3BA 4AOFA 4U07A 4AIFA 4CDRA 3MV3B 5BUZA 5BT1A 1FCHA 2AWIA 4GHJA 2CG3A 1QP4A 4DPRA 4CT4A 1UJKA 2IF4A 4ANVA 4C9BB 3TG5A 3QARA 3D9MA 3CGHA 4JL0A 4LRZA 3FH5A 3Q49B 2PUGA 4JA9A 3SD5A 4F3VA 4I6JA 2LCVA 4F1SA 1ZPQA 3UFDA 2X6FA 3CEQA 4GYYA 4L7TA 1EFAA 2PZIA 1POUA 2FF4A 2Y4UA 4Q94A 4IWRA 3UT8A 4X4BA 1IC8A 1LCDA 3FYAA 1B89A 4GCOA 3B13A 3APDA 4JEUA 4PS3A 4UWLA 2XPYA 3TXMA 4UQZA 5FQ6A 4BTBA 5C1DA 3CQCB 1IHGA 3ZXSA 4NQ0A 3HDXA 3IHYA 4GB9A 2WQHA 1DWKA 1JPLA 1WH6A 2J09A 1HG5A 2KPJA 2E0IA 4H7XA 4B8AA 4P29A 1SQ8A 3ZYQA 2VGXB 4E85A 5DBKA 4X4FA 3CV0A 3QWWA 2WM9A 1A17A 3ZHMA 5BV1A 3ZGQA 2WXHA 3QB2A 2LYJA 4U04A 4IA8A 3Q47B 5BW8C 3QWPA 2YINA 3PUJA 2Y3AA 3QJZA 2OFYA 1L1MA 4JXTA 2KZ8A 3FU6A 3CHSA 5G55A 4AXHA 3JXDL 4WWPA 3L08A 1UN9A 2MOWA 4J0UA 3UT7A 3EJNA 2V5FA 4YG7B 3MV2B 2CROA 3SFZA 3CROL 3SI5A 4GZ5A 1ZZBA 1ZZ7A 4I1OB 4N5CA 1E96B 5JJ6A 5KCMA 2CHZA 4N3CA 2PIJA 2CHXA 3QOUA 2X38A 4HOUA 3PVLA 1HXIA 2FEZA 1R69A 2AW6A 2WUSR 4X4HA 4PU7A 2LAHA 4YBAA 5FJYA 4BT8A 2YHEA 4XE0A 4GA0A 2B5AA 2HSGA 2LYQA 2R17C 4L23A 1PAQA 4G23A 3T5XA 3FUKA 3OTNA 4ABNA 2J4DA 3L13A 4CCAA 4EZJA 3MGBA 1RZRD 3CVPA 3D9OA 3RRMB 2EF8A 1EDUA 3MKQB 2WXJA 4GMLA 3OQMA 3LDZA 3QF3A 3MZLB 5CHEE 5LX8A 4MLPA 4ANXA 4YNDA 4DI4A 2JVLA 3SCFA 3PXPA 1ZVVA 3EUSA 1ZZ9A 2BNOA 4HXIA 2R63A 4NRHB 2CSFA 4B0ZA 2ICTA 1Z3XA 4AV7A 4D10C 3CVNA 4I1MA 3BS3A 3SNXA 1ZS4A 1TJCA 3L22A 2V4LA 4APOA 4EECA 4FHKA 1N52A 3ASDA 4GA1A 3RZZA 3HHMA 4GPKA 1BDIA 3GN5B 2YNQA 4L1BA 3GZ2A 3QQ6A 4Z59A 3FUNA 2KCLA 1NA3A 4KXKB 1Y8MA 1R63A 1UJJA 2PM6A 3FTYA 3I3NA 1HZ4A 3FHEA 1RPEL 3QDNA 5ANLA 5BPPA 3U66A 1OWPA 1WAO1 3CHQA 4U0UA 3RU0A 5JJTA 2VTBB 1UW4B 1ZZCA 4X4CA 1U3CA 2ZU6B 5CCLA 2X3MA 3U9WA 5KJLA 3MYVA 5CCMA 5FZQA 3ENEA 4YG4A 4BFRA 1NERA 5G04J 2V0PA 2PUEA 1UXCA 1RZRA 2KATA 5BV0A 3L1PA 2HINA 5K98B 2J49A 2WXQA 3Q5MA 4HFGA 3CVXA 4Z58A 4JQDA 2LNIA 2RG8A 3CVWA 5ARFA 2VSXE 1MQSA 4URKA 2X6HA 3KAEA 4G25A 3HVEB 4PDXA 2XJ3A 3MLFA 2VGXA 3IBEA 5FZSA 1HH8A 3FP3A 3GZ1A 4R7LA 1WY6A 5D0OD 3R9AB 3RJVA 3SBTB 4EZLA 2O4AA 2VJ8A 3PREA 1Y9QA 2Y4TA 2XQ0A 1XNFA 1WETA 3KS2A 1BPOA 4JHRA 1OWMA 5ARGA 3UT4A 4N2QA 4FULA 2LAIA 1QQAA 1JWGA 2XIUA 3CKCA 3LEWA 4J1XA 3CHRA 3BG1B 3OXFA 3QKYA 1E90A 2ICPA 2IQCA 3MEKA 3QYXA 1H6KA 2MQKA 3FUMA 4I9CA 4FLHA 4WAFA 4JW1A 3G7DA 3JXCL 5FQ7A 5AENA 1KLXA 3CSFA 3PE4A 3MKRA 5EX3A 1LLIA 4KMOA 5LP0A 4KZ0A 4A3TA 2BJCA 2A4ZA 1EPUA 2PL2A 2VQ2A 4ME2A 3TAXA 1SQMA 3B7RL 3CQGB 4OYSA 1IQRA 2XI8A 5HQ8A 1RZSA 2GRMA 1NZNA 2PQNA 2WXKA 3CR3A 4FU3A 4K0RA 4Y6WA 3C98A 5EKQD 5G05C 4AM9A 3UPVA 1Z6TA 2WXLA 1W3BA 2P58C 4EBAG 3NZSA 2KCKA 3FWVA 3MKQA 4EBAA 2LYRA 1HG2A 4H7YA 4OVVA 4F7AA 4G24A 1EF1C 3FUEA 4F8DA 2NSZA 3FULA 4Z5HA 3CLCA 2A6CA 2XGSA 3CHPA 3CHMA 3MJWA 3PEVB 4WWOA 3DBSA 2KZTB 4HLEA 5FWQA 1OSLA 4GQMA 4MCXA 4IVZA 4YG1A 5HI7A 5A23A 3F52A 5J08A 2MEZA 3VTXA 3FU5A 1OWLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GN5 A;  2IUO A;  1O4X A;  2B5A A;  2HSG A;  2LYQ A;  3IVP A;  1X57 A;  4X4G A;  1JH9 A;  3TRB A;  4MCT A;  1UTX A;  3ZKC A;  3KJX A;  1RZR D;  2EF8 A;  1BDH A;  3OQM A;  3QF3 A;  3FMY A;  3LIS A;  4FN3 A;  3FYM A;  4Z5C A;  2LYL A;  1YSE A;  3B7H A;  2IVB A;  1CJG A;  1LCC A;  2JVL A;  3SCF A;  3PXP A;  1ZVV A;  3EUS A;  1ZZ9 A;  2BNO A;  2AUW A;  2R63 A;  2CSF A;  4NDW A;  2AXV A;  2ICT A;  3S8Q A;  1XWR A;  1HF0 A;  3BS3 A;  1ZS4 A;  3SCH A;  4X4E A;  1NEQ A;  4JCY A;  2IV1 A;  3SCG A;  3G5G A;  2L49 A;  4I6R A;  3RZZ A;  1JFT A;  1BDI A;  3GN5 B;  1CQT A;  1WH8 A;  3QQ6 A;  4Y42 A;  3DNV B;  5A7L A;  4Z59 A;  2EWT A;  2O38 A;  4X4H A;  1S7E A;  1R63 A;  3QWG A;  3OP9 A;  1RPE L;  3KXA A;  1QP0 A;  4I8T A;  1JWL A;  1ZZC A;  4X4C A;  4Z5D A;  4O8B A;  1B0N A;  2KEJ A;  4I6U A;  3D1N I;  2PPX A;  4YG4 A;  3OQO A;  1UXD A;  1RIO A;  3O9X A;  1NER A;  1QP7 A;  4I6T A;  4OB4 A;  1E3O C;  2PUE A;  3HZI B;  4JCX A;  2O49 A;  1UXC A;  3BDN A;  4YBA A;  1RZR A;  3L1P A;  1PER L;  2HIN A;  3H5T A;  5K98 B;  2EBY A;  3OMT A;  3JXB C;  4Z58 A;  1PNR A;  2PUC A;  4JQD A;  3LFP A;  1GT0 C;  2IU7 A;  2AWI A;  1QPZ A;  4GHJ A;  1Y7Y A;  2FJR A;  4PU3 C;  1QP4 A;  3GBF A;  2LYS A;  2XJ3 A;  3MLF A;  2AXU A;  2KEK A;  2D5V A;  1X2L A;  2PUG A;  2LCV A;  2IVQ A;  3BD1 A;  1ZPQ A;  3UFD A;  2PUD A;  2O4A A;  1ZUG A;  1Y9Q A;  1ZZ8 A;  1EFA A;  2JCG A;  1POU A;  1WET A;  1LMB 3;  4IWR A;  3CEC A;  4X4B A;  1IC8 A;  1LCD A;  3FYA A;  2XCJ A;  1QQA A;  2XIU A;  4J1X A;  2H8R A;  3VK0 A;  2XSD C;  2R1J L;  4J1W A;  2ICP A;  3F6W A;  2LYK A;  1AU7 A;  3QYX A;  2BNM A;  1DWK A;  2MQK A;  1WH6 A;  1OCT C;  2PUA A;  3R1F A;  2KPJ A;  4PU4 C;  3G7D A;  3JXC L;  1SQ8 A;  3U3W A;  1WIZ A;  4X4F A;  2IVG A;  1LLI A;  4X4D A;  4X4I A;  1LQC A;  2PUB A;  2BJC A;  3ZHM A;  2LYJ A;  1QQB A;  2XI8 A;  1PRV A;  1OSL A;  3ZHI A;  1RZS A;  2GRM A;  4IA8 A;  2OR1 L;  2OFY A;  2LYP A;  1L1M A;  2KEI A;  2KZ8 A;  1ZZ6 A;  3JXD L;  3KZ3 A;  1PRA A;  2LYR A;  1PRU A;  1ADR A;  4YG7 B;  2GRL A;  2CRO A;  3F51 A;  3CRO L;  2GZU A;  4F8D A;  1ZZB A;  1ZZ7 A;  4YAR A;  4Z5H A;  3CLC A;  2PE5 A;  2BNN A;  2A6C A;  1JFS A;  1VPW A;  2PIJ A;  1ZAY A;  2L8N A;  4GQM A;  1DW9 A;  2AXZ A;  2WIU B;  4MCX A;  4IVZ A;  4FBI A;  4YG1 A;  3OQN A;  1R69 A;  2AW6 A;  2PUF A;  2WUS R;  3F52 A;  4PU7 A;  2MEZ A;  4PU8 A; 
#chains in the Genus database with same CATH topology
 3SFY A;  2QFC A;  2X6K A;  3UM3 A;  1A5E A;  3F6Q A;  1X57 A;  3AS5 A;  3ZKC A;  4ER0 A;  5AN8 A;  1HU3 A;  4BEP A;  3UI2 A;  1SZA A;  2J07 A;  3QAQ A;  2AUW A;  4ANU A;  3NB2 A;  2IV1 A;  1WH8 A;  4FJZ A;  5T8I A;  4HI8 A;  3OAW A;  3OP9 A;  5JHB A;  5EX0 A;  2L0T B;  2DZN A;  2J7W A;  3PNT B;  5CER B;  4G11 A;  3SBS A;  1QNF A;  2H6I A;  4JCX A;  3BEE A;  4JD2 G;  2KXP C;  5AJD A;  2FFH A;  2IU7 A;  2PXP A;  5CRU A;  1Y7Y A;  3FEY A;  3TJP A;  3L54 A;  3MCX A;  4YVO A;  4LCT A;  4N3A A;  1INZ A;  2IVQ A;  3BD1 A;  1ZZ8 A;  3D9K A;  2JCG A;  5AJL A;  2C0L A;  1QZ2 A;  4LSZ E;  3JXI A;  3IV0 A;  3LVR E;  2XCJ A;  4RSY A;  3K9I A;  4Y6C A;  4JC8 A;  4BSX A;  1OCR E;  2IVG A;  2KZT A;  2ILR A;  4X4I A;  1N9A A;  4G2V A;  2I6H A;  3AU5 A;  3JCK C;  4O1O A;  1H19 A;  4JEH A;  2LYP A;  5T3R A;  1BU9 A;  4LNB A;  1Y6I A;  1DCQ A;  2HE0 A;  3A9Y A;  3DPD A;  2GZU A;  3HG0 D;  2YBD A;  1HS6 A;  3GZD A;  3AU4 A;  2RFM A;  3ESK A;  2HFZ A;  1BDH A;  3TXN A;  2IOS A;  2VYI A;  2Y0B G;  1JH9 A;  2IY0 C;  3AS8 A;  2J08 A;  2XS8 A;  4Q96 A;  1MX2 A;  3LIS A;  4I2W A;  4XI0 A;  1BD8 A;  3ONL A;  2L9B A;  5HKP A;  4NDW A;  3S8Q A;  1TJF A;  3SCH A;  1BI8 B;  5DIZ A;  2IJG X;  1DUL A;  1MHQ A;  3IHV A;  1CQT A;  1HO8 A;  1D8D A;  1DVP A;  2C2L A;  3UKU G;  5FTP A;  2WMO A;  1JCR A;  3RSE G;  4I9E A;  2V5Q C;  5JA4 D;  4J8D A;  1KT1 A;  3FFL A;  5FQ4 A;  3PE3 A;  3QNK A;  3VLF A;  3GBF A;  2H6G A;  2IU1 A;  5AYW D;  2DCP A;  3A9Z A;  4ER5 A;  3DWL G;  4RG9 A;  2P9U G;  3CVY A;  3CEC A;  2MRI A;  2PXK A;  5CBN A;  2XSD C;  3P2B A;  4JZY A;  2LYK A;  5EYL A;  4V3I A;  3BG0 B;  4U0S A;  4MKT A;  3LY9 A;  4ATG A;  2LLW A;  4X4D A;  4OBM A;  4DLQ A;  2QYU A;  1LQC A;  2VSO E;  4K5A B;  2HCN A;  3ZHI A;  1TNU A;  3PS6 A;  3DXM G;  4RVB A;  2ZIS A;  3SR4 A;  4HOQ A;  4AY5 A;  3Q79 A;  2XPI A;  2LO6 A;  3F51 A;  2PE5 A;  5AQ7 A;  4JVS A;  3R7R A;  5HQ8 A;  5KJM A;  2M63 A;  2L8N A;  3DST A;  4AVX A;  4FAD A;  3OXG A;  4HS2 A;  3ZPJ A;  1OWN A;  3IXE A;  3CK9 A;  1O4X A;  1E7V A;  3MX3 A;  3FTU A;  3G2T A;  3AS4 A;  1WDY A;  2VSY A;  1OXJ A;  3RK6 A;  2AXV A;  3Q7A A;  4CT0 A;  3G5G A;  4I6R A;  1JFT A;  1QYM A;  1E8W A;  3FTW A;  3RO2 A;  3U64 A;  3C72 A;  2O38 A;  4U63 A;  3QWG A;  1RW2 A;  2GGF A;  2MHK A;  4XIF A;  2UWJ G;  1TN6 A;  4PH4 B;  1B0N A;  2KEJ A;  4I43 A;  4EKG A;  4GTT A;  4KVO A;  3OQO A;  3O9X A;  3N71 A;  2QC9 A;  1E3O C;  3NBN B;  3VLD A;  1HFA A;  2F37 A;  4N3B A;  4AOF A;  4CDR A;  5BUZ A;  2CG3 A;  3SQV A;  2IF4 A;  3CGH A;  3FH5 A;  5ENR D;  4F3V A;  2PUG A;  2H6F A;  2X6F A;  4Q94 A;  3UT8 A;  4X4B A;  3FYA A;  3GZD C;  2OEW A;  2XPY A;  4UQZ A;  1N4Q A;  3A9X A;  1DWK A;  1HG5 A;  2E0I A;  2VGX B;  3L9T A;  2B0O E;  2QZA A;  4IA8 A;  1SA4 A;  5BW8 C;  2YIN A;  1O1R A;  4BES A;  4AXH A;  2LLV A;  3L08 A;  4LNU D;  3SI5 A;  1N0R A;  1ZZ7 A;  5CBO A;  1E96 B;  3V31 A;  2X38 A;  1HXI A;  1R69 A;  2AW6 A;  3UIP C;  5FJY A;  3EHQ A;  4BT8 A;  2YHE A;  4XE0 A;  2B5A A;  4L23 A;  3L13 A;  3RRM B;  3CVP A;  4L9P A;  3LDZ A;  4MLP A;  4ANX A;  4GMR A;  3PXP A;  1ZVV A;  4NRH B;  4HXI A;  3TWT A;  4D10 C;  3CVN A;  1TJC A;  3NZL A;  1N52 A;  1BDI A;  1TN8 A;  3GZ2 A;  1TNB A;  1NA3 A;  1R63 A;  3I3N A;  1OWP A;  1WAO 1;  1YMP A;  3CHQ A;  3RU0 A;  1U3C A;  4U95 D;  4ZFH A;  1MJ0 A;  5GAH i;  3DEO A;  4DX7 D;  3DXK G;  2EIJ E;  5ENT D;  4YG4 A;  1IKN D;  2V0P A;  1UXC A;  2J49 A;  2RG8 A;  2VSX E;  1MQS A;  4TXR A;  4G25 A;  1K1B A;  2XJ3 A;  3MLF A;  2VGX A;  4G8L A;  3FP3 A;  3GZ1 A;  4R7L A;  3Q9U C;  3RJV A;  4F6R D;  3NDB B;  2L6B A;  2O4A A;  1Y9Q A;  4JHR A;  1WET A;  5ARG A;  2LAI A;  1N94 A;  2F8X K;  3BG1 B;  2MQK A;  3FUM A;  4FLH A;  4WAF A;  5FQ7 A;  3TWR A;  3MKR A;  5EX3 A;  4KMO A;  1N4R A;  2BJC A;  1EPU A;  3TAX A;  2VQ2 A;  4ME2 A;  4ATZ D;  3CQG B;  3CR3 A;  4AM9 A;  2WXL A;  2BKG A;  1W3B A;  3TWV A;  4DRX E;  4EBA G;  2KCK A;  4H7Y A;  4G24 A;  4F8D A;  2A6C A;  1TYQ G;  2IEJ A;  2GRR B;  4IVZ A;  4YG1 A;  5A23 A;  1OWL A;  2XHE A;  2IUO A;  3GYZ A;  3O4Z A;  3WXX A;  2LNM A;  2I1J A;  4UQX A;  3PZ3 A;  4IN3 B;  3NQP A;  3EHN A;  1GW6 A;  2BKK B;  2DZO A;  3KL4 A;  1HQ1 A;  4DK5 A;  3Q9N C;  2KCV A;  3B95 A;  4X4E A;  3TL5 A;  4JCY A;  5EN5 D;  2L49 A;  3ML8 A;  4CYM D;  3D9P A;  4IUL A;  3FUD A;  3ZUV B;  3ZPX A;  4BET A;  2P9P G;  4CRW A;  2WPV A;  3ZRH A;  4WUY A;  4XKB A;  4RLY A;  3ESL A;  2ZXW E;  3Q7F A;  4F53 A;  3Q4A B;  3T8M A;  1QP7 A;  2YHC A;  1H0A A;  1OCZ E;  3PE5 A;  3EIQ C;  3FU0 A;  4UUC A;  3PRZ A;  3OXL A;  5CMW A;  4K5C A;  3AG1 E;  4UWK A;  1MX4 A;  4Q69 A;  2HYZ A;  3ZEF A;  5A6C A;  2BED A;  3LXU X;  1O1S A;  3G2W A;  2XZD G;  2M4H A;  4XZ4 A;  2X6I A;  4J1W A;  1E8X A;  4I2Z A;  3ASO E;  2BNM A;  3NOC D;  1SVX A;  2IOL A;  3DPY A;  3UWP A;  3U3W A;  4XEI G;  3V2X A;  2GRN B;  1N4P A;  1H6P A;  4DUI A;  3KZ3 A;  5KJN A;  1DCE A;  4N39 A;  4J8F A;  2R2L A;  2LSV A;  2RKK A;  3J5P A;  4ILG A;  3CHO A;  3DSW A;  3S2A A;  3L17 A;  3D9H A;  4ZHB A;  5DSX A;  2EIL E;  2A5U A;  4GTM A;  3FTS A;  2OEV A;  3UUX A;  2CFZ A;  3HXB A;  3RKV A;  2Q7F A;  4MCT A;  5FWQ A;  2HM8 A;  1N11 A;  3CIA A;  2WXP A;  4A1S A;  3B7H A;  2IVB A;  1LCC A;  4GYO A;  3AG3 E;  4QFV A;  2L6J A;  2XEH A;  3D9I A;  2AVP A;  1NEQ A;  4BSZ B;  3TGO A;  1HF8 A;  4Y42 A;  2JAB A;  5G05 J;  1QBQ A;  5DTR A;  3LPZ A;  3ASF A;  1QP0 A;  1U2V G;  2YQ8 A;  4PUC A;  1NW3 A;  4A63 B;  3E4B A;  1RIO A;  1ELW A;  3R9M A;  5DTQ A;  3BDN A;  1MYO A;  3NZU A;  3H5T A;  4PS7 A;  3ZU7 B;  4E6H A;  3CVQ A;  3B7U X;  4BER A;  1N54 A;  3APC A;  2LYS A;  4UWH A;  2KEK A;  3E30 A;  2PXL A;  4U7E B;  2PXU A;  4B89 A;  4FC8 A;  3SX0 A;  3S7J A;  3C3Q A;  1XGW A;  3IEG A;  2R1J L;  2EIK E;  2JEK A;  3F6W A;  3Q15 A;  3PDN A;  3LVQ E;  4A55 A;  3S7D A;  4DJA A;  3E33 A;  3EDT B;  3ZNG A;  3QK0 A;  2OVB A;  1FT1 A;  1UN8 A;  2RD0 A;  4JHJ A;  3W9G A;  2OR1 L;  3G2S A;  1L5J A;  3QFI A;  5FQ8 A;  1U3D A;  2ION A;  4M3O A;  1ZZ6 A;  1PY1 A;  4HB5 A;  4HNA D;  5AAR A;  2V8S E;  2BNN A;  4I6G A;  4O1P A;  3CVL A;  1HX8 A;  1MZC A;  1QPZ A;  2WIU B;  3FTV A;  3LCA A;  2P9S G;  5AAO A;  3V30 A;  4X4G A;  1SZ9 A;  4WNE A;  4OVU A;  2IFU A;  4ANW A;  3KJX A;  3TG5 A;  4EHM A;  4J6I A;  2C0M A;  2J4B A;  3DM5 A;  3AG4 E;  1EYH A;  4EZK A;  2LYL A;  3FTX A;  3CKB A;  1XWR A;  2FUL A;  4FA6 A;  5GAG i;  2EIN E;  2FBN A;  3R09 A;  2I1K A;  3UM1 A;  4AEZ C;  2XEV A;  4F1P A;  4CGV A;  2JQE A;  1RZ4 A;  4UI9 J;  1UG3 A;  1E7U A;  4JHK A;  5C1D A;  4YVQ C;  4U8H A;  3BU8 A;  4Z5D A;  3ZW3 A;  3D1N I;  4HRN A;  2PPX A;  1PC2 A;  3LY7 A;  4UWF A;  3RAU A;  2FI7 A;  3JXB C;  3LY8 A;  5BT1 A;  1FCH A;  4DPR A;  4LRZ A;  4HRL A;  4DX6 D;  4GYY A;  4L7T A;  1LTX A;  2FF4 A;  3UM0 A;  4PS3 A;  1B89 A;  4UWL A;  3B13 A;  3TXM A;  5FQ6 A;  4BTB A;  5EYP F;  4NQ0 A;  2WQH A;  5AQ9 A;  4H7X A;  4P29 A;  3ZYQ A;  4X4F A;  2P9N G;  2LUH A;  3E37 A;  3ZGQ A;  2WXH A;  2KZ8 A;  3JXD L;  4WWP A;  4J0U A;  4N5C A;  5JJ6 A;  5FIN A;  1TNZ A;  2CHX A;  2FEZ A;  2WUS R;  4Z68 A;  3FUK A;  3OTN A;  3ULE G;  2J4D A;  4ABN A;  4CCA A;  3MGB A;  1RZR D;  3QF3 A;  3MZL B;  2JVL A;  3SCF A;  2PXV A;  5EKQ D;  3EUS A;  2R63 A;  4AV7 A;  4I1M A;  4N5Q A;  4FHK A;  2KBX A;  3HHM A;  3GN5 B;  2YNQ A;  4Z59 A;  3L82 A;  3FUN A;  2KCL A;  3FHE A;  1RPE L;  5ANL A;  4EZI A;  1UW4 B;  2X3M A;  5KJL A;  5CCM A;  1S63 A;  5FZQ A;  1JCQ A;  2XEE A;  5G04 J;  4U96 D;  2HIN A;  4TXQ A;  4Z58 A;  4JQD A;  2LNI A;  5ARF A;  3TEL A;  4URK A;  3KAE A;  3HVE B;  4PDX A;  3HXC A;  2ODR D;  1WY6 A;  5D0O D;  3SBT B;  3PRE A;  1XNF A;  1BPO A;  1QQA A;  3OXF A;  3CKC A;  3CHR A;  5EIL A;  2ICP A;  4M7C A;  3JXJ A;  3J5Q B;  1KLX A;  2DVW A;  5EIB E;  3PE4 A;  1DC2 A;  3QOX A;  2DWZ A;  4YDE A;  1NZN A;  4K0R A;  2P9I G;  2LXM A;  4Y6W A;  2PXD A;  5G05 C;  5CED B;  1KZP A;  3NZS A;  5D66 A;  4OVV A;  3FUE A;  4ER7 A;  1FPP A;  4GQM A;  4MCX A;  3PZ1 A;  3F52 A;  5ENP D;  3GN5 A;  5E76 A;  2WQ6 A;  1E8Y A;  1ELR A;  3ABK E;  2WXM A;  2A5E A;  1KT0 A;  2I9C A;  5DRY A;  5DT2 A;  3ZN3 A;  4NUR A;  3W9F A;  2ETB A;  4C0M A;  3V79 K;  3HXF A;  5C2Y A;  4AP2 A;  4DE8 A;  4KBQ A;  3CVU A;  3Q75 A;  1S7E A;  3PNL B;  1LD7 A;  3WG7 E;  3HVE A;  3VLE A;  2XS1 A;  1FVF A;  4I8T A;  4TUU A;  4BWR A;  3JUE A;  4I6U A;  4X8Q A;  4CEM A;  1UXD A;  1OCO E;  3CLJ A;  2L1P A;  3ZVV A;  1PNR A;  3KEZ A;  3LFP A;  1E8Z A;  2FJR A;  3PEU B;  4G1T A;  2D5V A;  5G2N A;  1AP7 A;  4J7W A;  3TWQ A;  1OY3 D;  5ENO D;  4FP7 A;  4J8S A;  2PNN A;  3PZD A;  5T4Y A;  3T9K A;  1LMB 3;  3DSV A;  2E2E A;  1K3Z D;  1ELK A;  3HIZ A;  2PUA A;  3KSL A;  3UX4 A;  4BT9 A;  3FUH A;  5DRT A;  2WXG A;  4I17 A;  4BY6 A;  4J8E A;  3ZXP A;  2PM7 A;  4DX5 D;  1MX6 A;  4RQI A;  2QY7 A;  4UI9 C;  3KSQ A;  2VGE A;  2WVI A;  2GRL A;  4A3V A;  3SGH A;  4DI3 A;  1YA0 A;  4MS6 A;  3ULQ A;  4OAV B;  3UIO C;  3TEP A;  2AXZ A;  4LG6 A;  2MYO A;  3SFX A;  4LUN U;  3R1F A;  3ISM C;  4B94 A;  3D9L A;  2BUG A;  4HVB A;  5KJK A;  4MRU A;  4HI9 A;  3FDH A;  5D0Q D;  5KNG A;  2DIW A;  4UQY A;  5B3S E;  3FMY A;  4GAA A;  2JLB A;  1CJG A;  3L6A A;  3MEJ A;  3B7B A;  3CK8 A;  3FUI A;  3ZKJ A;  3ZYM A;  3E32 A;  3SCG A;  2UY1 B;  2WXF A;  3DSX A;  3RRN B;  3DNV B;  3KD7 A;  4UI9 K;  2EWT A;  4FHJ A;  2LSU A;  3TG4 A;  3D9J A;  4IRU A;  5ANR A;  2I2O A;  1X81 A;  1QQE A;  4GU5 A;  3C3R A;  3LS8 A;  2CHW A;  3LYA A;  3VWS A;  3RO3 A;  2WXO A;  5M72 A;  2EBY A;  1OT8 A;  1G3N B;  5LFA A;  3I4R B;  1GT0 C;  3AG2 E;  3FUF A;  4PU3 C;  2R59 A;  5LOZ A;  4GZD A;  3VTY A;  3HYM B;  2PUD A;  1ZU2 A;  2XZT G;  1H2U A;  5A7D B;  3P1U A;  1FVH A;  2H8R A;  3VK0 A;  3ASG A;  3SF4 A;  1OCT C;  4PU4 C;  4EK9 A;  3T5V A;  1WIZ A;  2PXF A;  2GW1 A;  2F8Y A;  3NF1 A;  3S7B A;  1S64 A;  4U8Y D;  4UWG A;  3JQ1 A;  5AQA A;  1S0P A;  4TV3 A;  3G2U A;  1TR4 A;  2PQR A;  1H6O A;  1PRU A;  1ZB1 A;  3G2V A;  3HRA A;  2XEN A;  3UIN C;  1D8E A;  4YAR A;  3FUJ A;  4AJW A;  5G04 C;  1DW9 A;  2UY1 A;  3C5R A;  4ER6 A;  4ILH B;  4WND A;  5FZR A;  3FU3 A;  5B1A E;  3I4G A;  4NAC A;  3U4T A;  4GZ3 A;  4I6E A;  4A1G A;  4RG6 A;  4ILI A;  4PS8 A;  3S7F A;  2NXP A;  3CK7 A;  1DNP A;  5DTM A;  1H2T C;  3BUA A;  3C3O A;  2EIM E;  5A7L A;  3FH8 A;  3SO8 A;  4GCN A;  4HLL A;  4CDN A;  2NC9 A;  3FY4 A;  3ZYK A;  3JYS A;  4BX9 A;  5LCW J;  1NA0 A;  2OVF A;  3UPV A;  1IQU A;  1JWL A;  1MFQ C;  3UTM A;  4O8B A;  1V55 E;  1Z3Y A;  4GYW A;  4U0Z A;  3HZI B;  2ZGG A;  3OMT A;  3TWX A;  2GRQ B;  4GTO A;  4U07 A;  4AIF A;  3MV3 B;  2AWI A;  4GHJ A;  1V54 E;  4CT4 A;  2ETA A;  4ANV A;  4C9B B;  4JL0 A;  2LCV A;  4F1S A;  3UFD A;  3CEQ A;  2V4H C;  4HRM B;  2Y4U A;  1IC8 A;  1LCD A;  4U8V D;  3APD A;  2DYR E;  2R05 A;  1IHG A;  3DEP A;  3IHY A;  1WH6 A;  2J09 A;  1IXV A;  2KPJ A;  4B8A A;  4E85 A;  3CV0 A;  5EID A;  3QWW A;  2WM9 A;  1A17 A;  3ZHM A;  5BV1 A;  1K1A A;  2LYJ A;  3Q47 B;  1L1M A;  3FU6 A;  5IY5 E;  1UN9 A;  2MOW A;  3UT7 A;  3EJN A;  2V5F A;  3SFZ A;  3CRO L;  4I1O B;  5FIO A;  2CHZ A;  2PIJ A;  3QOU A;  4HOU A;  2DYS E;  4X4H A;  4PU7 A;  1S70 B;  2HSG A;  5KWD A;  2R17 C;  4G23 A;  3T5X A;  1EDU A;  2WXJ A;  4HBD A;  5LX8 A;  5CHE E;  3OWQ A;  3UKR G;  4J8Y A;  4B0Z A;  1Z3X A;  3UM2 A;  3BS3 A;  1N0Q A;  1ZS4 A;  2V4L A;  4EEC A;  3ASD A;  4GPK A;  3RZZ A;  3QQ6 A;  4KXK B;  1UJJ A;  3FTY A;  1HZ4 A;  4DX1 A;  3EU5 A;  3QDN A;  3U66 A;  4NIK A;  2VTB B;  4U0U A;  2ZU6 B;  1ZZC A;  5CCL A;  3U9W A;  4YDO A;  3HXE A;  4BFR A;  1RZR A;  2KAT A;  3L1P A;  5K98 B;  3Q5M A;  3CVX A;  5CRV A;  5FZS A;  3IBE A;  3NXH A;  4CZ2 D;  4QQI A;  2XXQ A;  2VJ8 A;  1Q2Z A;  1QZX A;  2XQ0 A;  3UT4 A;  1OWM A;  4N2Q A;  4FUL A;  1JWG A;  2XIU A;  3MEK A;  1NL4 A;  3QYX A;  1H6K A;  2PXQ A;  4I9C A;  3DRA A;  4JW1 A;  3JXC L;  5AEN A;  3CSF A;  2IO3 C;  2PL2 A;  4C48 B;  1SQM A;  4OYS A;  1RZS A;  1KPS B;  4FU3 A;  3C98 A;  1Z6T A;  3NOG D;  2P58 C;  3FWV A;  4EBA A;  1HG2 A;  4F7A A;  3FUL A;  3CHP A;  2XGS A;  3PEV B;  2F0Y A;  3MJW A;  1NFI E;  1O1T A;  4WWO A;  3DBS A;  4HLE A;  2QYJ A;  2P2C P;  5HI7 A;  5HRY A;  5CEC B;  2Y3A A;  3QC1 A;  1TEZ A;  3JUI A;  1UOH A;  1P5Q A;  2J8S D;  2WXR A;  2VTB A;  1K8K G;  4Z5C A;  1WM5 A;  3FYM A;  1OCC E;  4N2S A;  3EHM A;  4IYP A;  5JMN D;  2VSN A;  3SY2 A;  2GRO B;  4GZC A;  2PXB A;  3NRO A;  1X5B A;  4KVM A;  3UMV A;  1FT2 A;  3GZC A;  3AAA C;  3R7Q A;  4JA7 A;  5KNH D;  1LF8 A;  2J9Q A;  4DLO A;  3LQX A;  1ZBP A;  4GTP A;  4BX8 A;  1AWC B;  3ZYL A;  4KYO B;  3ASN E;  4HOT A;  3I5P A;  1X2L A;  5ENN A;  1IHB A;  4DE9 A;  2L0I A;  4KZC A;  5FT9 A;  5BNW A;  3APF A;  1VDY A;  2ZGD A;  5B1B E;  4ACL A;  3QWV A;  5J90 A;  2R5S A;  4CGW A;  2XRZ A;  3SHF A;  3L16 A;  4B8C B;  3D3M A;  4L2Y A;  3LJ3 A;  4WWN A;  2PUB A;  3KEA A;  2V3C C;  4GPM A;  1TNY A;  4GTQ A;  3V2O A;  3X2Q E;  5HS0 A;  1HE8 A;  5D2M C;  2KEI A;  2B6C A;  4FJY A;  5LCW C;  3DSU A;  3EIJ A;  1Z5S C;  2FO7 A;  3EHR A;  2OCC E;  2P9L G;  5ENS D;  1NP7 A;  1JFS A;  1VPW A;  2Y69 E;  3D9N A;  3OQN A;  3ML9 A;  4MBG A;  2OV8 A;  3URZ A;  2XXA A;  3IVP A;  3B7T A;  1UTX A;  1JUQ A;  4ER3 A;  5CEA A;  3ONK A;  5JJ7 A;  2OND A;  3B7S A;  1YSE A;  2KM4 A;  5H7P A;  2ETC A;  2WXI A;  3NAW A;  3AJI A;  3CVV A;  3ZHE B;  4DX2 A;  4LNG A;  4BTA A;  4GTV A;  3TWU A;  3T8K A;  3GUU A;  2DBA A;  3ZIM A;  3BQO A;  4C0E A;  2BF0 X;  4G8K A;  1YYH A;  2BTD A;  2WB2 A;  4LER A;  4G26 A;  3Q78 A;  1OUV A;  2GRP B;  2XRY A;  4AY6 A;  2XGM A;  3RIB A;  4LEU A;  4O60 A;  3PUK A;  2O49 A;  3TWW A;  2CFU A;  3PZ4 A;  3RRU A;  2PUC A;  3MA5 A;  5JHA A;  5E75 A;  4K03 A;  2AXU A;  1JWF A;  2VGY A;  3PH0 C;  4OAU C;  4HOR A;  1ZUG A;  4Q2J A;  4XKC A;  2XPZ A;  4YDY A;  4GTS A;  3FEX A;  4FLB A;  4I1A A;  4TUM A;  1AU7 A;  2LXL A;  4WNF A;  4TXP A;  4EPZ A;  3O48 A;  1TNO A;  4XI9 A;  3JQ0 A;  3E34 A;  3ASH A;  3FTZ A;  4GA2 A;  1SW6 A;  4WNG A;  1QQB A;  3TFL A;  1PRV A;  4B93 B;  2XCC A;  5KBA A;  2CG2 A;  2XGO A;  5AIJ A;  3ULY A;  2Y1L E;  1PRA A;  1ADR A;  2WXN A;  2EQX A;  2KC7 A;  3IKO B;  5EDS A;  2FO1 E;  1JCS A;  1OWO A;  3ZHE A;  4HOS A;  1ZAY A;  1N4S A;  4W9R A;  2PXT A;  3ABM E;  1QB2 A;  4FBI A;  2PUF A;  4PU8 A;  4EQF A;  1KZO A;  3ME5 A;  3TRB A;  3ZFW A;  2NYJ A;  4KT6 B;  3LKU A;  4WVL A;  3UQ3 A;  2X6J A;  2HR2 A;  4FN3 A;  4EKI A;  2WQ7 A;  1HF0 A;  1H2V C;  1LD8 A;  4O6F A;  5CMY A;  3SZ7 A;  3CST A;  4XX5 A;  1O5M A;  3GW4 A;  4JPS A;  3HXD A;  4APF A;  3KXA A;  4GZ6 A;  2WMN A;  2XCB A;  4CDM A;  1IYG A;  4YDW A;  2OOE A;  4L2L A;  3FH7 A;  4I6T A;  4OB4 A;  1PER L;  3GZS A;  4GMJ A;  2HO1 A;  4ACK A;  2IO2 C;  3OKZ A;  2AJA A;  2RFA A;  1NI1 A;  1QP4 A;  1UJK A;  3QAR A;  3D9M A;  3Q49 B;  4JA9 A;  3SD5 A;  4I6J A;  1ZPQ A;  1EFA A;  2PZI A;  1POU A;  4IWR A;  4GCO A;  4JEU A;  2HCS A;  3CQC B;  3ZXS A;  3HDX A;  4GB9 A;  1JPL A;  2ZIR A;  1SQ8 A;  5DBK A;  1WG0 A;  3QB2 A;  3Q73 A;  4U04 A;  3QWP A;  1BLX B;  3PUJ A;  3QJZ A;  4JB8 P;  2OFY A;  4JXT A;  5G55 A;  3CHS A;  5JUW A;  2J7U A;  4YG7 B;  3MV2 B;  2CRO A;  4GZ5 A;  1ZZB A;  5KCM A;  3G0T A;  4N3C A;  3EU9 A;  3PVL A;  2LAH A;  1N95 A;  4YBA A;  4GA0 A;  2LYQ A;  1PAQ A;  3EUV A;  4EZJ A;  3D9O A;  2EF8 A;  3MKQ B;  4GML A;  3OQM A;  1YCS B;  4YND A;  4DI4 A;  4TRQ A;  1ZZ9 A;  2BNO A;  2CSF A;  3PZ2 A;  2ICT A;  3SNX A;  3L22 A;  4APO A;  3TWS A;  4GA1 A;  1U2Z A;  2P9K G;  4L1B A;  5AQB A;  1Y8M A;  2PM6 A;  5BPP A;  3LJN A;  5JJT A;  2PXE A;  4X4C A;  3MYV A;  3ENE A;  1NER A;  2PUE A;  2MXD A;  3M9L A;  5BV0 A;  4HFG A;  4HRA A;  2WXQ A;  1D9S A;  3CVW A;  2X6H A;  5BXU A;  2VEO A;  1HH8 A;  3R9A B;  1SA5 A;  4EZL A;  2Y4T A;  3UXG A;  3KS2 A;  3LEW A;  4J1X A;  3QKY A;  3ABL E;  1E90 A;  2IQC A;  4GTR A;  3G7D A;  5ITZ F;  1LLI A;  4K5B A;  5LP0 A;  4KZ0 A;  4A3T A;  2A4Z A;  4HQD A;  3QOW A;  3B7R L;  1IQR A;  2XI8 A;  2GRM A;  2PQN A;  2WXK A;  3DSS A;  1TN7 A;  1BI7 B;  3MKQ A;  4EQZ A;  2LYR A;  2R02 A;  5ENQ D;  1EF1 C;  2NSZ A;  2H6H A;  4Z5H A;  3CLC A;  3CHM A;  2KZT B;  5BXO A;  1OSL A;  2R03 A;  5J08 A;  2MEZ A;  3VTX A;  2XXP A;  3FU5 A; 
#chains in the Genus database with same CATH homology
 2XHE A;  3GN5 A;  2IUO A;  2QFC A;  2X6K A;  3GYZ A;  3QC1 A;  5E76 A;  2WQ6 A;  3O4Z A;  1TEZ A;  1X57 A;  3JUI A;  3WXX A;  1P5Q A;  1E8Y A;  3AS5 A;  3ZKC A;  2I1J A;  1ELR A;  2WXR A;  2WXM A;  4UQX A;  4Z5C A;  1KT0 A;  3FYM A;  1WM5 A;  2I9C A;  1HU3 A;  2VTB A;  4IN3 B;  3NQP A;  1SZA A;  3EHN A;  4N2S A;  2J07 A;  1GW6 A;  3EHM A;  3QAQ A;  4IYP A;  2AUW A;  3ZN3 A;  4NUR A;  4C0M A;  4ANU A;  2VSN A;  4DK5 A;  4GZC A;  2KCV A;  5C2Y A;  4X4E A;  3TL5 A;  4JCY A;  4AP2 A;  2IV1 A;  2L49 A;  3ML8 A;  1X5B A;  4KVM A;  3D9P A;  4KBQ A;  1WH8 A;  3FUD A;  4IUL A;  3CVU A;  4FJZ A;  5T8I A;  1S7E A;  3OAW A;  3PNL B;  3UMV A;  3HVE A;  3VLE A;  5KJM A;  3OP9 A;  2WPV A;  4CRW A;  1FVF A;  3R7Q A;  4I8T A;  4JA7 A;  4TUU A;  3ZRH A;  5JHB A;  4BWR A;  4WUY A;  1LF8 A;  4XKB A;  2J9Q A;  3ESL A;  2L0T B;  5EX0 A;  4DLO A;  4I6U A;  3PNT B;  4F53 A;  1ZBP A;  3Q4A B;  4G11 A;  1UXD A;  3T8M A;  4BX8 A;  4CEM A;  1QP7 A;  3SBS A;  1QNF A;  4APF A;  2YHC A;  4JCX A;  1H0A A;  3CLJ A;  3EIQ C;  3FU0 A;  3BEE A;  5AJD A;  3ZVV A;  1PNR A;  3PRZ A;  3KEZ A;  3ZYL A;  3LFP A;  1E8Z A;  3OXL A;  2IU7 A;  5CMW A;  1Y7Y A;  2FJR A;  4KYO B;  4UWK A;  3FEY A;  3TJP A;  4HOT A;  3PEU B;  3L54 A;  3MCX A;  3I5P A;  4G1T A;  4YVO A;  2D5V A;  1X2L A;  5G2N A;  4Q69 A;  4LCT A;  4N3A A;  1INZ A;  2HYZ A;  2IVQ A;  3BD1 A;  4TRQ A;  4FP7 A;  4J8S A;  5ENN A;  3ZEF A;  1ZZ8 A;  3D9K A;  3PZD A;  5T4Y A;  2JCG A;  5A6C A;  5AJL A;  3LXU X;  2C0L A;  1QZ2 A;  1LMB 3;  2L0I A;  3IV0 A;  3G2W A;  2XCJ A;  3LVR E;  4RSY A;  2E2E A;  4KZC A;  3K9I A;  5FT9 A;  5BNW A;  4XZ4 A;  2X6I A;  1ELK A;  4J1W A;  1E8X A;  3APF A;  1VDY A;  4Y6C A;  4I2Z A;  4JC8 A;  4HOS A;  4ACL A;  3HIZ A;  3QWV A;  5J90 A;  2BNM A;  2R5S A;  2PUA A;  4BSX A;  3UX4 A;  2IOL A;  4CGW A;  4BT9 A;  3U3W A;  3SHF A;  2XRZ A;  3L16 A;  2IVG A;  4B8C B;  3D3M A;  4L2Y A;  2KZT A;  3FUH A;  2ILR A;  4X4I A;  3LJ3 A;  4WWN A;  2PUB A;  2WXG A;  4I17 A;  4BY6 A;  4G2V A;  2I6H A;  4J8E A;  3AU5 A;  2PM7 A;  3JCK C;  1HE8 A;  1H19 A;  4JEH A;  2LYP A;  5T3R A;  2KEI A;  2QY7 A;  4UI9 C;  4FJY A;  5LCW C;  3KZ3 A;  3EIJ A;  1Y6I A;  5KJN A;  2FO7 A;  2WVI A;  2GRL A;  4N39 A;  4A3V A;  3SGH A;  4J8F A;  3DPD A;  4DI3 A;  1YA0 A;  2GZU A;  2LSV A;  4ILG A;  1HS6 A;  1NP7 A;  3CHO A;  1JFS A;  4MS6 A;  1VPW A;  3ULQ A;  3S2A A;  3AU4 A;  3L17 A;  2AXZ A;  3D9N A;  3OQN A;  3ML9 A;  4LUN U;  3R1F A;  3ESK A;  1BDH A;  2A5U A;  2OV8 A;  3FTS A;  2IOS A;  2VYI A;  3D9L A;  2BUG A;  3TXN A;  3URZ A;  3UUX A;  4AJW A;  4HVB A;  5KJK A;  3IVP A;  2CFZ A;  1JH9 A;  3B7T A;  4MRU A;  3FDH A;  2Q7F A;  3RKV A;  4MCT A;  1UTX A;  1JUQ A;  2J08 A;  2HM8 A;  3AS8 A;  3ONK A;  4Q96 A;  5D0Q D;  2DIW A;  3CIA A;  2OND A;  5JJ7 A;  4UQY A;  2WXP A;  3FMY A;  3LIS A;  4GAA A;  4I2W A;  4XI0 A;  2JLB A;  3B7S A;  1YSE A;  3B7H A;  2IVB A;  1CJG A;  1LCC A;  2KM4 A;  2L9B A;  2WXI A;  3ONL A;  3L6A A;  4GYO A;  3CK8 A;  3FUI A;  4NDW A;  3S8Q A;  4QFV A;  2L6J A;  1TJF A;  3CVV A;  3ZHE B;  4BTA A;  3ZYM A;  3D9I A;  3SCH A;  2AVP A;  5DIZ A;  1NEQ A;  2IJG X;  3SCG A;  2DBA A;  3ZIM A;  3TGO A;  1MHQ A;  2UY1 B;  2WXF A;  3IHV A;  1HF8 A;  4C0E A;  1CQT A;  3RRN B;  4Y42 A;  3DNV B;  1HO8 A;  2BF0 X;  3KD7 A;  4UI9 K;  2EWT A;  5G05 J;  1DVP A;  2BTD A;  2WB2 A;  4FHJ A;  2LSU A;  2C2L A;  4LER A;  3D9J A;  3LPZ A;  3ASF A;  4G26 A;  1QP0 A;  4IRU A;  5ANR A;  3TG4 A;  2I2O A;  1OUV A;  2XRY A;  4AY6 A;  2XGM A;  2YQ8 A;  1QQE A;  4GU5 A;  4PUC A;  3LS8 A;  3RIB A;  2CHW A;  3E4B A;  4LEU A;  3PUK A;  1RIO A;  1ELW A;  2WMO A;  3LYA A;  5FTP A;  2O49 A;  3BDN A;  4I9E A;  2CFU A;  3NZU A;  3RO3 A;  3H5T A;  2WXO A;  4PS7 A;  2EBY A;  3RRU A;  4E6H A;  4J8D A;  1KT1 A;  3FFL A;  3CVQ A;  5M72 A;  2PUC A;  3B7U X;  5FQ4 A;  3PE3 A;  3I4R B;  3MA5 A;  1GT0 C;  5LFA A;  5JHA A;  1N54 A;  3APC A;  5E75 A;  3FUF A;  4PU3 C;  2R59 A;  3GBF A;  3QNK A;  5LOZ A;  3VLF A;  2LYS A;  2IU1 A;  4GZD A;  4K03 A;  2AXU A;  2DCP A;  4UWH A;  2KEK A;  5AYW D;  3VTY A;  1JWF A;  2VGY A;  3HYM B;  4FC8 A;  4B89 A;  2PUD A;  1ZU2 A;  3PH0 C;  1H2U A;  3S7J A;  4HOR A;  1ZUG A;  4XKC A;  2XPZ A;  4RG9 A;  1XGW A;  3IEG A;  3CEC A;  3P1U A;  5A7D B;  4A1S A;  3CVY A;  2MRI A;  1FVH A;  3FEX A;  4FLB A;  2H8R A;  3VK0 A;  2XSD C;  2R1J L;  3ASG A;  3P2B A;  4I1A A;  4JZY A;  3SF4 A;  2JEK A;  3F6W A;  2LYK A;  1AU7 A;  3Q15 A;  3PDN A;  4V3I A;  1OCT C;  3BG0 B;  4U0S A;  4PU4 C;  4MKT A;  3LVQ E;  4WNF A;  4A55 A;  3LY9 A;  3S7D A;  3O48 A;  4ATG A;  1WIZ A;  4DJA A;  4XI9 A;  4EPZ A;  3JQ0 A;  3T5V A;  4X4D A;  3ASH A;  3EDT B;  3FTZ A;  4DLQ A;  2GW1 A;  3NF1 A;  1LQC A;  2VSO E;  3QK0 A;  4GA2 A;  2OVB A;  4WNG A;  1QQB A;  3S7B A;  1PRV A;  3ZHI A;  1UN8 A;  2RD0 A;  4JHJ A;  2XCC A;  2OR1 L;  3G2S A;  3PS6 A;  1L5J A;  2CG2 A;  2XGO A;  4UWG A;  1U3D A;  4RVB A;  2ION A;  4M3O A;  5FQ8 A;  4HOQ A;  3JQ1 A;  5AIJ A;  1ZZ6 A;  1PY1 A;  1S0P A;  4TV3 A;  4AY5 A;  1PRA A;  2XPI A;  2PQR A;  3G2U A;  1PRU A;  1ADR A;  3G2V A;  2LO6 A;  2WXN A;  3F51 A;  2EQX A;  2KC7 A;  3IKO B;  4YAR A;  5EDS A;  2PE5 A;  2BNN A;  2V8S E;  3FUJ A;  4I6G A;  4JVS A;  1OWO A;  3CVL A;  3R7R A;  3ZHE A;  1HX8 A;  1ZAY A;  2M63 A;  4W9R A;  2L8N A;  5G04 C;  1QPZ A;  1DW9 A;  2WIU B;  4AVX A;  4FAD A;  4FBI A;  2PUF A;  3FTV A;  3OXG A;  4HS2 A;  3ZPJ A;  1OWN A;  4PU8 A;  3LCA A;  2UY1 A;  3CK9 A;  4EQF A;  4ILH B;  4WND A;  1O4X A;  5FZR A;  1E7V A;  4X4G A;  1SZ9 A;  3TRB A;  3FU3 A;  4WNE A;  4OVU A;  2IFU A;  3ZFW A;  4ANW A;  3KJX A;  3I4G A;  3MX3 A;  3FTU A;  3G2T A;  4NAC A;  3LKU A;  4KT6 B;  4GZ3 A;  4J6I A;  2C0M A;  4I6E A;  2J4B A;  3UQ3 A;  2X6J A;  2HR2 A;  4FN3 A;  3AS4 A;  4RG6 A;  1EYH A;  4A1G A;  2LYL A;  2VSY A;  4EZK A;  5LCW J;  3FTX A;  3CKB A;  4ILI A;  4PS8 A;  3RK6 A;  2WQ7 A;  1HF0 A;  3U4T A;  2AXV A;  1H2V C;  1XWR A;  3S7F A;  2FUL A;  2NXP A;  4O6F A;  4FA6 A;  3CK7 A;  2FBN A;  1DNP A;  4CT0 A;  5CMY A;  3G5G A;  3SZ7 A;  4I6R A;  1JFT A;  1H2T C;  2I1K A;  3CST A;  4XX5 A;  4AEZ C;  1E8W A;  3FTW A;  3RO2 A;  3U64 A;  5A7L A;  3FH8 A;  3ZYK A;  2O38 A;  4GCN A;  2XEV A;  3GW4 A;  4B94 A;  4JPS A;  4BX9 A;  4CDN A;  4U63 A;  3QWG A;  4CGV A;  2NC9 A;  2GGF A;  3FY4 A;  4UI9 J;  1UG3 A;  1E7U A;  2MHK A;  3KXA A;  3JYS A;  1NA0 A;  2OVF A;  4JHK A;  4XIF A;  4GZ6 A;  2UWJ G;  4U8H A;  4YVQ C;  1IQU A;  2WMN A;  2XCB A;  1JWL A;  4Z5D A;  4CDM A;  1IYG A;  4PH4 B;  4O8B A;  3ZW3 A;  1B0N A;  2KEJ A;  4I43 A;  3D1N I;  4KVO A;  2PPX A;  1PC2 A;  2OOE A;  1Z3Y A;  3OQO A;  4GYW A;  4L2L A;  3O9X A;  3FH7 A;  4U0Z A;  3N71 A;  3LY7 A;  4UWF A;  4I6T A;  4OB4 A;  1E3O C;  3HZI B;  3VLD A;  1PER L;  1HFA A;  3GZS A;  2FI7 A;  4GMJ A;  2HO1 A;  3OMT A;  4ACK A;  3JXB C;  3LY8 A;  4N3B A;  4AOF A;  4U07 A;  4AIF A;  4CDR A;  3MV3 B;  5BUZ A;  5BT1 A;  1FCH A;  2AWI A;  4GHJ A;  2CG3 A;  1QP4 A;  4DPR A;  4CT4 A;  1UJK A;  2IF4 A;  4ANV A;  4C9B B;  3TG5 A;  3QAR A;  3D9M A;  3CGH A;  4JL0 A;  4LRZ A;  3FH5 A;  3Q49 B;  2PUG A;  4JA9 A;  3SD5 A;  4F3V A;  4I6J A;  2LCV A;  4F1S A;  1ZPQ A;  3UFD A;  2X6F A;  3CEQ A;  4GYY A;  4L7T A;  1EFA A;  2PZI A;  1POU A;  2FF4 A;  2Y4U A;  4Q94 A;  4IWR A;  3UT8 A;  4X4B A;  1IC8 A;  1LCD A;  3FYA A;  1B89 A;  4GCO A;  3B13 A;  3APD A;  4JEU A;  4PS3 A;  4UWL A;  2XPY A;  3TXM A;  4UQZ A;  5FQ6 A;  4BTB A;  5C1D A;  3CQC B;  1IHG A;  3ZXS A;  4NQ0 A;  3HDX A;  3IHY A;  4GB9 A;  2WQH A;  1DWK A;  1JPL A;  1WH6 A;  2J09 A;  1HG5 A;  2KPJ A;  2E0I A;  4H7X A;  4B8A A;  4P29 A;  1SQ8 A;  3ZYQ A;  2VGX B;  4E85 A;  5DBK A;  4X4F A;  3CV0 A;  3QWW A;  2WM9 A;  1A17 A;  3ZHM A;  5BV1 A;  3ZGQ A;  2WXH A;  3QB2 A;  2LYJ A;  4U04 A;  4IA8 A;  3Q47 B;  5BW8 C;  3QWP A;  2YIN A;  3PUJ A;  2Y3A A;  3QJZ A;  2OFY A;  1L1M A;  4JXT A;  2KZ8 A;  3FU6 A;  3CHS A;  5G55 A;  4AXH A;  3JXD L;  4WWP A;  3L08 A;  1UN9 A;  2MOW A;  4J0U A;  3UT7 A;  3EJN A;  2V5F A;  4YG7 B;  3MV2 B;  2CRO A;  3SFZ A;  3CRO L;  3SI5 A;  4GZ5 A;  1ZZB A;  1ZZ7 A;  4I1O B;  4N5C A;  1E96 B;  5JJ6 A;  5KCM A;  2CHZ A;  4N3C A;  2PIJ A;  2CHX A;  3QOU A;  2X38 A;  4HOU A;  3PVL A;  1HXI A;  2FEZ A;  1R69 A;  2AW6 A;  2WUS R;  4X4H A;  4PU7 A;  2LAH A;  4YBA A;  5FJY A;  4BT8 A;  2YHE A;  4XE0 A;  4GA0 A;  2B5A A;  2HSG A;  2LYQ A;  2R17 C;  4L23 A;  1PAQ A;  4G23 A;  3T5X A;  3FUK A;  3OTN A;  4ABN A;  2J4D A;  3L13 A;  4CCA A;  4EZJ A;  3MGB A;  1RZR D;  3CVP A;  3D9O A;  3RRM B;  2EF8 A;  1EDU A;  3MKQ B;  2WXJ A;  4GML A;  3OQM A;  3LDZ A;  3QF3 A;  3MZL B;  5CHE E;  5LX8 A;  4MLP A;  4ANX A;  4YND A;  4DI4 A;  2JVL A;  3SCF A;  3PXP A;  1ZVV A;  3EUS A;  1ZZ9 A;  2BNO A;  4HXI A;  2R63 A;  4NRH B;  2CSF A;  4B0Z A;  2ICT A;  1Z3X A;  4AV7 A;  4D10 C;  3CVN A;  4I1M A;  3BS3 A;  3SNX A;  1ZS4 A;  1TJC A;  3L22 A;  2V4L A;  4APO A;  4EEC A;  4FHK A;  1N52 A;  3ASD A;  4GA1 A;  3RZZ A;  3HHM A;  4GPK A;  1BDI A;  3GN5 B;  2YNQ A;  4L1B A;  3GZ2 A;  3QQ6 A;  4Z59 A;  3FUN A;  2KCL A;  1NA3 A;  4KXK B;  1Y8M A;  1R63 A;  1UJJ A;  2PM6 A;  3FTY A;  3I3N A;  1HZ4 A;  3FHE A;  1RPE L;  3QDN A;  5ANL A;  5BPP A;  3U66 A;  1OWP A;  1WAO 1;  3CHQ A;  4U0U A;  3RU0 A;  5JJT A;  2VTB B;  1UW4 B;  1ZZC A;  4X4C A;  1U3C A;  2ZU6 B;  5CCL A;  2X3M A;  3U9W A;  5KJL A;  3MYV A;  5CCM A;  5FZQ A;  3ENE A;  4YG4 A;  4BFR A;  1NER A;  5G04 J;  2V0P A;  2PUE A;  1UXC A;  1RZR A;  2KAT A;  5BV0 A;  3L1P A;  2HIN A;  5K98 B;  2J49 A;  2WXQ A;  3Q5M A;  4HFG A;  3CVX A;  4Z58 A;  4JQD A;  2LNI A;  2RG8 A;  3CVW A;  5ARF A;  2VSX E;  1MQS A;  4URK A;  2X6H A;  3KAE A;  4G25 A;  3HVE B;  4PDX A;  2XJ3 A;  3MLF A;  2VGX A;  3IBE A;  5FZS A;  1HH8 A;  3FP3 A;  3GZ1 A;  4R7L A;  1WY6 A;  5D0O D;  3R9A B;  3RJV A;  3SBT B;  4EZL A;  2O4A A;  2VJ8 A;  3PRE A;  1Y9Q A;  2Y4T A;  2XQ0 A;  1XNF A;  1WET A;  3KS2 A;  1BPO A;  4JHR A;  1OWM A;  5ARG A;  3UT4 A;  4N2Q A;  4FUL A;  2LAI A;  1QQA A;  1JWG A;  2XIU A;  3CKC A;  3LEW A;  4J1X A;  3CHR A;  3BG1 B;  3OXF A;  3QKY A;  1E90 A;  2ICP A;  2IQC A;  3MEK A;  3QYX A;  1H6K A;  2MQK A;  3FUM A;  4I9C A;  4FLH A;  4WAF A;  4JW1 A;  3G7D A;  3JXC L;  5FQ7 A;  5AEN A;  1KLX A;  3CSF A;  3PE4 A;  3MKR A;  5EX3 A;  1LLI A;  4KMO A;  5LP0 A;  4KZ0 A;  4A3T A;  2BJC A;  2A4Z A;  1EPU A;  2PL2 A;  2VQ2 A;  4ME2 A;  3TAX A;  1SQM A;  3B7R L;  3CQG B;  4OYS A;  1IQR A;  2XI8 A;  5HQ8 A;  1RZS A;  2GRM A;  1NZN A;  2PQN A;  2WXK A;  3CR3 A;  4FU3 A;  4K0R A;  4Y6W A;  3C98 A;  5EKQ D;  5G05 C;  4AM9 A;  3UPV A;  1Z6T A;  2WXL A;  1W3B A;  2P58 C;  4EBA G;  3NZS A;  2KCK A;  3FWV A;  3MKQ A;  4EBA A;  2LYR A;  1HG2 A;  4H7Y A;  4OVV A;  4F7A A;  4G24 A;  1EF1 C;  3FUE A;  4F8D A;  2NSZ A;  3FUL A;  4Z5H A;  3CLC A;  2A6C A;  2XGS A;  3CHP A;  3CHM A;  3MJW A;  3PEV B;  4WWO A;  3DBS A;  2KZT B;  4HLE A;  5FWQ A;  1OSL A;  4GQM A;  4MCX A;  4IVZ A;  4YG1 A;  5HI7 A;  5A23 A;  3F52 A;  5J08 A;  2MEZ A;  3VTX A;  3FU5 A;  1OWL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...