2AXWA

Structure of drad invasin from uropathogenic escherichia coli
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
134
structure length
134
Chain Sequence
AELHLESRGGSGTQLRDGAKVATGRIICREAHTGFHVWMNERQVDGRAERYVVQSKDGRHELRVRTGGDGWSPVKGEGGKGVSRPGQEEQVFFDVMADGNQDIAPGEYRFSVGGACVVPQEKLAAALEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of DraD invasin from uropathogenic Escherichia coli: a dimer with swapped beta-tails.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Cell invasion
molecule keywords DraD invasin
total genus 23
structure length 134
sequence length 134
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05775 AfaD Enterobacteria AfaD invasin protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1950 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2axwA01
2CNYA 2CNZA 2AXWA 2CO7A 4OR1A 4PHXA 2CO4A 5D55A 2IXQA 3UIYA 2CO1A 2CO6A 2CO2A 3UIZA 2FVNA 2CO3A
chains in the Genus database with same CATH superfamily
3OC8A 4KKRA 4NGHL 3RGHA 3ZSTA 5GJTL 2IH1B 4ELKA 2C1PB 4HC1A 4XZUB 1X44A 3JBG7 3D3VD 2QGEA 3OLGA 4NQDD 4QXTB 3MCKB 4NJAH 1FH2A 1B6DA 2VZOA 4LPWA 3BVWA 1V54B 3B9KD 3QIWA 5T1KD 3PIQB 2CPUA 2E75C 3GXFA 3NJKA 3Q2CA 2UV3A 2VZUA 2DQIH 4FFZH 4Y4KC 5J6GB 5EOQL 4HP5A 3NJMA 3BDYH 3AB0C 4KFZC 3LNHA 4HCRA 3DXAA 2JI3A 2CDEB 3S3BB 3Q8AA 2H1PH 1HQRB 1E50A 4EUPA 3LEXB 4LAJH 3QI9D 1WBZA 1MUJA 1Y0LA 1AXTL 2FX8L 4QKXB 1LO2H 4L2LA 3A67L 4J8QA 2GFBB 1P4LA 1NFIA 3NESA 1MCNA 2C9QA 3O4LD 2BVQB 3WIAA 3PV6B 3MV9D 4AYDC 3HMWH 5EU4A 3ZRFC 1HH6A 3DGGA 2IPUK 2WNWA 5F7EL 4JQIH 3O11A 3F8UB 5D93C 2A73B 2NXYC 1VFBA 3AXLA 1F41A 1RUMH 3GZKA 1E4KC 5IFHL 2KDYA 5MERA 2EH7H 3M1BB 1F4XH 4JDTL 1AGFB 4LXFA 1HYSC 2AV1B 1BJ1J 2CRZA 5FDWA 1S8DA 3HN5A 2C7UA 1F18A 1N67A 1F97A 3D39E 4AEHL 3WKMH 2BHYA 4M5ZH 5LCVH 3KNBA 3D39D 4P3CL 5IBTH 3SO3B 2ZG2A 4IJ3C 3BUIA 3QHFH 2R23A 4BHUI 4X6FB 5DWUH 1MEXH 1KN2L 4Y16C 5C09E 4H0HB 1EZUA 5D1ZA 1CFBA 1Z5LB 3FQ2A 4NQEA 5D7IF 2O61A 3HCVA 2F53B 5KYNA 2WNKA 4RVBA 4Y16A 2W0LA 3VU1A 4XAWL 2BZCA 4P2CG 4C55A 2Y06H 2ZOTA 4YE4H 3RGVB 2NTFB 3CMOH 4AH2A 1BLNA 3OMNB 1AD9A 2ATPA 3ZPDA 1Y07A 1R34A 4JHAL 3PCYA 4N0RA 1JNNL 1U9KA 4YXHL 5IF0A 1U8KB 1RZKL 4ENEC 5GZNC 4HD5A 5HDBE 1IQWH 4HWBH 3IK2A 3OKEA 4ZI8A 1BZ9A 4PGBB 3UPRB 1MFCL 1IUZA 1U41A 3HI1A 2DS4A 1JGVL 1TEFA 2DQJL 3SKOA 2CKNA 3KLDA 3LEYH 4UTAH 1K6QH 4Y5VC 3OZ9H 2AV7B 4TQ8A 5EOCJ 2Y9RT 3MYJA 3NZ8A 4K94C 1J88A 2DLFL 3FRPB 4HVBA 2LHAA 2EDXA 3EYVB 1A7RH 3WIHA 4AL8C 3DA0A 2IALA 5JPNB 1T22B 4YBHA 5IHHA 2APXA 1U3HC 2RQEA 3QUYD 1JPST 3KLHD 2EINB 3QJOA 1UD6A 4U1KB 3KBHE 4QJ5B 5GZOA 4F7MA 3D3VE 4P46B 5DSCB 1YPZB 4L29A 2MPVA 5G55A 1DJIA 1N5AB 3GD1C 4NO0B 5DRWB 2R2EB 4ENZA 4HZLB 4IK7A 2R56H 3MLSH 1ACCA 2ICCA 2V5SA 2XCMC 1G0XA 4JPKL 4KK5D 1HSAB 4P9HC 1YY8A 5DJXA 1TUPA 3SGKA 5EIVA 3QYCA 3UTPE 1ML0A 3G5ZB 3AVEA 5C0RL 5ALCL 2W94A 1RK1A 2R1WB 3EH4B 3HZMA 4I18A 4PJFA 3BZ4A 4Z5RA 1A4AA 3NA9H 3CDZB 1DJHA 2Y23A 5HYSB 3TH2T 3KH3A 3PRZA 4U1HA 5K9JH 5F7NC 2I9LA 1H0DA 4H8WL 5I8EB 3OR6A 4NZUL 4FQ1L 4Y5XB 4U3XA 3BOVA 1EEZA 2H1XA 4FX5A 3FRPG 5F8QC 2IMNA 2XX1A 4MXWL 3S98A 1T0OA 2NX5A 5GIRA 1JPTH 4LLVB 5KVEH 4WFGE 3ARDD 4XE5B 3TVMD 5MEPB 3V4PH 3GSVB 2QSQA 2A4CA 1XGRA 3DSNA 1CGWA 5I74C 1G4RA 1G0DA 3BZDA 3K72B 1CTOA 3WI9A 1N6QH 1FVEB 4X4YA 3IJEB 5DS1A 4RWHA 1AD0B 4M7ZC 5L9DH 1JNLL 5LGHL 3D50A 2FJGB 4HKXB 2A83B 4KQ3H 1DL7H 2AJXL 2CGRL 4X42A 4XPBH 3O8XC 1LQBC 1TETH 2ZSWA 5FUZH 4OM0H 4CVWA 5AB2A 1G7JB 1D6VH 1LL1A 1KELH 1EDYA 1NEZB 2VR3A 1BZ7A 1UWXK 1EMTH 3TYGL 2KH2B 3P30L 4MWFB 3SPVA 4LSTL 2G75A 2M2DA 5E9DE 4BELD 4YHYB 4KO6A 5CD3B 5F9JA 4OU3A 3WENA 1FE8H 3GSVA 4OZFB 3VNYA 4B9KC 3P73B 2CALA 2EIKB 1Z9MA 4RIRA 3HRZA 4NQQA 1THAA 1SJEB 2A1WL 3BLBA 2DD8H 4KXDA 4TVUA 3GLAA 2B9BA 5ETUA 3T2NL 6FABL 5TK4A 4LB8A 3FCBA 1RZIB 1U8MB 4BA8A 4QRQA 2NXYB 1LK3H 1SDDA 1I7TA 4J3SA 5EUOF 3Q7JA 2WO4A 4BZYA 1MXGA 1MFBH 2Q8AL 3K5SA 4LSVL 1FLRH 1A5FL 1AKPA 3NIFF 3G5ZA 1J86A 5E0FA 5E99L 2WBJB 3Q8CA 1X9QA 3ZDXB 3FO0L 4EI6A 5LNGA 1KY7A 1NANH 1T7WA 3TVMB 5JR1L 3B43A 1QSEA 4P4KB 4TL5A 3VFGH 3N42B 3TNMB 2BINA 3C6LC 2G2PA 5E1QA 1CVRA 3W0WB 1JGDB 5KS9A 4XWOC 2BSSA 5SWZB 3ZE2F 4O02L 3OB0H 1FG9C 5I1DB 3LSOB 3BJLA 4Z77B 5D8JL 3BPLB 1UXWB 4LDCA 2YGQA 3S7GA 2V2WA 1PTZA 2EDJA 3F3HA 3E2HB 4BZ1A 1EZVY 2VITA 3BLKA 2EYTB 3EYVA 4M6NL 4FNQA 2ZJSL 3ZJAA 1NL0H 5JDJA 1OK0A 1XCXA 1TVBB 3BAIA 4KRPD 3SKMA 5I6LA 3EXLA 3PWJA 3SKOB 2K7PA 4AKOA 2ALWA 2HZHA 5FFLA 3FQWA 3T0EA 3CXHJ 4L3FA 5BUGA 4XODA 5HDBB 2V2XA 1JWUB 5ITFB 1BAFH 5LGJA 3NACH 2Y1AA 3P9LA 5HI3D 3D12B 3V4LA 1G7LA 2PW1B 3HI6H 5IJKC 5E95B 3T2QA 4DW2H 4S2SA 3T8MA 3VRLF 5AYUH 1JGUH 5EUKA 3IGAA 4G43B 3RIAF 4FMVA 1V27A 1IEBA 4O5LH 5CO1A 3GSOA 3JV6B 5E08H 3O0RL 4PEEA 4MGXA 4PJAF 3UROR 3UX9B 4PWIA 2AERT 4B3EA 4WWKA 4WW2A 2A4ZA 4EIZC 3RKDD 2ADGA 2VLJB 3NQKA 4FXGB 4PGEB 2Y7MA 1EQWA 5GZNA 4M43H 2XY2A 3ATAA 3HW7A 5E4EC 3MRLB 5MEQB 1TVDA 5GS1A 4F8NA 3VXUB 1F1AA 2H9GA 1A6AA 4URKA 5CCHE 5HYFA 3QULB 2W9DH 3MV7D 5AW6B 4YLBA 4AYSA 2VDRH 1INEH 3L13A 4GMTH 2XZCL 1O6TA 1YC8A 1JAEA 1BFVH 3H56A 4JRYB 1UXLA 1QA9A 4WNQB 4N6RA 4FQ2L 2N1TE 2PTTB 3D69A 2CZNA 1SY6H 5E56A 2ATKA 2GB2A 3ILPA 3FRUB 1NFDB 5FKPA 2E27L 2X4OB 4XVSL 4S1DC 1RULH 3GK8H 5I0DA 3AC0A 3QCUL 1IMHC 3W57A 5DVMA 4RFNB 5EU4B 4JVUA 5H37H 1AP2B 4Y5XC 2BVQA 3RY6A 1L9QA 2GK0A 4G6FD 5GGRY 1MRDL 5C6PB 3DO7B 1OTUC 5CU9A 3DVNB 3IDNB 2H9GB 2GJZB 3SGEH 1Y0LB 4K5PA 4UILH 1NQBA 1SDAB 3NZSA 3QUZD 4FXGA 2MNWA 4XE0A 2E9JA 4OI7A 4PCKA 1IJ9A 2CBPA 4AGMA 2Y07H 4KUCF 2MPAL 4KOBA 4Y5YB 4XP6H 1AQMA 4C59B 3MKKA 3GM0A 4R7NA 3LHPL 5SWSB 3LIZA 5LGYA 4AQAB 1N2RA 1GW0A 1OWWA 1P4IH 4Y4HB 4MNQD 5E6SB 4EEEA 4I3RH 3MLRH 5EIIB 4H5SA 1PDKB 4ZUWB 3NA4A 3H9SD 1A4JA 3O6LL 4L1BA 5DF0A 3TT1L 3UTQB 4D7BA 1A6VH 3FOLA 4DNLA 1U8JB 3CZGA 3WLBB 1N26A 3WO4B 5LGJB 3L7EB 4DP9X 4P0DA 3IPBA 2WO3B 2J8UB 4FJZA 1RHHB 4CL7A 5MP6L 3UAJA 3FQWB 4A67A 2C1PA 5ESQA 1SMOA 3O0LA 4KHTL 1TQCB 5C0ND 3FFOA 3PWJB 1XBRA 6TAAA 3QORB 3D34A 5A6LA 4OZHF 1JK9A 2A74B 1FYTE 3RWGA 3DPBA 1OAUL 4OJDH 3ESNA 1I3RA 4ANUA 5GJSH 1SF5A 1TF4A 1T5XA 1E67A 4NNYB 5I0VA 3HAEG 5JHMA 5E8NA 1E2VA 3BO8A 3B9KB 5GGVY 3SE4C 3FQRB 4NQCE 4ODSL 4FFVC 3W0WA 3VGGA 4JMNA 1C5CH 4NQED 5FYKE 3APDA 1P4BL 3OMAB 1DDTA 3BPCB 1YG9A 5D2LA 3L4UA 2R0ZH 3QJQB 3RPIA 5DMKA 4TQEH 1HZHL 3ARFA 2YPKA 3Q3GB 4UUJA 4JZOA 3ARDC 1HCYA 5I1HL 4U6VH 3HBZA 4W9GC 3WDIA 1FZOB 4OT1H 1F2QA 4M5SA 1TQUA 4XC3H 3DTXA 4Q0XH 1MH5A 5CWSA 1NTDA 1KNOA 2EUWA 2F8XC 4I5BA 4QYOA 3LZNA 1BQ5A 1WBXA 2YOCA 1L3WA 2J8UE 4KQ4L 1A9BA 1NBVH 4HU2A 3FC8A 1OTTD 4GEJA 3DSFL 4I1NB 4KTDL 1FZKB 3LYRA 3BUYA 3P73A 1CI3M 1YEHH 3FFCB 3RAJL 4JZNA 3NFPA 3PAZA 4AYBA 1LTXA 1PCXA 2J1WA 1ZGLM 4GFTB 3U82B 3M7OA 5TPWH 1JHTA 3IN0A 4MWFA 3SPVB 1O5PA 4IU3A 3KLSA 2EAEA 4L9LB 5A43C 4S1SH 5IY5B 1NEZA 4GG8A 1KLGA 2C4XA 3MCLH 3ZE2E 1RZJC 3NPSC 5T8IA 3DRTB 3PWPD 4YS4A 3JVFC 1P5UA 4V1DB 4YFLI 2W0PA 3LEVL 5SWQB 1CWVA 1DBKH 2D3LA 1TKWA 4DEPB 4LCCA 3II1A 4U7MA 3VDAA 2VZ1A 1KEGL 4OF3A 2E9GA 3G6JF 1EGJL 1KCVL 5F3BA 3MRHB 4QRFA 3FU3A 5JO5B 1HINH 2NNFA 2VLRD 4YE0A 4J8RA 5I6NA 4F58H 5EU6A 5J13B 2JB5L 5FUOH 3S2CA 4CADA 4C4UA 2H26B 5ANME 5IQ9B 5MEPA 2X9ZA 3OGCA 3VRLE 3ZMRA 3V5DB 2V6HA 2WIMA 1F6FB 2V9RA 4ZSOB 1QSED 1OCRB 4MCMA 4HIIA 2AANA 4FQIH 1S7XA 4X7DC 1LQSR 2WUBL 4UZUA 1O7DC 5T5FL 3VXMB 5FA3A 2Z31C 3S3JA 4G7YH 4ELDA 3PYCA 3BZFA 2QVIA 4I0PB 2FNWA 1XR9B 3H42H 3OAYK 4N28A 5IFAH 1HXYB 4WK2B 2V5MA 4QTFA 1M4KA 2YLHA 1IKNC 5AOLA 4AEFA 2VDOB 3WCYA 2J44A 3WEXB 1GGIL 4MJIE 4PJBB 4R96B 2FO1A 1UC6A 1S5IL 1JGEB 3ILEA 5FWRA 5F7HA 1YY8B 2E7DA 4AGOA 2F19H 4ANWA 4DUVA 4NERA 4UT6A 3ZE0F 4MHHI 2E7MA 5EIIA 4YHML 5JHLH 2D73A 1GYCA 1NSNL 4KO7A 3H2WA 5I17A 1FFRA 1AE6H 4MYWB 5D7JB 2ADJB 3OHXB 3VTAA 2AC0A 2OCCB 5DQDH 1HYSD 1ZTXE 5CS7A 1YAZA 5AW9B 1TQVA 3GSUA 3M07A 4WFHE 4YDLC 4J3OC 5C0BD 2FX9H 5B3SB 5IUSA 3CE1A 1C5BL 1QLFA 1CDHA 4ZO7A 4D3CL 5FYLH 3U0PB 5F97E 3EYUH 1F58H 3V6BR 2R39A 2FBJH 1T7YA 4QRPE 5J0BA 2JIXA 3M86A 2EVJA 3MODH 4ONGL 3RTQD 1MCBA 3EO0B 4PJDA 2VDNH 4ZFOA 1KTCA 1XF5A 4GAYA 4PBDA 4GRWH 5D7JC 3HI1B 5H4YA 2WOYA 4Z0BL 2B0SH 2XQYG 2NY7H 3UACA 2H6PB 3I6LD 4PD4J 3VXRD 2WQAA 3BQVA 3F85A 3L5XH 5JXEC 3SYOA 3OKDA 4ZNEA 3ZIMA 2ATAA 2J6EH 2OULB 1J18A 3DTDA 3G6JB 1D5ZB 4U1MA 3D69B 4DESA 2A74C 1J5DA 2V0AA 4L37A 4ZOAA 1TQTA 4BSVB 1ZA3A 5LVEA 1OTSC 3EOBB 4NOBA 5TQ0H 1KPVB 1MSPA 5C7ZA 1VB9A 4JB9H 3U6XS 1TR7A 4OCXH 3HCVB 3VRIB 3ABLB 4U31A 3INUL 4MA7L 1KCRH 4ZAKC 4OZ4A 4RFNC 1JHLH 5DYFA 1E4HA 1QRNA 3I9PA 3APFA 4A6YA 1TJGL 4P23C 4U7KA 4D9QE 4EQ3A 5LAPA 3IPFA 3V6OE 2FYVA 3HZYB 4IKNA 4S1QL 5D2NB 3N41F 4Q4EA 2IAMD 1I8KB 3VW3L 3F7QA 4FNRA 2AQ1A 2Q8BH 3SDXA 3E3QC 1H6TA 1RZ8A 4UM8A 2A2QT 4ODVH 5I2IB 2VC2L 3VFOB 3C5ZC 4IGBB 5I66A 4S1RH 3BWZA 2Z31D 1G7LB 4OZFG 3SYPA 1R0AL 5HI5D 5J89A 3G6JA 1GXEA 4M3HA 4JZJC 5IESL 3FB6A 5DD3H 2OJZH 4KNTA 3RPKA 3WMPA 4RGNE 3B7YA 1LD9A 1RXLA 1HH6B 1OCCB 3TIDA 1KIPA 1JYXA 1W80A 4Q89A 4A7SA 2FEDD 1M3IA 3N06B 4ZUUA 4ORZC 3MGAA 4K3HA 4KVCL 5TE4L 4PJ7B 4B5ZA 2DEYX 1J8RA 4EUPB 2ZXQA 3EYSL 1LJMA 1JGLL 3HG3A 1TZHA 2N4IA 4OIIH 2WQVA 3L3JA 3V4VB 4MCYB 4OJEH 3NCXA 4RSVA 3VRJB 2VZVA 3PWVA 1CICC 1AMYA 1PEWA 1S7QB 4YDZA 5SX5H 4BSJA 4XNQA 2VW7A 4CMHB 5FV2A 2Z91B 4JJHA 3C5ZD 1D2PA 3R4DA 2EH8H 1EEYA 3NMEA 4FTVD 4Q97A 4A38A 4F2MB 3BPLC 1MRCL 5J6HA 1Z9PA 3GXDA 4ERSH 2C3WA 1F86A 4LBEB 5DS8A 3TEWA 1QLEB 2B4CH 4MMZA 5TE6H 4G1EB 1WSST 1J5OH 1TVHA 5E94B 1PKQB 5INDA 3T6VA 1IVTA 4YFDB 1O6SB 1XZ0B 3RI5K 1S7RB 3ZDZE 3P77B 1ES0A 4HIIB 5BW7C 3KPNB 3TJEH 3TBTA 3HKFA 1V3LA 4KZEL 1SJHB 3EFOB 4BQCA 3TCLB 2NNRA 3ALWA 2VLKD 3I6KA 4M6AA 1CLYL 1E3XA 1UVQB 3MXWH 4GBXA 3UBXB 3WY3A 5B22A 1HHKA 2EXWD 2NY5H 4JFZL 1D5BB 1SBSH 2VN6A 1BVOA 1PL3A 5AW1B 4G7QB 4AUJA 5JXED 3N43B 4XR8C 4E9RA 2ZYRA 1AIZA 1QFWM 3ZKSD 5IZ7A 1ADWA 1W72B 1ET5A 4HA1A 5K39B 4ZMVA 4PGCB 2WJ7A 3LXAA 4J4PA 4NIKB 3QWNA 2G5UA 2Q2EB 4IRZL 4HGMA 5EBLB 4YR6A 1FA4A 4K9EH 1KLGB 5FHBL 3TONA 4J3OD 5DVLA 3NIDF 5I8KH 1NCWH 2D3JA 5IIEB 5GGSB 5BJTA 4KROC 2DQGH 5D1QD 4FQJL 1KPRB 3D51A 2EUXA 1O6VA 4OZIA 5LBSA 4U2YA 4PRDB 3ZTEA 2QVKA 4WHCA 1A7OL 5T1LB 4X6DE 1FNFA 3TJHC 1EEZB 1ETA1 2A6KA 1GKEA 2QLVB 1OF2A 3ZRSA 5CLWA 1ZDQA 2UZIL 1NCDH 3CH1A 1H3WM 1EERB 5HDBF 3UP1A 5C2UB 5HYSA 2W88A 4PW3A 4OD3H 4KY1L 1MH5B 2PYED 4E9WA 4ZFGH 1BQRA 4DETA 3TBCA 1AVAA 2LFEA 1FZOA 4N8UA 1T89A 1WGOA 4EZMA 4ZQTA 3TJPA 1L6XA 4N9OB 4PJ6A 4M6OL 4OQTL 5EZIL 2KDGA 1TQSA 2Q1EA 4YHPA 1U8HB 4PJXA 2WXHA 2Y7QB 4OLXH 2H6OA 3NSCA 3QUXB 4EN2A 3T6WA 4LL1A 4GS7B 5EN3A 1A6ZA 4Y7OC 3ZTNL 1QO3B 3K6DA 2XUWA 4W68A 4L1SA 1LK2B 4UZGA 2BCKA 2WKGA 3O9WB 4K73A 2B9AA 3GSWB 3LCYA 1HKLH 1XTMA 5DVOA 2BXZA 1XGZA 2XX0A 5DT1H 4FQPA 3PNRB 1MDAA 1AHWA 2BVPB 2MKWA 4WTQA 5LUMA 1OM9A 4G8GE 5A16A 1I3RB 1OANA 4M93B 3EO1B 3LKRB 1UOLA 4O02A 4P2RB 1JK9B 2A74A 3T4AC 4TNWK 4LOVA 4U1JA 1IGJA 1I9EA 3QXDA 2VXVL 1G7QB 3OKKA 4GW5B 3S36H 1DSWA 3NIDE 3LQAC 2DKUA 5F7UA 1NCUA 4U3CA 2F54E 3MV8A 4E9LA 1NLDL 1YEWA 5DA0B 3SJVA 3SY6A 4EDWL 5ICXB 4FXGC 4HLZG 4MMXA 4U6XA 4MNGB 2FT7A 1KWKA 4KY2A 3WLBA 3OHXC 3CCHB 1I9IH 4OZHE 4AQ1B 2OAAA 2J5WA 2Y5QA 2KL6A 2E6QA 3L1FA 4M48H 2OZ4A 4B7IA 1CXIA 4PI0A 5AQ0A 4B53A 5C2BL 1CGSL 1K8IA 1OE2A 2R69H 1BLNB 1N2RB 3AG3B 3RGVA 1V7NL 4G42B 1PZCA 3GMLA 2A0LD 4R7NB 3O8XA 2GBUA 1UACL 2JCCB 5HI3C 2F53A 3HZVA 3HG5A 2HJKB 3PXHA 4PRHA 5HJBA 5FECB 1YYML 3STZB 4OB5H 2DBLH 2VAAA 5CUSH 4K9JA 3IJ8A 3LS5H 3DO4A 4MZIA 4JY4B 3NYKA 1I7UA 5CIPH 1UEMA 1I9RH 1XGUA 4PJFE 2NUPA 5EF0A 1F8TL 2GVYA 1MZYA 3V4VL 1URZA 4CDGC 3UAJC 4UDUB 4IHOA 3TLRA 4AIEA 1S8DB 1YY9D 3SE8H 2HG5B 2QVTA 2WLMA 3FFDA 1V3MA 3CC5B 3Q9PA 3N2JA 1NCIA 3RNKB 1XVSA 1T7XA 4JPIA 1AXSA 3AXLB 1VFBB 1KV7A 25C8L 4ABWA 1HH9A 1S7WB 3T8XA 5C09B 5D7SH 4FFVD 5EIIG 1ND0B 1T0NA 3A4EA 4F7TA 3W11C 4GRLA 5BRZA 2NW3A 3T3ME 4FMFA 2F6AA 1FNGB 3H2PA 2YEZA 2WSKA 3L2LA 4K3EL 3WL9B 4BDVB 1QABA 5E6IB 5EPMB 2J72A 4NN5C 5KJRH 1DQQA 2WINB 2VUOA 1N6UA 2CDEA 1CN4A 1JWSB 4NM4L 5GS0C 3FZUC 2JCCE 1ADQL 3TZVA 1GJUA 2VLKE 3WFEL 1IEBB 1KZQA 1OSPH 1NCNA 1T1WA 5J6GA 1UATA 1UXMA 5EUKB 4CW1A 1DFBL 5C0FA 1V10A 1ZIBA 3HC4H 4XTRD 2B3RA 3L5HA 1E8XA 4AGLA 1HOEA 4XTRC 2BWQA 4NHUA 4OTXL 5IMOA 1EAOA 3A6OA 2EDFA 3EH1A 1WTGT 4P2OB 5BV7B 2CDFB 5AKTA 2YRPA 4MAZA 2Z1PA 3NRPA 3CFCH 2LQRA 1ET8A 2H3NA 1DEDA 3D2TA 4LPYA 4EZJA 3TBWA 5JPMB 2X28A 4KC3B 2ILLA 2YKLH 3EDJA 3QQNA 3X3GH 3MJ7B 4F57L 4LCVA 5A2IH 2F7OA 2BK8A 4TNFA 2JF1A 4I87A 3O6KH 3D4ZA 2VITB 3NZUA 1OEZW 4K8RH 4K7PX 2IPTH 3P2DA 5TQ2H 1KPUB 4HWZB 1CFNB 2E4FA 3S3PA 3W11D 1OB0A 1N3NB 4LKXB 2AXWA 1QI5A 5AKVA 5DJCB 5EU5B 1P0SE 2BWDA 5L6YL 5KS9B 1HHIA 2LLGA 5H35A 2XLLA 3GMOA 1WEJH 1JS4A 3QRLA 1BQLL 3KS0H 4OR1A 2IAMA 5B4MD 3IB4A 4S1DD 1Z0NA 3D4GA 5D5MB 2YSTA 3I6GB 4UU9A 1QP1A 2Y5TB 4KI1A 3V0IA 3WNMA 4L8SC 3MGTA 3T0EC 4FNLH 1U8CA 3MLTB 1BA9A 4XNMA 5I5MA 1TPXC 4OZGA 1A1NA 3BE1H 3AQXA 1YVLA 1RUAH 2Z0UA 2Z31A 2UXGA 4WUKL 4GQRA 4XMPL 2HFEA 3BC9A 3C5XA 43C9B 4R0LB 2JJTC 2XTJC 1IKOP 3KWVA 4H0GA 2DJMA 4BV1A 3MA7B 4B5EA 2VMEA 3DUHA 1I7TB 1X5FA 2N0MA 3EDFA 4QRQB 4LMQI 1MJUH 4P57B 4PSPA 1G6RL 1EZSA 3QUMB 1EJOL 4A7TA 2ZOWA 2YD6A 1RZJL 2FUTA 1INQA 1UKTA 4QWWC 1IZKA 1DQTA 4JFQB 2VDOH 1X4YA 1D9KD 3MTRA 5LDUA 3WNKA 2IGFL 4KQ0A 4XBEL 1BVKB 3CHXA 3MJ9H 4XMXA 3NIGB 3EDDA 3GTVA 4NC1C 5CZXD 4ODXA 4AW4A 4LCIH 4WFEE 4DIXA 4YL9A 1F6AB 3VFMA 2VDKH 4RZCA 4UQAA 5CJOL 5ILTL 3RVVD 1DANT 2RMNA 1IQDA 2YARA 1HCZA 1XR8A 5F6IC 1NDMA 3ARRA 3S37H 3STLA 4I9WD 3PHSA 4FC3E 4YWGL 3EOYG 1TZIA 2AW2A 2FQGA 4RDBA 4KRPC 3K46A 2VR9A 4M03A 3CVDA 4KJYA 2CG9X 2K6ZA 1AD0A 3VXSB 3KLHC 1PD1A 3N43F 3QUXD 2HAZA 1MCCA 4WVRA 4DGIH 4NZ8A 3NDZE 3X14B 4PTTB 1JXJA 3HOGA 5FGCB 4YHIA 1FNAA 2J4WH 3D06A 4JN1H 1CXEA 1E7VA 3N44B 3MBEB 2B3IA 4AL8L 1KB5L 5AYQA 1DBAL 3RZWA 4HXBH 2EUVA 2FHBA 5GIRB 3KPRB 4XH2A 3H1ZA 3QDJD 4OVUA 3ZZLA 2C1OB 5IJKA 1YN7B 5DYOA 3C6LD 5F6HI 2Q7YB 4B7LA 1XX9C 4XPTL 3OR6B 1TTAA 2F61A 3VFNA 4Y88A 1BDYA 2BRRH 1CDGA 1ZA6B 4M6MH 4OM1L 4PG9A 3DIFA 4WFHD 3CDZA 3VFMB 2XG4A 1BXUA 3BZ4B 4UBDD 3RVTD 5HTSA 1XTLA 3KJ6H 4NNXB 4E41A 1RZQA 3QZBA 5C08A 3QORC 1C16A 1FO0H 1N64L 1FVDA 3RJDA 2OSYA 3RWHA 2ZF8A 4PTUA 4UYPA 1SUHA 4GSDH 3DX4A 1DBBL 3WEMA 1INDH 2WTRB 3RB7A 4A55A 2HKAA 1BGXL 4WFFE 2JJSC 2R2HB 3O2VH 1E4WH 2MFNA 4XHJD 4EXKA 2DF3A 1YYLH 5JORA 5DHDA 1WK0A 4F7MB 4FEIA 2F8VA 2IXQB 3NP4A 4KUZH 4N2MA 1JZ2A 3DJTA 1DQML 4X2UA 3KPRE 3T1FB 1BVNP 1TSRA 1T3FB 5CEZL 4GI8A 4PRBA 5B1BB 3WY1A 1HU8A 2ZAIA 2NUTB 4LSQL 5HYEA 3MX0A 2FVNA 4NENB 4AT6A 3V4PA 2DLHA 4W9FC 4POYA 3K71A 2AAAA 2CXGA 2BNRB 3FTYA 3NJFA 5HGBB 1YDPB 3WLWD 3QK0A 2R1YB 4PS7A 4WI7A 1JVOA 2DQTH 2JJTA 3CIAA 3CSGA 5LBSL 1UZ8A 1N3NA 4G8EA 1IL1A 1KLUA 5I1GH 2VTFA 3LPWA 2R8SL 1BIIB 3OB0K 1H3PH 1YMHA 3S5YA 5E2TH 1OD9A 3IJSB 1KPUA 3RVUC 2GSIB 2Z8RA 3EYQC 3PL6C 3QQ4A 4XP1H 2OPCA 3S48A 1CICA 4WI0B 2V2TB 4RAUA 1JFQH 2BVTA 5DRXB 2YZ1A 4JREC 1I7RB 3BQUB 4JEGB 5HXMA 3PWPE 3R8QA 2E6PA 2RJMA 1GZHC 5KVGH 5KOVC 4WF7A 1C1EH 4LSPL 3C9NA 3GJFK 3QHZL 2IIJA 3WIHL 4E42B 5DK0A 4ECNA 2F5AH 4NM8L 4GRLD 1JV5A 4U3HA 2B77A 1CLVA 1PJWA 2WWMD 2Z8SA 3GSNB 2CE6A 3HC0B 5IQMA 4XOBA 1LO0H 5F7DA 3UAFA 1NDGA 2D3VA 3VYOA 5C0FB 2CDGA 1QLEH 2KKQA 3QDAA 4X8XA 1SMAA 2C7UB 2OYPA 1TMQA 3GXPA 3CFEB 1B0RB 5FFOA 5B8CB 1HDMB 3NQIA 3ET9F 4KK5C 5MERB 3OJVC 1NWOA 3CN2A 4QKTA 4UQDA 3Q6GL 1PZAA 1U6AL 2V17H 3KW7A 4HMDA 2AJYH 2X2IA 1QHPA 3ATEA 2D9CA 4JDVA 3ATDA 3VX0A 2GSMB 4IJTA 5CJXA 4HJTA 3O6MH 4WW2C 2VDNB 4YMPA 5DZJA 4WUUE 1FHGA 5KTEL 5E8DL 1IKFL 3QEHA 3D0VB 4FL4C 2ORBL 4CMHC 5AG8A 1HIMH 1W15A 5ACZA 4R26H 3FCUB 4E5XG 2HVJB 4YSQA 1P7QD 1PZ2A 1Q1PA 4G70B 2LVEA 3A4AA 4TXVB 2FEDC 1AGBB 2J1YA 3DOSA 4BZ1H 1IGFL 4GSQA 2JB6A 4K23H 4KFMA 4GP8B 2CIIA 4PPTA 5T3ZL 3FK3A 4A2HA 1PJ9A 3LN5A 4N9GB 3AZUA 1QFOA 3GYRA 1JZ5A 4YXLL 1ID2A 4NC2B 4OUOA 3CG8A 5GZND 4ENED 1IBYA 3ELQA 4FI6A 1NLBH 2CJUL 4HETA 4AMKH 1JL8A 3ESPA 2Q76B 4LPTA 3MDJA 1M7IA 4FJ6A 3CVIL 2XVGA 1URLA 1OP3K 1T4KB 3KAAA 2ZSVA 4KZCA 4FG6D 4N8VA 5D70L 2FK9A 2A9NH 2CKBB 5DJ2B 1TXKA 4HJGB 5C0IB 3RWJA 3V0DA 5D4IA 5C70A 2VXSH 3QCTH 1V7MH 4O58L 3CVHH 1FFOA 1Y1UA 4N3UA 3CXDH 1UYWL 4PJGF 3MRNB 1I1YA 1NCBL 4MLSA 3IXAB 5IMKB 2EDLA 1K8IB 1WIPA 5DO2C 5JQIB 1F11B 1KACB 3ABZA 2F5BL 2HKFH 3PAUA 3VXUD 3FCTA 5AW3B 5EOTA 2W81C 3RTQB 2Q20A 5T3XH 5A3ID 3VWKA 4LLMA 2AF2A 1GGTA 4Z23A 3HVNA 5I1IH 2VL5B 4AQ1C 4R97C 1HL5A 2GW5A 1FL6B 3QUZA 3IDIB 4PAZA 1BX2A 5C0BB 2QQQA 1HE8A 3EUDA 1OAQH 4PWHA 4PIBA 5C6TH 4ODWA 4RESB 2AJ3A 2WAQA 4B27A 2OTWB 4UT7H 5DUPH 2VLJE 4OGZA 3IDXH 2JKRM 3LKRA 3MJ8B 1W8EA 4K2UL 1E4XL 4M61B 4XVJH 5D7JD 2GUOA 3NEOA 2P5ED 1DJWA 1ZY9A 3DV6B 1Y6MR 3LDBC 4TVPL 5D96B 5IR1B 5KVFL 2XIDA 1AHWB 1AI1H 5K59F 3DRQA 1CFSA 3ZZQA 2W60B 4OF7A 1IKNA 1UWFA 3PWPA 4BFGA 2RBLA 5G4NA 3T3PF 1F5WA 4NUPA 3AS2A 3DX2A 3KPSE 5AAMC 2X87A 5IT2L 2OR9L 1KYOJ 5C0DB 2YA2A 1NZRA 4F93B 2HLEB 2XU9A 3MOBH 1P5VB 4PG2C 1GPOL 3NCCB 4M3JA 2VLRA 1VRSA 3LDBB 1ZGLA 1OOWA 1JWMB 1M71A 2YA0A 4GQ9L 4Y4KD 5JXAH 1MFDL 1YNKL 1JDDA 4HULB 3QIUC 4P4RA 4I0PD 2Y7SA 1ZHBA 2VQ1A 4JHUA 4QEGA 5B7EA 1RPUA 5EH1A 2DJ4A 4X6DF 3BKYL 5K1VA 1WHPA 1SLXA 4TOYH 3CH1B 2JKWA 4NQTA 1X9RA 5CKGA 3PHOA 3TL5A 2BNRE 5C86A 1RP9A 3FCSB 5DI8B 1FRGL 1ITCA 1Y6KR 4N0YH 5FUCC 4GH7B 2DQFA 2Y6SC 4XXDB 2ZXWB 3U7WL 2NDGA 2K3HA 1JZ8A 2ZZUT 3EG9B 3LV3B 5DJ6A 2VLRB 1WZMA 1CF1A 3LZLA 4UDTA 2QSCL 1A7QH 1UKSA 4IBYA 2BSCA 5AKSA 1N6QL 4LDEB 2UX6A 3D85A 4K0OA 2HN7B 2EDBA 4LVNC 3S35L 4DSYA 2NSMA 4AQZA 4JFFA 5F88B 1X5JA 2WGXA 15C8H 5FYKD 5DJZA 4A2EA 3UH8A 2IGLA 3AITA 3UEQA 3C08L 3L3KB 5G5DB 5E23A 2CRYA 1RIHL 1W72A 4XCYB 1WWBX 2AGJL 3C60D 1S9WB 3CH8A 3PGCA 3GBDA 4YHNA 3TWCH 3F84A 3WTUA 3UP6A 5DZ9A 3BUQA 1BF5A 1HESA 2OTWA 2VRKA 5L4FA 3BPOB 5BOZG 4ZT1A 3QAQA 1MQKH 5E2WH 2F74B 2WUCH 3Q5YA 3RDTC 3MV9E 3VU2A 1A02N 4OF0A 4HPOL 3E0GA 3WN5C 1BOGB 4N85A 3WUWG 4LLMB 3KS0J 3C87A 5A2JH 3M45A 2IOMA 2E9BA 1LE9B 1TJHH 5BZZA 2VWEE 2DDQH 2AS5M 4YSDA 1XZ0A 4HWBA 4XXWA 1EAPA 4JAMB 4R8WH 1UOKA 4IHBA 4F9LA 4MNHA 4X8CA 2YK1H 4AENB 2CIKB 1J8HA 2Z64C 1F4YH 2EYRB 3PP3K 4AJYV 2H5UA 5D9SB 4FABL 4PB0H 4FMKA 1OTTC 4L8SB 1JN6B 1MCQA 4Y4FA 3SEPA 3UG4A 3ARDB 2OTUB 5E00B 4EN3D 5E7BA 1QSFA 3U7YL 5HYQB 3QXVA 2ZOLB 2HFGL 1AY1L 3L5JA 4NPYA 4RX4D 3BGMA 4X9BA 4AVHA 3IFPB 1JGIA 1B2WH 4DVBA 1T0MB 5F8RC 2IG2L 2TSBA 5E8OA 2E7HA 2ZNWA 4RZKA 1UWXH 3UYPB 3WJMA 4FQQA 5C08E 3RU8H 4YC2C 2ZTBA 1L9PA 2A9ML 4KKLD 1RU9H 2X89D 1BQHA 3MLXL 2D4DA 2XA8L 4G82A 3V52H 4HMCA 5AZ2H 2A99A 5HHMD 4RMRA 1ZGLP 3VWJD 4J3OG 5AWNL 5I0YA 4H8HA 4UOW1 3ZQXA 3LH2H 1MVUB 4H88H 4FYTA 4KDTA 1ZT4A 3HNTH 5F0LB 2YQ2A 5KSVA 4HWEH 4RGOL 3V8CA 3QPXL 4AK1A 3AT9A 4CDHA 4XC1H 4XBGB 4CSTA 4UTBH 3H7LA 5FHAL 1CGXA 2JKNA 3DO3A 2J8OA 4OKDA 4D9RE 3H9SB 4WHDA 1ZLWH 4JKWA 5F6IB 4APQB 1KSRA 4W9DC 4LAQH 3VXPA 3LNFA 2KC0A 2F7PA 2XQBL 1B0WA 4DN4L 2DWEA 4KO5A 5C0NC 1FBIL 1J7VR 1U95A 1RFDH 3VJ6A 1DBMH 3BWSA 3SD5A 4NKDA 3UABA 1WC7A 5AB1A 3Q5TA 4LKCB 3QS2A 4HKJB 4PLJC 1CLZH 2EYSA 4KVPA 4UM8B 1EX0A 5MI0B 2IAAC 3NFNB 3GHBH 4JDZB 5C7XH 4OV5A 1H5BC 3D33A 4OCSL 3VXME 2SODB 3ULUD 1UA6H 2DTSA 3S9DB 1QKZH 5DK0B 1AO7B 3H2QA 3KYKH 4MJJA 1QWHA 2DYPD 4OLWH 3OG4B 3LQAH 3SDXF 3ZE1B 5E5MB 3TA4D 1FHNA 3FU6A 1M56B 5IKCB 1RJYA 1KPVA 3UTPD 3CHPA 3QUZC 2FJHB 5MI0C 1TFHA 1GZPA 4PH8A 2O93L 1TTCA 1DCLA 4L37B 4H44C 1D5IH 1D5ZA 2BVOA 3X11A 3S36X 5EF3A 2QZQA 3HI5L 2DYPB 3N44F 4B6ZA 4JO3H 2ZX5A 4ODHH 1FPTL 3TNNB 3X3FL 3WAJA 4JPWL 4J27A 1OGAB 5DCCA 2B08A 4R4FH 3IETA 4CC1A 3VG9C 2EACA 2OW7A 5SV3A 2H32B 4A2LA 1UD5A 2YAMA 4JFHE 3BAEL 2V9TA 1PG7H 5LJYH 2ERJB 2XQYA 2DWTA 4KO9A 5I15L 3VFUB 3MOAL 1ZS8A 5IMLA 4NSKA 1RZ7H 3PE9A 1EFXA 4DKTA 1HS6A 3QQDA 3WXVH 3SYCA 5LQBH 1DSFH 3O4LB 1ECYA 1WG3A 4GT7A 4M7LL 3CBKB 4BKLA 4OD2A 3NSJA 4F15B 1NBQA 1XMWA 4HLEA 1NC2B 1HHGB 3TEZA 1H8NA 2V3FA 5BV7H 3DARA 3D7PA 1FVDB 4G83A 4GIOA 3SDDA 3BPOC 3US9A 4P5KA 5DDHB 2RIKA 4IRSA 3II3A 4WU5B 5KBMA 5IHUL 5IROC 1CVSC 4MJ4A 5KVFE 5K1JA 2XG4B 2ITCA 4MAYA 1CL7H 1E6JH 5D71L 4N0UA 3U30C 2IQAB 4F9PA 5F3HB 3VTTA 3K6SA 1QFUH 1JYWA 2PP9A 5TGBA 5FA3B 1B9ZA 1I9JL 2FH6A 4F7PB 3RB5A 4PGDB 4JHWL 43CAB 3TU6A 2CUHA 3GJEA 4P4KD 3BVVA 5AW8B 4G6ML 4BJLA 4JANB 3CLWA 3BAXA 3RKPA 4EN3B 2XXFA 4DERA 1ZSHA 3QHTC 4N2CA 2E0PA 2PCPB 3C8KB 3IDGB 4LCWA 1XGYL 3G9VA 1KJ3L 2QKIC 3MFFB 1MHCA 4TPRH 3VQ2C 4NKMA 1LO3L 3F58H 4PTTA 4CU8A 4XWOD 1X7QB 1WBYA 3BIAX 5F96L 5KSAA 2DQEH 5E8PB 1CBVL 4M9PA 1E8ZA 3VM7A 1H3TA 5JHBA 4PMFA 1TKWB 2XWJB 3GSQA 4JZJB 4U6HA 1A7NL 2CO6A 2YAQA 3LY6A 1AGEA 3V0HA 1QSZA 3LKPB 3FUKA 3N5AA 3EF4A 4AW7A 4XMLH 2WOBA 5KSAC 4YX2L 5T1DL 2W9EL 3W0WE 1IARB 3MNWA 1QEWB 2KT6A 4TLTA 1JJUA 1GH7A 5I6XC 1FNSH 5HDWA 2NOYA 4JBSA 1S5HB 5K93A 2N01B 2WANA 1I8LC 1NIDA 1OSYA 1F3DH 1H3VA 4WWOA 3Q2LA 1BVKA 2L8AA 3K8LA 5DMJB 3GUTA 4X8JB 1G9EA 1EJ6A 4MZRA 1NJ9B 1AG0A 2FIRT 4JFQA 2YBGA 4G80B 1F4WL 2I07A 3U9UA 3B6SB 4NCDA 3D07A 3ZGIA 3GSNH 4I3GA 3V0GA 3V9FA 2MSPA 3S34L 2ZPKH 4NZTH 2DIJA 4YXKL 2H2SD 5FCUH 3S3CB 3PP3H 2DL9A 4XN7A 1FN4A 1UD8A 3SOBH 2XWDA 1D3CA 4FZ8L 2B59A 5J06A 1MCHA 1MRFH 2X3AA 3KMDA 1DQJB 3GIVA 5E5UB 4F33B 1JI2A 3LIZL 1MN4A 5DC9B 3O8XD 1OK8A 1YQVL 4D0CA 3D18A 2VXQL 4ZPTA 3F7VB 5EUOB 3GGWA 5LN4A 1YNLH 4OFYA 3ARTA 3A5VA 3MXVL 1ESOA 3BISA 5GGRA 1CFTB 3QE5A 1JV2A 4I18C 4JN2A 4FA7B 1Z2KA 3CHQA 3RWCB 5IHLB 3WNOA 3LD8C 1CYGA 2V7HB 5JPMC 4UTBA 3BO8B 1S7TA 1DJYA 5IB5A 4Y8AA 4K3DH 1KUMA 1THCA 5DK2B 2EDMA 1ZCRA 4J6IA 5HDQL 4PJCF 2OL3A 3TO4D 1CFQB 2C9AA 2ZUXA 2GUYA 4KKZA 1MFEH 5ERWA 4ZMWA 1XB3A 4FG0A 5HJGA 1LDPH 1WT5C 3OLDA 1C08B 1P53A 2H3NB 3BT2H 3RX8A 1SN2A 1SYSB 4QYAA 4E9VA 3AS0A 4KKAC 4W93A 3ULAB 1NEZG 5IK3B 5FWQA 1SHWA 5TFSL 4L8BB 2ICES 1GC1L 1I53A 3FOLB 1A0QH 3ARGA 1K3IA 1A4JB 3FTUA 4CBZA 1PDKA 4ZFFB 3B9VA 1J9TA 2B5IB 3K4ZA 5ISZD 3PAVA 1EO8L 1YN6A 4BWTA 3CFNA 3O3AB 4QR7A 4WU7A 4Y4HA 1KYDA 2WP3O 4AQAA 3TZVD 1UQSA 1L7TL 4MB5A 4W4OA 4Y5YA 2XWEA 2H0EA 1J1OL 1ZVNA 1XF3A 4BINA 3ZL1A 3IDJB 2KS0A 2NLJB 1PZDA 4DKFH 2VJ0A 4TTDD 3JTTB 1AIFB 1ZE3H 4XAKE 1L7IH 2YJQA 4XNUL 5D2LE 3LH8A 5EG6C 5AVVB 5HHOD 1MJ7H 2VO5A 1W6WA 1ZLSL 1I8UA 2AJSH 5K9KA 3EZ8A 3QJSB 3KVDD 3CUPB 2W38A 3HLKA 1QUPA 3UMTA 3RGVD 3FRUA 4L3CB 1FZMB 1I7ZA 2O30A 2VR5A 1J05A 3WTSA 1SEQL 5JQ6L 5MEOB 1GGBH 3OXRB 4L4VA 4WO0A 4HPYL 4JRYA 3FOMB 5EBGA 2XV3A 3OXSB 3MA9H 3CN0A 1FCGA 5BS0E 1MHPH 4FNUA 4HX1B 2CHXA 1I7UB 2AK4A 5KVMC 4JFYA 2G3ZA 4JDEA 2BP5M 4OCWH 4AEIH 5IQ7L 3EDEA 4AQEB 2ID5A 3N85L 4AKQA 5DR5H 5D7KE 4UQCA 4MAUH 3EZJB 1BP3B 2KI6A 4YZFE 1ZEAL 1O9WA 5EN2A 1PNCA 1UADC 3AABA 3B2UC 1MCSA 3VNZA 3BWAA 3K0YA 5EEXA 5JUEL 3IFNH 4UINH 2APTA 3DX7B 1ZK5A 3KPPA 2ZWZA 3K7UA 1T80A 4AQ1A 4Z1PA 5C07B 1T7VA 3K2IA 3IJYA 1KJ2L 1M1SA 4Y2NA 3S5LA 3KBPA 1XSKA 3QI9B 4X0NA 5FB8B 1E2ZA 1XZWA 4YHZH 3CVBA 5FDYA 4Q9CA 2AQNA 3RHWF 5FO8B 3RJOA 4OCNC 3MRJA 3QFDA 1ZXKA 4D94A 1WWWX 3TA3A 3N6YA 3SDAC 4HK3N 3ZTDC 4PP2B 1VGEL 1ZT7A 5C0AB 4IRSD 1YMMD 4OJFH 1WISA 5J8OA 4L1LA 4FRWA 3L1OH 3ZIYA 3O3EA 4ZMQA 2AVGA 3G5XA 3JZ7A 4NNPH 3UTSE 4LASL 5J12C 1FDLL 4ORGA 5I1LB 3SCMD 3MLUH 3NIGE 1KJMA 3HS0C 1U2YA 1ZAGA 3B7SA 1ORSA 3BQUD 2X4PA 2YUXA 1GYVA 1KGIA 1F56A 2LAAA 2OTPA 5CJXC 1QO3A 4O9HL 4OH2A 1KTDB 2X09A 3I6LE 1CPUA 1E9PA 4YHPB 1HXMA 2ZOOA 4UOZA 1RUQH 3AMLA 2W9LA 1I8LA 3AWEA 2DPKA 1L6PA 3OKOA 4OSUH 4OLEA 1KEML 3MRBA 1DCEA 5GS3A 3KLKA 1SDDB 4AYID 1T6WA 4N5ED 1U8MA 4JG0L 2A6JB 4PJ8C 1VEOA 2BNUA 6PAZA 1ZK9A 4NXSA 1U91B 4LEXH 3WD5L 3OWRA 4NKIL 4J39A 4KZDH 3NSDA 1LEGA 5IBLC 4XPAL 5AW7B 1HWGB 1XQ4A 2RAMA 3VM5A 3OR7B 5HJDA 2IH3A 3K4DA 3I84A 3ECBB 1NKOA 2D0HA 4KBPA 3VYNA 4CVUA 2X44D 4G1MA 2ADFL 4RWYH 4OJAA 2WQWA 3F7YB 4YHKL 3MRIA 1LEKB 1S7UA 4MA8H 3IT8D 5LGKA 4JKNA 3HB3D 4JO1H 2J43A 4YDJB 3RZCC 3DHUA 3F65A 1LP9E 1Q9OB 2WKOA 4AYEC 3VSVA 3FONB 2WD0A 2FJGA 4WNJA 1GCFA 4MD0B 2FEJA 5FM5M 5GHWL 3O2DL 3UYRH 2WMPB 5AENA 4HJ1A 2HH0H 4NDMA 5INCA 2P42B 2R2CA 2W95A 2X10A 4TUKH 3ABKB 1QSEE 4HJUA 5FOJA 1DYZA 4GBXB 3A3YB 3UBXA 3IFOB 3SE3C 3PUCA 1YEFH 1ZD6A 2GC7C 3NK3A 4X7CC 5JOEA 5DLMH 2E8ZA 1IC5H 5CEZE 4IRJB 1FFNB 5FYKH 4YZWA 1SHSA 1CFTA 2CD0A 5GRYA 3C6LB 5KYYA 3ZKMD 1TO4A 1WQVT 3CHSA 2Z93A 3QDJB 1FNEB 3QEUA 4HS8H 4N0CC 5ANMA 5I8EA 4DT2A 1TZAA 2Q2LA 3PWLA 3UIYA 5T1JA 1SXZA 5DEGB 1R75A 3ZL4L 3I50L 3MBED 5GRUH 1VCAA 3QBTB 1Q1JH 5IG7B 3WUWB 4B9ZA 5EEVA 5LBVA 3G6JE 5DS8B 1KFAH 4MXVE 3L7FA 1DUYB 5GS1C 4Y5VA 3HUJB 1G7PA 4RISL 3FAWA 3APCA 2X1OA 1DDHA 2P8LA 1UM4H 2Y7OA 3DBSA 1V3JA 4GXVL 4NX0A 4BUQA 4ZMOA 2EXTA 5GRVL 2ISDA 1G4MA 1ZHNB 4HMEA 3VYPA 4Y2LA 4F3FB 2Z7YA 1R47A 5J56B 4HZLA 5I76A 1UJ3B 4AIZA 5CJ5A 1A9EA 2OQJB 4GO6B 1IFGA 4QRUA 3LKSA 1T2QH 4PS4H 4HKZA 4OGAD 1QYGL 2OMYB 4AUYA 1PY0A 3DJSA 3NEEA 3FO1B 3UJTL 3WFZA 3FT3B 3BP6A 1T22A 2FRGP 1P9MC 3GHEL 4JFDE 3DGDA 3IJ9A 4TRPH 3IWVA 4ZUUB 3BMWA 1J1XL 5AOMA 2P4AB 1UUNA 3A6BH 1A1MA 3K80A 4JRXB 4U6HB 3TIDB 3VGAC 4FXKB 4UCFA 1N68A 5J3HD 1YECH 1LD9B 2ZOKB 3DURB 2APVA 4N8VG 4ZS6D 4APXA 2B8OT 5ADPH 5HD8D 1LNUB 1Q94B 1GHFH 5C0CA 1MCJA 1QLRB 4HG4J 3HG1A 4X6CB 4YGAB 1RIUL 3OWEA 4U4IA 2CMRH 3QWRA 3BSHA 5JHDE 4A7GF 2FX7H 2EVHA 5BS0B 1BFOB 5I1AB 2G0LA 2CSPA 3FO9A 5KBPA 4U1IB 4RGNC 4TUUA 1BAWA 5F9WC 1NCOA 3CFQA 3MROB 2O5NA 4G9FD 1ACYH 3HS0B 5CEZD 3IBEA 2JKTM 3GIZH 3SPCA 1XWVA 1C9SA 4LSUL 1QRNB 1IILE 5LXVA 3VXRA 2VO8A 3QNZA 4HKBB 4MAYB 4NGHH 4Q52A 4B96A 1J1PH 5GJTH 2CHNA 1E90A 3GBNL 4BQBA 4HOMA 5HHQA 1FZJB 4YNYA 1ROCA 2QQLH 3T9WA 4P2QB 4AYMC 3KM2A 3L4WA 1P7QB 2J3SA 2OL3H 2GAZB 2OJEB 3Q13A 4F20A 4C56A 2ESVA 3MKGA 2DQIL 5DHVB 2KBGA 4LMQE 2AMGA 3JQOB 4MZ3A 4PRHE 5EOQH 4CMMB 2YR3A 3RDJA 4QO1B 3OJDA 3QVAA 1OZTG 5EA0L 3BDYL 4Y2DB 4BFNA 3SBRA 3QJVB 2EEXA 4I88A 4MJ6A 1KDJA 4DWHA 2NMSA 2FWUA 3KR3L 3HMXL 1ZHLA 2E46A 3QR1A 4G3YH 1LWRA 5MENA 1GAFH 4NYLB 4XVUC 4W9LC 5B39A 2CAKA 1UWGL 4WRLA 2H0JA 3ARZA 1PSKH 1QLFB 3GXTA 3Q1SL 3IE9A 4YO0B 3IS1X 2EIEA 5FW7A 5EEUA 3HMWL 3ZTCC 2Z4TA 4XMKL 3HPJB 1WWCA 2EIDA 4HXAH 35C8L 5IFHH 1TU2B 5DMYA 4QXUL 4ZW7A 4O51B 5AALA 2WNGA 1WRFA 3L1GA 4C4KO 4LLWB 3MV9A 3MRKA 1PMYA 2QGDA 4PHXA 4CC4A 1N0XL 3KWXA 1M2VA 1YEGH 1WFUA 4AJWA 1WAPA 1L0QA 3WY2A 4PJBA 1UFGA 2XWBB 5DURD 5DD5H 5KVDL 3WS3A 1KN2H 3QZOA 2PWEA 5E5MA 5EORH 1BVNT 5DVPA 4YAQB 3KXFB 2NQ3A 2Y22A 4YHOL 5ID1B 3AQZA 3AY4A 3H3BC 2EKSA 1R3HB 4XAWH 5EC2A 1NDTA 4DP5X 1CGUA 4JREB 1AH1A 5I73C 1HOCA 3CMOL 5CGYC 3EGDB 4WKXA 4NUJB 2QHLA 2QVFB 2BMKB 4JHAH 1IAOA 5TF1L 1XIWA 2B15A 5G4OA 4WJ5B 4UTCA 2EE3A 1DJSA 5I6OA 4XCCL 1PZBA 4CADB 5EU6B 4JPVL 1ED3A 1KYFA 2FGZA 3WJLA 1NC4D 5CSBA 5A2FA 3SE9L 2WLZA 3BP7A 2PO6D 3G08B 2DQJH 1F42A 3VXPB 4G7RB 3JV4B 2W65B 5LNEA 3LEYL 4UTAL 2NYYC 3QQ9C 5C0GB 5FYJL 5HVWA 4Z0XA 2IQ9H 3MBXH 1ANUA 4G5ZL 5F70A 2HRPH 2BVEA 1CD0A 4PRID 2O6FA 5CZKA 5AAPA 4UMGA 3MLWH 4QXVA 3IMWA 3TYFB 3WKYA 3CFDB 4DZ8A 4PJHE 1BPLB 3TPUA 3DROA 4YFEA 2OMYA 2NY6C 5D7KD 2FJFB 2UY6A 3WFBL 1F6LL 2W80C 3GI8H 1CF8H 2R56L 4LVEA 1LDSA 5EZJB 2NY4D 1F3DJ 1NICA 2JKIS 4WTZG 1IB5A 4ZMNA 4PG2A 4RBPK 5GZOD 2DKMA 5BMFH 2Y0SA 4IIQC 2O5YL 3NZHH 2G60L 1WFMA 3BYTA 3O9WD 5EB9A 2OM5A 2BNQA 3BGMB 4GS7C 2X4TB 3QWOA 4GUPA 3BVNA 2MCG1 2HVKB 3RPBA 1PD0A 2JKLA 3LQMA 1R3JA 1WCBB 2B39A 5D7LE 4V2CB 1IGIL 3GMNB 5IG7A 4G11A 5KAQG 1RZGA 4YSTA 1XIWC 5B21A 3GMRA 2EXSA 3KM1A 1ZJBA 1WA1X 4JZOB 4Y9FA 4BXSV 5JHDB 4MNHB 2Y25A 3CPUA 4O2FB 3ULUL 3T65A 1DTUA 1EAPB 1CS6A 2E6JA 3GXMA 4MD5B 2DZEA 5E5RB 3MV01 1XGTB 2B2XH 1D7DA 1KBKA 3BD5A 4JG9A 3PGFH 1TJIL 1Z9SA 3H9HB 4Z7QF 1M9SA 4LHUG 1U2CA 4TSCH 4W9EC 2IFGA 5GXBB 1DQDH 2VZSA 5FM8A 3BFQG 3OPZH 1UJTA 1IM9B 4JMXA 3UO1H 3ZHFA 2GTWB 3CX2A 4U1GB 4A2DA 1BZQK 3MRQA 4TNGA 5L9DL 1SY6A 2M1KA 1SMDA 5D7HA 4FFYH 4EVNA 4BZ2L 2PO6C 3A6CH 2CGRH 5GPRA 3EFDL 1TTUA 5LAXA 1WA0X 1T89C 4XPBL 2BSED 1A3QA 1PS3A 5EOCH 3L3KA 4NKOB 5F7KC 2DQUL 3GINA 1KELL 2VERA 5HDOA 1Z32X 3IMTA 1EMTL 3MLVH 3TYGH 3WFHA 1E4XI 1YUKB 3P30H 2Y1YA 2BP0A 4FXTA 3ESVF 2HB0A 3JV5A 4JFFD 1XF2B 5AVWB 4LOEA 3UZEC 1FGNL 2AQ2A 3NJIA 4M7JH 3D85B 5CGYD 1NGWA 1GRWA 4HEPG 4JFEE 5BZDB 1A4BA 3GRWL 2PO6B 4IS6B 3RX7A 3HPLA 5PAZA 5CP3H 2WXKA 2DL2A 4GFXA 5I8OH 4LCCC 1JERA 1HILA 4JCWA 1MLCA 5CP3A 4W9ZA 4NB7A 2VJXA 3SDCA 1YYCA 1FFQA 3R8BB 1AYOA 2AXGB 3QIUB 3OKMB 4Z6AT 4FTDA 3WSQH 4I2XE 4LE8A 4J6RH 1LHZA 3KGSA 4F1SA 3JVGA 1LEIB 3C8HA 4HDIA 4LCWE 3HC3L 1QNZL 1JRHL 1JZIA 3BPNB 4KX8A 4ZXBD 4EZLA 3B5HA 5E2VL 2CPCA 1M42A 3MYZA 5AUMA 3ISRA 4DQOH 1E9PB 1V5JA 4WQOA 4ZUVA 2JQAA 2HLAA 4DFIA 4CKVX 1RL1A 4U1LB 4FTVB 4F24A 4GP4B 4LPXA 2WB7A 1YEKH 2LTQC 5JA9A 4LHUA 4HUXB 1Q90A 1ORSB 4FKHA 4JO4L 4LLYA 1A2YA 3H3KA 4ZYKB 4A39A 5I1EL 3JZYA 4P5TC 3WS6A 4G6JH 2FZ3B 1QI4A 4RSYA 2Z92A 2XPZA 2VYRE 3IF1B 4YPGB 5FF6A 1IIKA 3MRDB 4HK0B 4RX4A 1A6AB 2X6UA 4AJVA 4BUGA 2JQMA 4NI6A 1BD2A 3B9DA 5MEQA 1JIBA 1RH8A 4GRMB 4M61A 4M4PA 4AG4H 1FL5A 2BIOA 2VLJA 4NWTH 4F7EA 1NPNA 3FUDA 3GI9H 3KD4A 5E9DB 3RWEA 2VNCA 2C8NA 4PJBF 3HA0A 4MTMA 4X5PA 3KLQA 4IIZA 3IDIA 1X7TA 5KN5B 1S4IA 3N9GL 4Q9QH 1X5XA 1T20B 2WZPD 1IEHA 3NACL 4ETYA 2YIHA 1B0GA 5EBMB 1VEPA 3HI6L 1DQIA 2FT6A 2OXHA 4G2AA 5CINH 1DANU 2WYIA 4XNYH 4QRTB 1MW3A 3NCEB 1XD0A 1I3GH 3S4SB 3RFZA 2JELH 2R29L 3DX7A 1ILSA 1Q72L 4X7TA 1OHZA 3MV7A 4Y2DD 3FTVA 5GGTL 3SD2A 2XHNA 5HVFB 3ENEA 4M1CD 1ZVSA 2Y36L 4M7KL 4P9HH 1FFOB 2PCYA 3V0WH 1JPGA 2XXMB 2ALAA 3Q8FA 4OBSA 2GHWB 2X0WA 4RNRB 3QA3B 4OF8A 2M83A 4HJGA 2J55A 3FQUB 4MCZB 1AGDB 1RLWA 5J4MA 1O75A 2D2OA 1T03H 2X4RA 2CWRA 3UG3A 3AUWB 5BO1L 2XTSA 2K3TA 2W9DL 3LKNB 2JJUA 5GGSY 3GSRA 4RGMB 1INEL 4ZXBB 1KB3A 1WFIA 3MNZA 2Y1ZA 3F04A 2VISA 1BBJB 1IGCH 4JFWA 3C5SB 3GB7A 2CO2A 1TCMA 5MEOA 4JFOB 2EZ0C 4XVSH 4Y9GA 3WJJA 1PY4A 5E4IA 1RURH 4ONHB 3QCUH 1G9MH 3D8MA 1FAIL 3U4KA 3VFVB 4E41E 3QUKA 3SGJA 4B9FA 4KRLB 1T04B 1HFUA 1HAWA 1NCAH 2HVJA 3OTTA 3QUGA 4E9YA 2R0WH 3KL5A 3ZHLA 2WBJA 4M4RB 3C2AH 1RD6A 4OCYL 4UILL 5CGBA 3CXFA 5I1KL 1EUTA 4Q6IA 2ZP0T 4GG6A 4UV4H 4YDVB 3WUZA 4IM8A 3P4LA 5GRJL 4HJSA 1DE4A 3G5VB 4FOMA 1IO4C 3CZLA 4ZODA 1XF3B 4R4ND 4MJ5B 3BCFA 4WSGA 3UAAA 1P4IL 5FO9B 5E1GA 2JE8A 5L7XH 4KTEH 4I3RL 4JNXA 4UIKL 1CDIA 4AV0A 4DVRL 2FGWL 2HRLA 2CDGB 2P49B 2VDPH 3NJLA 2PKDA 1I1RA 2G75B 3HNSH 2EDNA 3B2VL 2GY7B 4B9JA 5MP6H 1JZ7A 3MRFA 1WZAA 3I3BA 4NQCA 1W72H 1K5WA 5LN8A 3N1MC 4KH9A 4NFCA 5ACMA 1KV3A 4AOFA 4ZMYA 4FQHB 4A68A 4IDJL 4IJ3B 3K2UL 1C08A 1OAUH 3V0VB 4B50A 1MF2L 1TT6A 3FBQA 5DMGC 1XF1A 5DJYA 3QXAB 5KYXA 5HHPB 4YPJA 1MAJA 4IU2A 3ZE2B 1NGZA 1EA9C 2GSGB 4GMSH 5AL0A 1BIIA 3NCWA 1G84A 4F5CE 1C5CL 1KT2A 4RA0C 4LLVA 1WHOA 2O4EA 3FT9A 4XVTL 3KYNB 1AFVH 4DTGL 4QRPA 4TNVK 1AQHA 4TQEL 1NUNB 1U36A 5I18L 4LLQB 4K15A 1QFWL 1YJDL 5J11C 5DFAA 4HIJA 1BREA 3BKJL 4HT1H 3UZEA 3F00A 5L2JB 3E1ZA 3GEFA 1GS8A 4G8FA 5JIIA 2E47A 2XN9E 3L3IA 3MNMA 2B59B 4G6KH 1JYNA 4KJWC 3GQFA 1YPZE 2PYFA 3MGOB 2YFNA 1CK0H 2OR7A 3F6LA 3I3EA 4KQ4H 1NMAH 5SWZE 1VF5C 2A6IB 4RLDA 1OALA 2X2HA 3LPFA 1J5HA 5GS0L 3GXNA 3BP4A 3IMBA 4XRCA 2EDEA 4Y0GA 4ZUTB 2EVFA 4EOWH 1JTPA 3RWHB 1CD1B 2DM3A 4PSRA 5TPWL 4N5EC 1U3JA 2A6IA 3OAYH 3PNWA 4N2BA 5HHME 2YMTA 3MCLL 1P84K 3HN3A 3V6ZA 1ZTXL 4ZQKB 1QAWA 4LSRL 1S9XB 3FTGA 1EHLH 4KI5D 1MCLA 5C71A 1MCOH 3MNWB 4GEIA 2QTVA 5EU6D 3LEVH 4ESKA 5C08D 1ZJAA 4CUCA 1OAXH 2ZCLH 5I9QB 2AV7A 5IUCA 1EANA 1BHGA 4HHGA 1ZLVK 3EHBC 3UFIA 4K3JL 1X6NA 3HRZC 3W9DA 2ZWNA 2IJ0C 3KPRA 4XH2B 3LN4B 5IGXL 1BJ8A 5SX4H 1MJJA 1KIRB 2BCMA 3EHBD 1OY3B 2CLVB 2FO4A 2F1EA 1RZKC 3UZVA 1USQA 2J5LC 5EV7A 5DURB 4Z9KB 2RQ8A 2WUBH 5T5FH 4IU2B 1VEMA 3DIVA 1G5AA 1ACXA 3POHA 2IDUA 2YD4A 4XP5L 4WV1B 3C5ZB 1HT6A 3IMSA 1HEJC 3W2DL 4ALAL 4UNVA 1ZV5A 4GKLA 4NQEB 2UZXB 3BIKB 4ZD3L 1CFMA 3SCMB 2X6BA 5EFIB 2HSIA 12E8L 3N3EA 3IGKA 3MSPA 5I26A 3U2SA 2JTYA 2I85A 2BSBA 3FT4A 4LNRB 4NZFA 5FS5A 5G4MA 3PGDA 4BKTC 1HC1A 1NGXB 1BOYA 3LXBA 3UGXA 4BHUA 4DEUA 3QPKA 5J9PB 2ITFA 4FFYA 3PL6B 1MG3C 4NJAL 3VFWB 4WK4B 2L04A 1FH5H 1GS6X 3QH3A 2ZNXA 1BIHA 4J1UB 5AZEL 2NY6B 3T77B 2H2PD 3FAXA 1U8IB 5FO9A 5D2NE 1IBZA 4MJ5A 1TLMA 1OCWL 4JKLA 4BKLB 3W56A 2D7QA 5DQDL 3VD0A 3I02A 1CXLA 1D7BA 2OZ4L 3PJNA 2H1PL 1NFIB 3T04D 4D3CH 3ZHKA 3UBFA 4P59L 1F3JB 3EYUL 2OZNA 4Y4HD 4HCRH 2Z31B 3AG4B 4Y2OA 3GBLA 4ONGH 3QEQD 1HEHC 1OP5H 1U8CB 2DQCH 3K8KA 2VQTA 3MGTB 4L5FL 3ULUF 5TDNA 4BK8A 1SQ2N 4Z0BH 4KMTL 5HSFA 4IMKA 4PRPB 3L5XL 1TZGH 2F18A 3RGVC 3RY5A 5B7FA 3OKLB 4WCYL 5F7AA 4X98B 3ULSB 3FSVA 2EH7L 3TNNA 1F4XL 3ES6A 3R19A 4JDTH 4ZUSB 2JIXD 1QRND 4AZ8B 2BVOB 3X11B 4KMQA 5TDPB 3WKML 4H20L 4M5ZL 4QXTA 2XV6B 5TQ0L 1KC5H 1BQUA 5LCVL 1DVFA 3BN9D 3HE7D 4JB9L 4UIMB 4NO3A 1GSKA 3SDYH 3NJNA 3GUFA 2G9HA 3PDOA 4MA7H 3A22A 5E8EA 3TWYA 4OY9A 4QOKD 1MEXL 3TBWB 2J73A 5JPMA 3TFBA 5I6KA 4DZBA 3TN0A 3Q6FA 4POZC 1AO7A 1E27B 4MS8C 4OGXL 4UIMA 3MV7B 1IBFA 2Y06L 6CGTA 3IKCA 3P0YL 2XVBA 3ARBA 3QO1A 3NGBB 3WXWL 4A7UA 1GMEA 2VC2H 4L1HA 4GKSB 4OV5B 4AZ8A 4ZPVB 2QMJA 4MASA 3RY6C 4RFEA 4OCMC 1R0AH 3UCQA 4HKJA 4BBWA 1JNNH 1Q0YL 4YXHH 2GG1A 2AK4D 4KKAD 1AAJA 2OCJA 3P11L 5DTFA 3TIEA 3JSSA 1IQWL 4KKPA 4HWBL 1YA5A 3TZVB 3EH5B 3IKKA 3IJ7A 5DD0L 5HVHC 2X4UB 4AM0Q 1KWGA 5IB3A 1NGPL 1PLAA 1K6QL 3Q9QA 5TDOA 4YFLF 3LZRA 4Q9BA 3U9PL 2WXMA 4BFEA 4ZO6A 3TO4C 4KVCH 2DLFH 2AK1L 2H47C 2FSEB 3HNVL 5EC1A 2P8PB 3LHAA 1J5IA 3ROOB 5KSVB 2J21A 1JGLH 1G6VK 2FZ3A 4WLCA 3ZE0B 5T5NF 4OIIL 4G9DB 1W8OA 5HJ3A 3ZTJG 2Q5BA 4AY0A 4OLYL 3I2CH 4MRBA 5K9OB 4ILDA 1OO2A 5A2LH 4YSSA 3INOA 3PV7A 3H54A 5E9NA 3FN0L 3TO2A 1TFPA 3FFDB 4JHBA 3MU3A 3OBAA 1QBBA 3DJZA 3UTTB 5AAWC 1JK8B 4GW4A 2UUDH 4XNXH 3X1GA 4D2NA 5JYMA 5HHOE 3STBA 1FFTB 1WV7T 4CVZB 2X4NB 2P5EA 2LLLA 5FGBA 1OGAE 1UB5B 3DETC 1Y18A 2N1KA 3FSOA 2FWOB 2NXZD 2OLDA 3ZHNA 1QBMH 4F1ZA 5HYQA 1FLTX 3VD2A 2AXGA 1JVKA 1TDQA 2Y72A 5E00A 1RHFA 4IRJD 1OM3L 1XXFC 4PR5A 1MLCB 3BAJA 4BFIB 2DMKA 1VACB 1N7ML 4H8WH 4WV1A 1NEUA 2FB4L 3NN8A 4FQ1H 3K5RA 2KZBA 2WXFA 4HUMB 5DHXB 4LOFA 2KMWA 3VGEA 3JVGC 3MBWB 3QZWB 1JPTL 5KVEL 3QJFA 3BXNA 3V4PL 2HYMA 3IU3A 5FGSA 1CLYH 3DX6B 5EZOH 4HAGA 4JO2L 3MHZA 1EGJA 2VIRB 5LO7A 4U6XB 3VDCA 3W1ZA 4AZUA 4MAYC 5JHAA 4M29A 1HHJB 1SBSL 3MV8B 1E43A 1NMBL 1SM3L 3B1TA 2H1LM 1JYVA 5FA4A 3CVHA 3P9MA 2IWEA 1UCTA 4NUGH 2NYYD 3QQ9D 3DX9B 4H4NA 1DN0B 2OP4H 4HEPA 5DFVD 5DJ8A 4WWID 1YMME 2ZUSA 2XNAB 3UTTE 2OV0A 4XCYA 3MRQB 5ITBL 3BDBA 4ZQKA 5LB1A 2QVMA 1TIUA 1D6VL 3QJUB 1VERA 4K9EL 2DMGA 3ELAT 3SBQA 5I19H 2V8LA 3QG7H 5TE7H 3RZCB 1NGYB 4LSSH 3FUMA 1YQ2A 4X5XA 4P4KC 3KLLA 1GOFA 1FE8L 4MDIB 3T4YA 1NCCL 2XSKA 3D25A 1C12B 2HJFA 5D4JA 3F5WA 2DLIA 2ADIA 4KJPC 1U8HA 3MR9B 2H0FA 4UDTB 4GOSA 5DJ6B 1U92B 3VI4A 3CFIC 2DJUA 4NLHA 3S3SA 1RZGB 3MGOA 5IEKA 5F7WC 3II2A 2UZIH 4QXWA 1LK3L 4U6YB 2H6UA 4WI4A 3LNEA 1R3JB 1OCZB 1WCBA 1M6OA 3PHOB 4CGTA 2F7RA 2WHVA 3JWNH 2B1HH 4N2HA 4QGTA 1A4CA 4LSVH 3ZDWA 3ZR5A 3B8YA 1Y18B 1RP8A 2HT2D 1KB5A 4G9FA 5GGUA 3RWFB 4CVZA 3LZQA 1QUNA 4K07A 2WJ5A 4M6OH 4OQTH 5EZIH 5DC0A 2YMXL 4WTZA 4C4BA 5T1LA 3IVKA 1PZ3A 1YMMB 5ABZA 2QJDA 4HGWA 3T5WA 1AJ7H 1CE1L 4JM0A 3K1DA 3DROB 1UB6B 3M17A 4IOSA 2IWGA 1K4CA 1HKLL 1S9VB 2GSGA 3PXJA 1MCIA 2ZWSA 5D8JH 5DT1L 4DZ8B 4ADJA 4NJ9H 3T08A 3QXAA 3WNNA 3SPGA 4M6NH 3V0VA 2GY5A 1DQLH 3GMQA 4JY5H 4U0RB 5HYJD 4ICXA 3OF6A 4NO0D 1X5AA 3SO3C 3HE6D 3SPIA 4Q6IC 2R69A 5D7IA 3Q8EA 4FQLH 3ARPA 4MD4B 5SWSD 1O5DT 3QUYB 1KG0B 4H8PA 1UH3A 1ZMYA 1LE5A 1I9IL 5FGCE 4K71C 2YXWA 4WJ5A 5D72L 1XIWB 3DOIA 2BMKA 1UA3A 2ZX9A 3ZO9A 3TF7C 2BY3A 4E0RB 4NUJA 4IBLT 1CGSH 2E56A 1JNJA 2R69L 1IJNA 4KDTC 2PYEA 5E08L 2X9YA 3O0RH 5EC2B 3GTNA 5DD6B 3QDHA 3T0EE 4OI8A 3QC6X 4N1HB 1RQ5A 3V5HB 4KXZI 4UM9A 1RUPL 3O9WC 4OB5L 2BRQA 32C2B 3DNKA 1CGTA 1MW1A 3L3OC 1WD8A 3APNA 2G9HB 2MHAB 4WEBL 3NCYS 3S4SG 5GZOC 4G6AC 3MRCB 4EBQL 4MDRA 1T6VN 3LRSB 4FG4A 2VDRL 1H9DA 4ZX6A 4Z7OF 1IC7L 5ICZA 4IEFA 3FQTB 2XZCH 3SDAA 3MRKB 1Z5HA 4RDQG 1HL8A 4NQUA 5HHOB 5DEFA 4ZFZB 4BGLA 1AO7D 1SY6L 3LN5B 4N9GA 3TESA 3P2BA 3L5WA 2Q6WB 1JUFA 1H8LA 3GK8L 4QLRA 2VISB 1AGBA 3VFSB 2HG0A 2VM4A 2VR6A 4EIBA 3CQQA 1JFHA 5AOKA 1SHMA 4TQIA 5F71A 1Q9WB 5F1IA 3LRHA 4F9LC 3WKPA 1MJ8L 1XGQA 1CB4A 3TCXA 2YPVH 1SBBA 4K3EH 3DVGA 4WHYH 5I6PA 5T3ZD 3ZUCA 4XXCA 3RWDB 5ISZB 32C2A 1ZPLA 2YFOA 4OGAC 2VSDA 1SXSA 5KJRL 2E8YA 3HE6B 4NM4H 4G7SB 4UF7C 3V5HA 3MREB 1JG9A 2VKWA 3UTZB 3O3DA 1X5KA 1XB8A 4RQQA 3LIUA 3LHPH 1K5NB 4MX7B 1BFSA 3OJDB 4EDXA 3N41B 3S4SA 3D0LA 3H3PL 4OKVB 1T66D 5DHVA 4PJAA 4HAFA 3CFEA 5FC9A 5I66B 2ERJC 1J0ZA 4JK0D 1A6VL 3KPMA 2OS7A 3VWJB 5I2IA 4A6YL 3VFWA 2BW4A 3U0TB 2BLFA 2KZWA 1L9MA 2FE0A 4FADA 3PGDB 2C3XA 2M26A 2XV0A 2DQMA 4FYSA 3PU7A 5E1IA 2YKLL 1KN4H 4JVWA 3P3TA 3RGBA 3W0WD 3DUSB 1BD2B 3FUNA 1KXVC 4WTXA 1XDTT 4E68A 1MPAL 3O6KL 1P5UC 2WLHA 4P05A 3S96B 5JTWA 5GJSL 5FF6B 1NAML 4WI0A 3S8WA 3WFCH 7FABL 1BFOA 5I1AA 2BC4A 5DXWA 1JNHA 4ODSH 1DR9A 1MW2A 3ZL2A 2P48B 4PVLA 3T0DA 4PP1D 4J2XA 1MWAL 1KIRA 1MJJB 1P4BH 4DGVL 3OKDB 1HAUA 1EH9A 3V6OC 4LOUD 3IVKB 4Y4HC 1KBPA 1XF5B 4FNLL 3FXIC 1QUNB 1VHPA 3RWFA 1KB5B 4JL2A 3RZCD 2RACA 3HB3C 1O9ZA 4LPCA 3BW9A 1U2HA 3OKMA 3UAEA 2AAVA 4U49A 3B1UA 1BXVA 4MNQA 3OLEA 4NCC2 5D7LA 1E6OH 1AZRA 3NCMA 4UT6L 3MPCA 2NNAA 3H0TA 1U8OA 1NBVL 3UBHA 3WG7B 4FFWD 5EO9A 3ME0B 4XCFL 3DSFH 1RZJH 4KTDH 2AHIA 2Q87A 1OSZA 2IC2A 4PBXA 3S35X 2BSEA 3U4AA 4M1DL 3WJLC 5DQ9B 2XA3A 3UTSB 2CGZA 2C3VA 4P9ML 2VGLM 2Y6SD 4R6UA 3RILA 4F7KA 4HSAC 4MDIA 4B95C 2GTZB 3MJ9L 3FU5A 4POUB 2ZT9C 4TMPA 5MHSE 2FQFA 1NCJA 2P5WB 5CMAA 2Y1VA 4HHAA 2F8OA 1ZOXA 1MCPH 2A77L 2CLZB 1N70A 4NNXA 1U8NA 3CC1A 3JTSB 5ILTH 3R18A 5GGVL 1E40A 1MHEA 2CO7A 4P3WA 3L45A 5A2BA 2WXRA 3DIFB 4MNGE 4YWGH 3FUFA 4QNPE 2F08A 1ZA6A 4F2FA 1RZFL 3BUDA 3EYFA 3SKUD 2ZXBA 2VQ4A 2JWYA 3FMGL 4M5YH 5D1ZI 3BZFB 3HG1E 3G6DH 3QDJA 3FYIB 1FL3A 3C5JA 2APBA 1KBGL 2UVFA 3MNVB 4WV1C 5D93B 3VFPA 2CR6A 1NUDA 4FQCH 1E5CA 2IFFH 4NS0A 2CJTA 3SPJA 3V95A 4P04A 3PWNA 5DD1H 3PREA 2VIRA 3I9GH 3IRPX 4Z7WA 3IU3B 4XXCC 2ZP8A 3BXNB 1AZNA 2VSKB 2W0FB 5H4ZA 3FQNB 2XICA 2AP2A 4WHTA 5CSZA 4DO5A 3LKQA 1NIEA 4FQIL 4N0FB 3X14A 3GT6A 4HU8A 4PJ8A 4NDMB 5HI4C 3AB0B 4KJYB 1N59A 3WNJA 1CLOH 1Z1WA 4R9HA 3H42L 3SY0A 3NK4A 5IFAL 3UCRA 1IZJA 2GI7A 2OMXA 4TL4A 2HVKA 2RTTA 4FQXB 5LCVA 3SE3A 4LBAA 3DRTA 4X9HA 4FTVE 1XCWA 1TMCB 2P5EB 1MIEH 5ABDE 1J12A 2BDNH 4PJEE 2E9IA 2UY7B 2XWTA 4HZ1A 3ZHDA 1N18A 3VH8B 1S78D 2PNDA 1Q9LB 5EZJA 1A3ZA 1INDL 5JHLL 3AAZB 3QNXB 1INQB 1NSNH 3E6HB 4KJWD 5ID0A 2FJFA 4OUUA 2ICWA 2CNYA 1E4WL 2MTPA 4NN7C 5IOPA 3DLQR 4ZOBA 3QUMA 1FVCB 1YYLL 1CGVA 2R15A 3RVWC 1MELA 1Q9KA 5ACLA 2DH2A 3TYFA 3V4UH 4QJ3B 3B9EA 4YDVA 5LDSA 4FLRA 4DK6A 4KUZL 2FX9L 4Q6IB 5DFWH 1ADQA 1DLHA 3TA3C 5CWSB 5C92A 5KBLA 3TTSA 1IC4L 2DKSA 1TNMA 2Z4QB 1KXHA 3O45A 2VABB 1NUFA 3A24A 1YHPA 4NRXB 2YPKB 3Q3GA 4QOKB 1ZLUK 3FQ1A 1ZDSA 3M7FB 5DMKB 2IDCA 3GJFB 2WV3A 4QXGL 3EYOB 3QUML 4JKPH 4Z7OE 4GRWE 5HGHA 1TITA 3GF8A 4FLQA 1YCSA 2DQTL 4I48A 4Q9RL 4B3VA 2F8IA 3HE7B 1HHIB 5T3ZE 3OQRA 3SJVE 5EU5A 3GS4A 1BQKA 2WWKT 5I8CB 4J3OH 4HC1H 1EBAA 5IHZB 3G5XB 1LP9A 4LCYA 4J3UA 4HJEA 2P5EE 3KHOA 4XP1L 3L4VA 2XYBA 4GXFA 1GZQB 4CA4A 4DP0X 2Z6FA 1S9KC 1JFQL 2LVCA 5CP7B 4KXCA 1V55B 5B39G 4YUEH 3OSVA 3H6AA 4PRPD 1KCRL 5D1QE 2CRMA 3ERXA 3FQUA 3PQYA 1SVBA 3MVSA 2IF7A 3L2MA 4LQFL 4D9QD 3QA3A 1TJGH 5DLLA 3EXJA 4H7VA 1SPDA 1C1EL 4JX0A 3QEQB 4LSPH 4ZW5A 1JPGB 3TZVC 5F7BA 2ZCKL 4S1QH 3QI9A 3AM8A 1WS7A 5ESQB 4P2OA 2B1AH 4NO3B 3VW3H 1MCRA 4ANVA 3R0MA 1QLEL 3MV9B 4JFUA 3MUJA 3U2IA 5IJCC 4R4NC 4EIGB 3IGUA 1AHWC 1PD6A 1ETJA 5I74B 4WWPA 4O51A 2H0PA 3LZFL 4S0HA 1OV8A 2AJVL 5IESH 3ZYIA 4LL9A 5DD3L 2OJZL 4HFUH 2AJYL 3HPJA 3RQ3A 3VD4A 4L5FE 1XO8A 4XP9L 5IEHB 5GGQL 3HZKB 3HG2A 1PQZB 1AYRA 4NC1E 2D7TL 4XNBA 4K8RD 3PL6D 1PEZA 5FK9B 3NJGA 1P2CB 1PX8A 2YEZB 4TUOA 1XEDA 3WMQA 1Y6NR 4HFWA 4GRLB 2YGVA 2QKSA 4HUWA 2AEPL 5JHLA 5T1KB 3CGTA 1ND0A 3QDGA 3FOMA 5AG9A 4K55A 1IGFH 2V3EA 1HH9B 4Y2DA 2L7EA 4JPIB 1BQHG 2WXOA 4CMMA 4WWNA 4PJEA 3CFKB 1KYOK 1AXIB 2PTTA 5DO8A 5SX5K 2XZQH 3N40F 4WO4A 3BZEB 2BOCB 4IRSC 4OGYH 2X70A 3WIFB 1NLBL 4ALAC 4YBLC 2ED8A 4K7PH 3EKCA 3L95A 3NABH 2WN2A 5T1KA 2PCXA 2BX5A 4TUOB 2X4SB 4H0IA 4BA0A 5FK9A 5I9QC 2DLEA 2BNRD 5CILL 2VC2B 5EU7C 2VXSL 5TE6L 1PQZA 3TBSA 3CVHL 1ZS2A 1J5OL 3P4NA 5IEHA 1XEUA 2WBWB 4N2KA 2J5LB 5AYTA 3U4EB 4L9DA 1UQSB 2FL5A 3E8VA 4HUUB 4G42A 3FO9B 4XHQA 4I1PA 1AQDB 1SXBA 2YQ3A 1MLBA 2GEEA 5F7FA 5JXEA 5K1NA 1FV1A 3TJEL 1PX4A 2D7MA 2CLVA 3QARA 4XCNA 5IJVA 4V2BA 5I71C 3T6ZA 2ZUYA 3DXAE 3SQRA 2ED9A 1PYWB 3MXWL 2V2XB 2BVYA 3UO8B 5GISL 4JFZH 3P02A 1R24A 2YQBA 3CDCA 2BSTB 1GGCH 3W9DB 4N4YB 1OAQL 1HI6A 5CZVL 5C6TL 4UQEA 1SJVA 3KPSD 5DZPA 1B88A 1PAZA 1SN5A 1HKFA 1OGTB 1CGYA 2NSQA 1SZNA 4Y9CA 4K2UH 1E4XH 2WB1A 4XVJL 4EKJA 4Q6KA 5KVFH 3EAKA 3ZTJH 4N0UE 4TNVF 1AI1L 4NO5B 2IADB 3X13A 2H8PB 1CFQA 5L0QC 1GY2A 2VL4A 1IM9A 5I1DA 2P47B 1V3KA 3UPCA 5I6MA 4NUQA 3KLAB 5KS9E 5B38G 3IGFA 5TF0A 1XB6A 3MRPB 1N5YH 1GPOH 5LG1A 5DVKA 2G9KA 5IVZB 5JMRA 1RZPA 4MD5A 3LQZA 1TZOA 1L4IA 4O2FA 5GSVA 3KPRD 5HPOA 4D9LL 2UZYB 3IMVA 1KJ2A 2XV2A 3EBIA 4ZPTB 4ZW3A 1X4ZA 1MREH 4NRZA 4JL1A 1VADB 4ADGA 1IGML 2FEEI 3BKYH 3PLYA 4JHZA 4TSAL 3ULVH 3T4AA 4AGNA 4ATWA 4Y5VB 4J3TA 3EBGA 3MRMB 2DWSA 3L3GB 2X9WA 4KY1H 5KSBB 1EJ8A 4NT6B 4BQ8A 2H3KA 3QWQB 5L8JB 2WKOF 4N0YL 3EJSA 1XCQA 4GSRA 4GUPB 3PWLB 5ETUB 5GSVB 2XJKA 4QWWD 4QRPD 1SJEA 1KJVB 3GTTA 3FU0A 4IOFD 3FT0A 3ESOA 1Q4NX 3QFGA 2QSCH 4RIRB 1AHMA 4KVNL 4K5LA 2AXFA 5D4QA 3ZTNH 4ZMAT 5E1HB 4OZIB 1KT2B 1RI8A 4N68A 3S35H 4MJ2A 1K9TA 4NQEE 1SEBB 1IAIM 2UY7A 5CD3A 1SLWA 1X5HA 4LQ1A 15C8L 2WLYA 1FG2A 1H3XA 3R1GH 1D9KB 1E9QB 4BD4A 1DVFC 5INCB 5IMMB 1UCBL 3GBEA 4DGUA 1M1XB 3MRGA 5CN3A 4QAMB 5M95B 3TV3H 1RIHH 2EABA 3QIBB 1H15A