2AXWA

Structure of drad invasin from uropathogenic escherichia coli
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
134
structure length
134
Chain Sequence
AELHLESRGGSGTQLRDGAKVATGRIICREAHTGFHVWMNERQVDGRAERYVVQSKDGRHELRVRTGGDGWSPVKGEGGKGVSRPGQEEQVFFDVMADGNQDIAPGEYRFSVGGACVVPQEKLAAALEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DraD invasin
publication title Structure of DraD invasin from uropathogenic Escherichia coli: a dimer with swapped beta-tails.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Cell invasion
total genus 23
structure length 134
sequence length 134
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05775 AfaD Enterobacteria AfaD invasin protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1950 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2axwA01
2CNYA 2CO3A 2CO1A 5D55A 2AXWA 2CO6A 2CNZA 2FVNA 4OR1A 4PHXA 2CO7A 2CO4A 2CO2A 3UIZA 3UIYA 2IXQA
chains in the Genus database with same CATH superfamily
3VXMD 2F8XC 5EZPA 5IQ9B 3VFVA 4YSOA 2ENJA 2OJ1A 4OCWH 1OP3K 3ZR6A 3NJFA 2HUHA 4TVPE 3VE0A 3W0WE 3BAIA 1WH0A 4ZOEA 3K71B 4JHVA 2VDLL 3GHBL 4AUYA 4TV3A 2HT3C 1L4IA 3ARYA 3N0PB 3MV8D 4GQ9L 2QVTA 4PS8A 3LKOB 1GOFA 2ZWNA 2GJZA 1D6VL 4JB9L 4Z3IA 2PR4H 1CL7L 2QKIA 3IJ7A 3MHZA 5F0JB 2K6YA 3I74A 1WC7B 5DQDH 1MHEA 3FT9A 3O2DL 3X2QB 3BWAA 4JMNA 4PRHA 2OW7A 3PAUA 5D1ZC 2N7BA 4PCTA 3QA3A 3ZSSA 2JI2A 4W9IC 2XTLA 4P9HH 5C0AA 3V4UL 4BSWA 1IC5L 3O2WH 1XCWA 1B6DA 4NQCA 1BBDL 5AAMC 2AQQA 1A9EA 1K4CA 1EMTL 2FGZA 4OZHB 3II2A 4UQ9A 1JPST 2NR6A 3RGVD 1XTMA 2ICEA 2V33A 2K3HA 5CBEA 3VYOA 4RVBA 4C57C 1B0RA 1ADQA 1F6AA 4OV6F 2FJSA 1XGZA 4F3FB 4DAGH 4XAKD 2XJKA 3WSQL 3WTSA 1Q4NX 4AYDC 4HEME 2A6JB 2WWKO 1L9NA 2V3EA 5B39B 5D1QB 3L3OB 1A7RL 5EU5B 4A7VA 1NAKH 5KYUA 4IHOA 1GGIL 1HWHB 2Y5TA 2X4PA 3MKKA 4I0PA 2DMGA 3TBWB 1KACB 4CC0A 3BKMH 3GMOA 4DVBB 4JFXB 3NA9L 2I69A 3VH8B 4PS4H 3EJCA 1IM3A 2TRYA 1X9LA 1BVKA 1GGBH 2MEJB 4ZFQA 3X14A 2QDVA 5EOCH 1KYAA 4N8PA 3SDAD 4W9FC 3ZBMA 5HXMA 7PCYA 3VDAA 1TQBB 4BFIB 5D2NA 3WNIA 3ISWA 4V1DA 3SKMA 4FJ6A 5I30H 5D7JC 4K07A 1I31A 2XWRA 3LKNA 3O0LA 1LEIB 1LILA 2C4XA 2ZT9C 4EOWH 2VITA 3QJQB 4XVUC 1FIGL 2CU9A 3GJFA 1BWWA 1QSZA 3AY4A 3HG5A 1TQSA 4PJAE 5D1XD 1EDQA 3MUHL 4OGYL 2Z1PA 3QWNA 5I1IH 3NSYA 3QUXA 1K4DA 4AIZB 4BCXA 5JPMC 1DJGA 3L4TA 1UTDA 3T4YB 1LEKB 2OKMA 1SLVA 4ZTEA 1XB6A 4H1LA 1QX1A 4XMLL 3QDME 4EF3A 2DLGA 3AMKA 3FRUA 4MMZB 4QAMB 1NJ9A 2J71A 2J6WA 2WUBH 1Q1JH 4RAUB 3S2AA 2OV0A 2FJFB 3O41B 2YS4A 3MA7A 2YLHA 5MEQA 1EBAA 2B20A 4B96A 1PEZA 4YSAA 4K73A 1IZJA 5AW6B 3TNMA 1NL0L 2JXMA 1JWUA 3OHMB 1AR1C 1QG3A 2WW8A 4L8BB 1IVLA 2JCCB 4PJ9D 3RVTD 2JV6A 2XUWA 5D7IB 3RTQD 4HC1A 5EUOA 1EO7A 2IG2H 3IGUA 1UCBL 3O8XC 5FYLE 4P2RE 1JFHA 2HRPH 2GEEA 2ZP8A 5GGTL 1JPSH 2EXWC 4H8VA 3V0VB 1J5OH 3ZTDC 5DJYB 5TF1L 4HV8A 3DARA 2F15A 5DHVA 4PJXA 2APWA 5JW4N 4WNQB 1A0QH 3A6OA 4BSJA 3OAZK 3ZMNA 3PGCA 3PWNA 2DD8H 5EWIL 3C60C 3PWJB 4XHQA 5I8KL 4E41D 1WBXA 3VFSA 1YAZA 3KJ4C 3ARFA 4PJCB 1AIFB 1RJZB 4G1EA 4Y4FB 5I1AB 1D7CA 3VFNA 1OSEA 3LZLA 1Y07A 2IIJA 1KYUA 3WMSA 5EU4B 4G8GE 4MYPA 4IMLA 4NCC2 4NUJA 4TNWF 2C8NA 5IIEB 3PV7A 1DUYB 4FXKA 1A4JA 1T7XA 3DK2A 4LEXH 1M4KA 2N7AA 3FUKA 3I9IA 4U6HA 1YNLH 2YGVA 1B3IA 4WV1B 3T6WA 2ARJA 4KDTA 1FGVH 3P0YH 1U4FA 1QVOB 3ELQA 2PWDA 2WNWA 1QFWM 4L23A 5F9JB 2AVGA 3O3AA 3WJJC 4Q9CA 4ODBD 1RERA 5IBLD 3VB9A 3WFEH 3A3YB 4X4ME 3LY6A 4JPVL 3O9WA 2XFXA 3EYVA 3MRIB 1NC2D 1WTGT 2Y06H 2Z9TA 4KJYA 4K3EH 5BCAA 3HFFA 5HHXL 4YX2L 3S34L 4K5PA 3UTPD 4HBQA 3MUY1 1FWXA 3WKNA 4FTVA 2BDNL 2CJUH 1AFVH 2AABL 3TYFB 4DZBA 5LGJA 1U8QB 3ESOA 2HJLB 3GKZA 4GSQA 3TO4C 3H3PL 4GP8B 4HD9A 4M3KB 3STZB 1PYWB 3DTUB 1OAUL 4U1MB 5HJ3A 3IU3B 4P2QD 3UG4A 2HVKA 3QJSB 2BY3A 4Q6YA 3TIDA 2BHFA 2AQNA 5HHVH 4HUVA 3U2SB 4FA6A 2F8VA 3BWZA 4B50A 2WJ7A 1MCWM 4UIKL 5DJ2B 2FIKB 5EO0A 4Z78A 3ZDYF 5IJBC 5K9KA 4UMSA 3O6KL 5C0FA 1MXGA 2AJUL 3OLEA 1CFQA 1DEEA 2QQLL 5GS1C 4OKVB 4M5ZL 1HZHH 3MCYA 1DE4A 3EH5B 3LIZL 2F54A 5IF0A 4TVPH 2GTZB 1ACXA 4L3FA 5LBSA 2VABB 2P80D 3OKNA 5FYKL 1KYFA 2A74B 1N6QH 2B1OA 4MMXA 3MLXH 4PTUA 2WP3T 5JO5A 5I9QC 3OSVA 1A6AB 2OP4H 3QEQB 3VSQA 4I3RH 5DFWH 3MLPA 3QH3B 2CO3A 5HY9A 4N3TA 1BSIA 5IBUG 1HQ4A 3SQOH 3VG0L 1M56B 1J87A 2LU7A 5TE4H 5ESVA 1D5MB 5DA4A 4PB9H 5C7XH 2MFNA 4P23A 1X5IA 2IQAB 1GW6A 3KDMA 1PZDA 3DX7B 4TLTA 3TS8A 1XIWD 3OB0K 1M9SA 2BNQE 4HX1B 5D6CB 4Z23A 3Q8FA 1QTYT 1E9PA 2OJEB 2RH0A 2YXWA 4LCUA 3AFLA 1PX8A 3OKOB 1IAII 5HVHC 1U3HB 1XH3B 1QKZH 1IGIH 5E4AA 1KGXA 4FQPA 3BISA 4WEMB 2CLVA 3ZE2B 4GSUA 1KJMA 1SHWA 2X1QA 3CX5J 4LIQE 3H9YA 4LDEB 5JOEA 3N6YA 4XHJD 2VJXA 2ZX7A 3EH1A 3C6SB 1XGTB 4HJTA 5T3XL 4MA7L 3QIWA 4JY6B 4ES8A 2BSBA 4EUPG 1GCFA 1KGWA 2ZICA 4PY7A 1MLBB 2NXYB 2HFFA 4YIQB 1IAOA 1IBYA 2XIBA 2NX5E 5DC4B 4J6IA 2G2NA 2DW5A 4MS6A 4R3SB 4Y1AB 4XZUB 2CR3A 3IDMA 4DVRL 2EYTA 3ARRA 1OKEA 5GIRB 3U4AA 5DMIH 4ERSL 3CFQA 2AXJA 2UY6B 3QUYC 5C2BH 1DJWA 3CFNA 1IGYB 1KN4L 5D7KE 5DRNB 2XWBA 3CBKB 2WD0A 3APDA 3FUJA 3L81A 5FFOA 2OSYA 1Z5YD 2CUMA 4XNMB 4NI3A 2VM4A 2ETWA 4QCIB 1HHKA 4J4PD 1YEGH 1NDGB 2J1WA 4MQTB 2Z93A 4Q9BA 2XTJD 4M7LL 3VI3A 4YK4C 4IBQA 5DGRA 3PGFL 3MV9A 2HWZL 4N6RB 3ZUCA 3CFEA 2GY5A 4UB0L 2HJKB 3IN0A 4LLVB 3TBYB 5GRXG 1I9EA 5C92A 2BHYA 3OKEA 1KGCD 1ITCA 3G6AA 4TUJA 2VR6A 1FDLL 1TQUA 3NFNA 4GSRA 4AQZA 5A2BA 5CD3A 4F7MB 5SV3A 2IF7A 4MD0A 5B1JC 2G4EA 1JTOA 2YUZA 4MB3A 3GBEA 5EUKB 4KXDA 4XVJH 4BWUA 3KG5A 1AHWC 5K5YA 3ZJAA 4AKQA 5BVPH 3JT2A 2AV7B 2CHZA 2VLJE 4XODA 2F53B 1HYSD 5CR8A 5DD5H 3Q8AA 4YHLL 3IETA 4NN5C 1LMKA 2NZ1A 4LRNL 3NIFF 1HHGB 5D6DA 4G6KL 2J12B 2DI7A 1OD9A 4NP9A 1XWVA 2VXQA 4YJZL 1OW0A 3HE7D 1BLNB 3HZMB 4NWTL 4JZJA 3VWKD 4P2OD 3SGEH 4FXGC 1RIUL 5H37A 1IM9B 4V33A 3CHXA 1OK0A 2VAJA 3MV01 3WMPA 1R3HB 1FUNA 5FF6B 3B9KD 2VKWA 5JW4M 2FBJL 2HJFA 2HPOA 1KTDB 1N5AB 3ARDD 5A7BA 3NCBB 4QF1B 4WO4A 3B2VH 2C1OB 1T6BX 2C9RA 5F1IA 1A6TA 4NNYB 3TZVB 4W9CC 4AM0Q 4BRJA 3M07A 2DEXX 2DMBA 1J86A 3R1GH 2YRPA 2V2WA 1QR1A 1TVHA 4NQXB 1FNEB 2PMZA 1GXEA 2AJVL 1XDTT 3BUQA 5DURB 2CUHA 5D7IF 1PZ2A 2GJ6A 4U1KB 5H94B 2YA1A 1QSFA 3CAFA 3U0WH 1GA2A 3JTTB 4Z6AT 3BKJL 5ITFB 1AZCA 4EN3A 4Z3JA 1URLA 1HH6A 2P43B 3HC4H 3PFQA 4FYQA 1WBYA 2EZ0C 3SY6A 2X4OB 2CGRH 5EBWA 5I1GL 1S7VA 5C07D 3D12B 1HILA 1ND0B 4FJYA 4B9GA 5D1XE 4AIOA 2HLAA 3CSGA 3GGWB 1WAAA 2IDSA 4L4VB 5AYTA 4X7TA 3ZMEA 3EJYD 1L9PA 5CLTA 5B7MA 5T3ZD 1P7KA 1EHLL 2SODB 1T4KA 4P4RB 2VXSL 1KIQB 5F71A 1JXJA 2PYED 1OPGH 1F90H 3SPVA 5D4QA 3O4LA 4DP0X 2J6EL 4FDWA 2A0LC 3V0EA 3KPQA 4GKLA 5CWSB 2CMRH 2BM3A 1K72A 3BKCH 2GFBB 4IIQA 3QRLA 5F7YC 4M56A 1KELH 1R3LA 1R33A 3EJQA 1WZKA 1DZBA 1UXSA 1AQ8A 1GZPA 1HEZA 4Y19D 1XT5A 1NGWA 3IMSA 2ATPB 2QQKL 2IFFL 3IPEA 2WWMD 2WXLA 5HHQB 1LO3H 2JJSC 2XV2A 2YC1B 4Z95H 4Z3TA 2GBAA 5JW5B 2XQBH 4PGDB 4ZUTB 4DSYA 1YYML 2OQJB 3D08A 2C1PA 4APQA 8FABB 4NBXB 5FUOL 4P05A 1UGNA 3NTCL 5I8OH 2RQEA 1KIRB 3G6DH 4QHLB 2XT1B 3STLA 3HMXL 3QNZA 2PYFB 3KWUA 1LNUB 4MCZA 4BH8A 3NOIA 4N2AA 3Q8CA 4YHNA 3GDBA 4DWHA 2GSIB 5CN2A 3VGFA 4U3HA 1FFQA 4Y7OC 5DEGA 4E9LA 5HGBA 1MCPH 1INDL 1HOEA 2NPLX 3ZKMC 4H8QA 2B4CC 4QRPA 3QJVB 4HGWA 4NJAH 5J6GA 3Q01A 3VXSE 1HSAA 5IQ7H 4KVCH 2C9SA 3UTTA 5B38A 1FAIL 2QSTA 4Y1SA 2OAAA 5CXPA 1S7SB 2EH8H 2VB5A 3EKCA 1UB5A 1TCRB 5C3TA 2P45B 3O3DB 4PY8J 2EVGA 3L3DA 2CR6A 5DD3H 2AV1A 1BFTA 1M1XB 4P06A 3EDEA 3ILDA 4F2ME 3NIDF 3GSRA 3ARXA 5F7AA 3RGVC 1NGXB 4QHNA 1YG9A 3APNA 3D8MA 5SWZE 3QFJA 1F4YH 3LNGA 1KXTA 3V8CA 5KYYB 2M83A 1GZQA 4GXUM 1T4WA 5DRZA 2QV4A 1OLLA 4NBZB 2Q2LA 3MUUA 3NCWA 4YSTA 1ROCA 4HA1A 1PLBA 4YNYA 3UPRA 1PPIA 2IGLA 3MACH 5E7BA 1K85A 3H85A 3GS7A 2FATH 3NRPA 4EMZA 3KYNB 4L18A 5GS3A 4ZD3H 1GJWA 3OKDA 1I9IL 4W93A 4JY4B 5EU7C 2IPTH 2A73A 5D96C 4PJEF 3WNMA 2FX8L 3MBEA 5INDB 3DRQB 3ARQA 1EEYB 4HUWB 4OZFA 1A7QH 5DT1L 4OZIA 4FOMA 4HCRA 1MF2H 1AIZA 4FTDA 2CDGB 4U1NB 1DJYA 4AYEC 4D0BB 1P5VA 4D9LH 5DK0B 4DKEL 5DS2A 4BFRA 4HBCH 1R3IL 1XR9B 1XZ0A 4WI0A 2ITEA 3SDAC 3MROA 4JANA 4RGMC 1EV2E 4UV4L 2GBUA 4L1TA 3A4FA 4TLUA 2C3HA 5CGBA 4BQ6A 3IE9A 4DIXA 3V6BR 3X11B 3LKSA 3BQUD 2AQ3A 3PNRB 4BWTA 1T1WA 2DOCA 3D0LB 3IDNB 3LH8A 3OHXB 4MJ2A 4D9QE 5I26A 4BZ1H 1EEZA 5ITBL 1R5WB 4N9GA 3IDIA 4ZO8A 5KVDE 5KVEH 2Z6FA 5T1KA 4MLIA 5CJXA 4LLDA 3NZHH 4N2IA 1LK2A 3Q1SL 1WS7A 3BW9A 2AKRA 5DRXB 2CO2A 3V0IA 3IJEB 4EUPB 2ARWA 3UBHA 3ECUA 1RUAH 1X5HA 4AGLA 3S37X 4YHOL 2OR7A 1RUQL 2JI1A 2J1YA 2I9LB 1D5XA 1ZHLA 3HBGA 3LKQA 4HXBL 1UVQB 4PJ8B 4JG9A 5KJRH 3K2MC 4BFNA 5HHMB 2WWKT 4LK4A 4PV9A 1PJWA 1JZIA 2J8UF 4ZUWB 1QEWA 4W6WB 5DQJB 3S3BB 1IBBA 1XGYL 2APTA 2YD3A 3VXNB 1RZIB 4KRMB 5GISH 4M43L 4E9VA 1C5DB 1I8KB 4PJ9C 3NACH 1T2JA 4QRRD 4WWKA 1QRND 2BZCA 4YDZA 3WIAA 4JREC 3MCKB 3CVBA 1V3KA 5KSAC 5L0QC 3C2AH 3MBXH 4XXDB 3WHXB 3KPOA 4IRZH 2EP6A 5BZWB 1M42A 2C4FU 4MBRA 1TZGH 1KTLA 2P5EA 3GD1C 5D7LE 5EOQH 5I8EB 4A55A 3NP4A 1IZKA 2DMCA 5EO1A 5B1CA 3TH3T 2YFNA 1ZKAA 4JFEA 1JUFA 4CJ0A 3MPCA 5K59E 3MV11 1YEDA 1EDYA 4M48L 1FCGA 3NCJL 4CRPA 1JNNH 5D4HA 3CUPA 4N0FA 1BG9A 1QTSA 3TO2A 5DJXB 2CUIA 4BHUI 4NQDA 1AGFA 3NIGE 1K8DA 2K45A 4PJFE 1TU2B 1I3GH 1P9MC 3HNTH 4FLHA 1C7SA 2ZOWA 3BYYA 3WDHA 2VDQH 2O6FA 3WUWA 1MJ7H 4HJGB 3S35X 4DN3H 1UA7A 4LHJB 4UQCA 5EC1A 2B1HL 4P48A 3U4KA 3JSSA 3UABA 3SJVA 3V9FA 3VFPA 5HYSA 5KZCB 1O6VA 1T83C 4W4NA 4AE1A 3TYGH 1HL5A 4PJ5E 4N22A 1HNGA 2OJZH 4GKNA 1MVUB 1AS6A 2OXGB 2EIBA 3PABB 3L4ZA 5IBLC 3H54A 2VL4A 2E7DA 2ZXAA 1R4XA 3W37A 4ZSOA 2VN3A 4LL9A 3QQ3A 5EC2B 4NHCL 1ZVNA 4N8UA 5I5RA 2LT9A 3II1A 1OGSA 1HHIA 4M8VA 3ZKND 1JIBA 3QUKA 1B4LA 4E2OA 3CU7A 3RIFK 2G2RB 2Q8BL 2GAZA 4ZQTA 3ELAT 3EYUL 3DNKA 4J3UA 3C09C 4I18A 3L3IB 1KBGH 1CXHA 3FN9A 5FIEA 4BJLA 1A3LH 4P59H 1GIGL 2GUOA 2VDMB 3K4DA 4JRYB 2J44A 1G0XA 2MCG1 4R8WH 1NBZA 4G2AA 2F8OA 4JKLA 3IEAA 4FFVD 3BCFA 4Z18A 3D2UA 4Y9BA 4FGMA 3K74B 1AC0A 4MB1A 2EDJA 5JIMA 5D1ZA 1N64L 1ZT4A 1XCTB 3ULVL 3S8FB 3NH7L 2K0RA 2ZKXA 4GSDL 5FM4A 2JI3A 4IRSB 5AAMA 3BZEB 3GSNA 2BZDA 1R5IB 2D7TL 5KS9E 1HESA 1YNKH 5L4JA 4L8CA 3CN2A 3JTSA 3RB5A 5IOKA 5B7FA 2ZOLA 4OF5A 4DPCX 5H8DA 4MCMA 3JWDC 3VO0A 5TDPB 3DGCR 4Q56A 1J9RA 3EJPA 4K3JL 3ZYJA 5K33A 3K1KC 4EZJA 2NY5C 3G5ZA 3MLZH 5JHMA 1TLMA 1J05A 1BM3H 4HJUA 3G6JE 4Z7OE 1BV8A 3QISA 1HT6A 1TJGH 4XH2A 5JNYB 2BIMA 4JFDE 4POYA 3BOVA 3FCBA 2Q76B 2AXFB 5DZPA 4WU5B 4QHUB 5LN8A 4U1GC 3RDJA 3V0GA 4XWOD 1RVFH 1IC1A 3GXIA 1P7QB 2AK4D 1NFDE 1UZ6F 2WNGA 3RUGF 2LAAA 3ARGA 4FNLL 5F70A 4EVNA 4HLZH 2O4EA 2OR9L 3G04B 3Q6GH 3ZPDA 4AXWB 4BFGA 4YL4A 1ZA6A 1AGBB 1AXTH 4QTIH 2NTSP 1TVBA 1RHHB 3SQBA 4ZW5A 2LLGA 1Z1WA 5IJKC 2H7WA 2HTLD 3FSVA 5FUCE 1FV1A 2GC7C 5MENB 1MI5D 1XGRA 5FWRA 4WI6A 3RRQA 2ZUWA 3IF1A 2IBGA 3QIBC 5D7JA 3S35H 3HHMA 2IDFA 5IZ7A 1ZJBA 2Y4SA 3BGMB 2DQIL 4YMPA 3GM0A 3PG2A 5GS2H 1DSWA 3GRWH 3FCTB 4MNQE 4MVBD 4JPIA 3T71A 1P4BH 5JPMA 4KZCA 5DJ8A 4WFHD 5CEZL 2JKLA 3HLAA 4PUBH 1S9KC 4GUQA 4JM2F 4ACPA 1G4MA 1BD2E 1MQKH 5I1DB 1IGML 3WTXA 3V9EA 3AJ7A 4TQPA 2R0KH 5E1QA 1I8AA 1YUKB 4KO7A 1UWEL 1DEDA 3MBWA 4H0IA 3W82A 4AZ8A 1BJMA 3UL4A 1Q0YH 2DQ6A 4IU3A 1RZKH 4ZO9A 5EZJB 2H1LM 1ZVSA 2HRHA 1HINL 2CGZA 3PL6B 1UUSA 3U4EA 1FL5A 3HBZA 4J4PC 4WY7L 2XTJC 4LSTH 1H6FA 3MLWL 3UIZA 3IU4L 5KVDH 3BUYA 3O8XA 4ELMA 1SMAA 1PFCA 1PKQB 3WIIL 4JQVC 4HUCA 5DR5H 4LOUD 2ZUUA 5FYKE 4GBXC 2VDLH 2VW6A 1RZJL 3EZ8A 5CEYB 1EAPB 4LNVA 3V0HA 4EKJA 2B59A 5E0QA 5HHPB 5SX5H 3WIFA 1JJUA 4KI5F 3S48A 1D6VH 3ZE0E 3HCVA 1FBIH 2ZD0A 1ZS8A 5L2JB 2ZXQA 4O02A 5FCUL 4X4XA 4EI6B 3ZL1A 3O2DH 4BXSV 1HYSC 2Q0ZX 1TEYA 3KM1A 1A6WH 2WN2A 3PWVB 1KDIA 3SQRA 2YPLA 4V11A 2P7TA 1ZT1A 3RL1A 3RWJB 2YK1L 1MCRA 4K8RL 5IB2B 2FO1A 5HYJB 1QFWH 2NUTA 5AYUL 3IMTA 5BZZA 4P2OC 3JV4B 2UY7B 4OB5H 5IB5A 1XFPA 2J1KA 2GG1A 3KW8A 3T6XA 2WYZA 1QI4A 1H8OA 1UA6L 1BXAA 2MCPH 3W0WB 4D0CB 3RPIA 5I76A 1NC4B 1IE5A 4GKZA 1FFPA 2AJ3A 4MDRA 4BFFA 3CVHA 5HPMA 3E3QC 3T8XB 1S7UB 2B1AH 2AGJH 3MRHA 5GJTL 1DQVA 4XAWL 4Y2OA 5DHDA 3C6LD 3OKLA 4LDOB 1W91A 1GGIH 3C60B 1KTJA 2ZAIA 5T3XE 3K0YA 5EZIL 3WJLC 3QIUD 2PO6B 4N26A 4N2HA 2HX7A 4LLAA 4MX7A 1VZHA 3U36A 1CJYA 2XVKA 3ECQA 4AMKL 2D7NA 4NO3A 1LQSR 5DRWB 1FNHA 2Z0UA 1MFEH 2ZP9A 5E70A 5TQ0H 1LO0H 2QEJA 2DTML 1KT2A 5FHAL 3BCDA 4RRPG 2WLJA 4CDHA 4QHMB 3WENA 3QDGD 4X6DE 3CLFL 4QIRA 3SODB 4BKLA 3TO4A 3TVMD 1K6QL 1E6OL 3CH1A 3FT0A 1Y18B 1H6EA 3BWUC 3FTVA 3FYIB 5FC9A 2CE6A 3D07A 1FIGH 1TZOA 1A66A 3H9ZA 2BCKB 3WAJA 4ZOCA 4DO4A 2C9VA 1N8OE 4G42B 4JY5H 4PRAA 1QFPA 5FKAB 2JK5B 3WO4C 3IRCA 5C9JB 4X5WA 3KPSE 1CFSA 3ZZSA 3CZLA 3BKYL 1TTFA 3IDGA 3UFIA 4X5PA 3BE1H 5C0DA 3GBNH 5DC0A 4IJ3C 3C5SB 1RUPL 1HU8A 2RFXA 4N5EC 5GS1A 5DD6A 1IGTA 2DZEA 2GKIA 4QXGH 4N90D 2IPKA 3DX6A 3RZCD 1F4HA 2C7FA 4XPTL 2G5BA 4QI3A 3CSYB 4KAQL 3UTOA 3O6ML 2XWTB 2WKLA 1MWAH 4WNSA 4M5TA 5AG8A 4BZ2H 5C08B 5F7LB 3HJ0A 3AT0A 3FB5B 2NZIA 2WBWB 1BQKA 3WGUB 2WYTA 3DXAD 3NAAH 1JP5A 4I4WA 4UQAA 2YRBA 2R2EA 3V0FA 4FA7B 4MJIA 1F45A 4JX0A 4GFXA 4HKJA 1AQDA 5HYIA 4PJAB 4TXVB 5J57B 1NZRA 1AS8A 2WIMA 5TD4A 3RY5A 3I6GB 3H7BB 4JM2C 5TF1H 1H3UA 4HUMB 5FO8B 1U3ZA 3DURA 4S2SB 1AOZA 2D9CA 3GB7A 3QC6X 3PWPB 5MP6H 4WSGA 4I48B 4PHXA 1B90A 2NRDA 2UWEA 1U95A 2Q7YA 1K5NA 3CJJA 3FQNB 1GKEA 1OP4A 3MRMB 4KHXL 2EO7A 1V5JA 1UADC 4AITA 4MD5B 5I17A 5FO7A 3VVWA 2EUVA 4XC3H 3B9AA 4ZW7A 3US1A 3TPUA 3RL2B 3EYSL 5J12C 2Y7OA 1ET8A 4MCYB 4X8CA 2JJVA 3ZKQD 3L2MA 2ZOKA 2JTYA 1WIPA 2EIDA 3N85H 4MXWL 4AEFA 4KZEL 4XCFL 2YAFA 1WCBA 2KH2B 5GGSB 3WE1A 1KEMH 4Q97A 4C56D 4UDUA 1S7RA 4JFOB 4P2RB 4W9ZA 2I7SA 3QNXA 1ZMYA 3S9DB 1TTAA 1JD9A 2XNAB 5BV7L 2P47B 3WOVA 1HN1A 5HDBF 1EZUA 2D3VA 3C8KB 4R7NA 5ID0A 3EFDH 4NLHA 1HCYA 3WKML 4ZXBB 2DIBA 5AAWC 5DTFA 5IHUH 3KEHA 3SBQA 4YPGA 3LQAC 4NFDA 4X0KB 1AZNA 1ZXKA 1E9OB 2IGTA 2PTVA 3DV4A 5FDWB 2Q6WA 4BELD 5FYJL 3IFNL 4JPVH 1DQLL 3O6LL 1CGVA 3UYRL 3MCLH 1JZ6A 3MA9H 2NXZD 5CEZD 1FJ1B 3QCUH 4ALAL 1FORH 3OX8A 5I1KH 3MJ8A 1ZV2A 4G8GB 4L1BA 4QLRA 1CGUA 4YX2H 4UTBL 1OT4A 3ZKXB 2BSED 4Z77B 4GS7C 1UT2A 2BDNH 3KPRE 3ZO0A 2R39A 1FYTD 2RR3A 2AABH 3VD4A 2H0JA 4N20A 5D2LE 3UZVB 5IOPB 4MTMA 1JF1A 1T03H 3N1PC 1G6VK 1KBPA 4K2UH 3RWFA 3WKYA 5GGUA 1LP9B 4ZMOA 1WF5A 1AHWA 4XWGL 1EGJA 2V7HB 3NVQA 4Z7WE 1BAGA 1VFAA 1AQMA 1PLCA 1HXYB 4AWJC 2HX8A 1NBCA 1E3XA 2XSKA 3HPJB 1YEFL 4PJIE 2YAEA 3GXUB 5T1LB 1I1FA 2CIKA 1ZHKB 4Q9QL 2G0LA 3GMRB 6PAZA 3O6KH 3A4AA 2AJUH 5E2WL 1BJ8A 3F7YB 3BSZA 1VEPA 1TJHL 3CVCA 4ZT1A 3ABLB 4E9RA 3LIZH 2VDOL 2NNRA 3B6SB 2QVIA 12E8L 2AEPH 1KLUB 2DQUH 1YCSA 4Z7UB 1GY1A 1IGJA 1T21A 2H26B 4OQ1A 2ILLA 1U8LA 1G7HB 4P4KD 1ODAA 4RFNB 5IVXB 5JW3H 2BVOB 3D3VA 3MRFA 2W80C 1EA9C 1GJUA 2O5ZH 3MRBB 3D09A 5MHSE 1SM3L 1J11A 3NMEA 3A6CL 1HI6A 1CGSL 4X6BB 2A6DB 4YUEL 3HB3B 4MDIA 1W72B 2OFQA 2LE9A 1L9OA 3GC3A 1NCCH 2XN9E 3VG0H 5CUSH 4PRIA 1AKJA 4WCYL 1QLEB 4AEIL 3L48A 1OGAA 2LU5A 5I1EL 2JJTC 4MNGB 1CDUA 2BOBA 3W9DA 4D3CL 5MERA 1NANH 3L4CA 2UVFA 2DV6A 5A3IC 1F3JA 3V0JA 3WJMA 4HLZG 2R2CA 4FCHA 4P9HC 3OXSB 5IEHB 3ZDXE 3EBHA 5BO1H 1JVOA 4CU6A 4IQHA 1JZ2A 4LESA 5L2KB 2W95A 3L6FA 3CZFB 5GRVK 2FWOB 3ZTEA 2VTFA 4DPRA 4OLWL 4PR5A 3PAZA 3UTSE 3V0DA 4EEEA 3U0PB 1PNCA 4L4TD 1OF2A 2O1AA 4YHIB 4DCQB 2G3ZA 4NM8L 3OKYA 4QTHB 5IM7A 1L6XA 1CFNA 3LZQA 4HH9B 1U0QA 5TDNB 3V4VB 2X42A 1GTFA 3CLWA 3LZFH 3EW3B 2P24A 2ICWA 3R4DA 4OJFH 1YMMD 3RTLA 3ABZA 5CP3H 4HPOL 4FMFA 3U1QA 1NIBA 2CCVA 4AH2A 2A4EA 5TQ2L 1D7BA 2QADC 5F96L 3GMMB 4QY8B 4MA7H 4E9WA 3SDYH 1DQKA 5TGBA 4N3UA 2R7EA 5DS1A 3N9GL 3L5XL 5EO9B 3VRJB 2EEBA 1I7TA 1T0MB 5IQ9A 1J8HB 4JDZB 1O6SB 2GEQA 2GITB 2OMZB 5C0BD 4BQCA 5G4MA 3HVNA 4DVRH 5IT2L 2KC0A 5IMOA 4MXQC 4GRWH 2YEVB 3QPXH 3UAJD 1DBKL 2MIZA 1VA9A 2FLRT 2QVKA 5DO2C 1DVFB 2BP8B 4CA4A 3BESR 1U58B 3LKOA 3CPLB 4CSZA 2JJSA 2H8PB 3ZKNC 1BZ9A 3FQ1A 4TUOA 5IHLB 3PGFH 1CU4L 4LVHB 1YEJL 4DGUA 4UB0H 3HG0A 1B2WH 1XF2B 1BM7A 5LAXA 5IW1B 1SF3A 4HXAL 2G5RA 3ASNB 4L3EB 2VL5B 4ZMLA 1MAJA 3B2XA 3MRPB 1FDLH 4KMTH 3N44B 2Y3NA 4KZ0A 3ZIYA 4QOKE 1KLGA 1JRHH 1V27A 4U1JB 2VXVL 2VLMD 1QUPA 4HH8A 2NX5B 1F4WL 2D7OA 1RJYA 4JZOA 4Z8FL 4F3FA 3CIAA 3ZRCC 3SD5A 3POCA 5LBGA 1JHTA 1HCFX 2YUVA 2ZSVA 5EA0H 4JRXE 2EECA 1PZ3A 2DKMA 5B39A 2A6KB 3MLYH 3RIAK 3MFFB 5EU5A 1DBJL 5AWNL 1I1AD 2ATAA 4YN3A 4XMUA 5A16A 4QT5B 4YGVA 4AZUA 1HOCA 3DGGB 2CPUA 3LPPA 3T3PE 4AV0A 4DVBA 1QLRA 4HWEL 3LN9A 3VH8A 2D2CC 2Q87A 3LKPB 1JG9A 1VKXB 2CBQA 5ABZA 3MV8B 1WV7T 2FQDA 3D48R 3H2QA 2YRZA 5T1JA 4BFIA 1Z9PA 3AB0C 1MW1A 4XWOC 3WN5B 5F8QC 2VDKB 1MRDL 1YN6B 2A9AA 2P8PA 3W1ZA 3EJSA 1KWGA 1NBVL 3OXRB 2WTPA 4N6QA 5B3SB 1EHAA 4ZTPH 3SKNB 3AACA 1U91A 4PW3A 4X99A 3T6QC 3SYCA 4LOFA 5INCB 4L1HA 2DEWX 2XIDA 3QDGE 2HT4D 2ZCHH 2UYLB 2IMNA 4KK5D 1HDMB 4PJAF 2ALWA 4Y5YB 1AH1A 1OD7A 5F97E 3T4YA 3BKJH 5E4EB 4F7TB 1I9RL 15C8L 1TFPA 1GYWA 1N6VA 3QXUA 1KXVC 1N68A 4RGOH 4PJHE 5DVLA 3S3PA 1TOXA 4JFZH 3KD4A 2F5AL 4ACTA 4AENA 3VD0A 4KROC 5FYJD 3VXOA 4CSTA 3FO2A 5CJOL 3KBFA 4GAGL 4LP5A 1NBQA 5AVZB 3Q8BA 5PAZA 1OK8A 1S3KL 5DYFA 1A1OB 1JGEB 4ONGL 1PIGA 3SYQA 2AVFA 2EIEA 4JGJA 5FLVA 2E3VA 1A6ZB 2RCSL 4NRXB 1P4LA 3GPEA 2J6EH 2G3MA 1ONQB 3SDAB 4RGMB 1CE1L 3T3ME 3U25A 1DBML 1CLYH 2J57A 1HZLA 2PTUA 1ADQH 3H55A 1NGPH 4EDWL 3GI9L 2OM5A 3RY6A 3L9RB 3SZ6A 2ZYRA 2J5LC 3ULVE 3QJFA 4JFFD 2Z7WA 3PCYA 4RMSA 4DEWA 3CFBA 3CMGA 2UZYB 2Y5EA 4XCEA 2WIIA 1G9NL 5D1XB 5KSAA 4PLKD 2PPEA 1AIFA 4X9BA 1RJZA 3LOWA 1SJVA 2VOTA 5I1AA 4LOUC 5I5IA 2WLHA 4QJ5B 2I9TA 2Y22A 3ZYIA 5EU4A 4WKXA 2IXQA 4BD4A 1DUYA 1PD1A 4G1MB 5C6TH 2X88A 4FFWD 5E6IC 4OIAA 1JZFA 3TFBA 4PJ7E 1I7ZB 1UXLA 5DZOA 4FHBD 4XVTL 2VZUA 1M53A 4FNTA 2AS5M 4WV1A 4BRVA 4A2FA 2X09A 4CBPA 1OF0A 4O2FB 3OV6A 4TSAL 4WHYG 1C5BH 2DKUA 4Q9RL 1DDHA 2D7QA 5JPNB 1E67A 2GPZA 1QYGH 5F9JA 3RHWK 3RTQB 4ZFFB 2VR4A 3F12A 3ZHDA 2DS4A 4PRPA 1UH3A 1GC1H 2FJGB 3GJFH 4GUCA 4CADB 4F80A 2EH7H 1FL3B 2IMMA 1WCQA 2NW3B 4RIRB 4TSBH 4OLYH 3SHSA 2B5IB 4ANXA 3MRIA 2K1MA 2JJWA 2VIRA 3L9EA 4AQ8C 4H1LH 1R3KB 5E1HB 3C6LC 4P3WA 1IV8A 2Y2YA 5E03A 3VXSB 1JPGB 4R26L 3UDWA 1U8QA 3U0TB 3X17A 4CVXB 5L4MA 2IV8A 1HIML 4U1LB 1PYWA 1Z5HA 4U1MA 5IROA 3ETSA 3EGSA 1MFBL 3FUIA 3GXNA 4OFYA 1TEGA 5CEZE 4M5YL 3ROLA 2FECL 4JRLA 1R3IH 2FBRA 3O2VL 2X4TB 4F2MB 4UV4H 4GG8B 3U2SA 1U8NA 1EZLA 5TE6L 2BFGA 1XXFC 4HC1H 4PD4K 5DJ2A 2FIKA 1W0WB 2OMVB 1KOAA 1SF5A 4R0LB 3TVMC 1TJMA 2PW1B 3N40P 2OMYB 3MRGA 1BBJA 5DHVH 1J1XL 4OR1A 4N9OB 5T5FL 5ITBH 4PJEA 2DWYA 5JHLA 1V7NL 4NQED 1SDAB 3NCFB 5D72L 5HJDA 5C7ZA 1IEAB 1FFOB 2BSSA 4QRUA 3F04A 5C70A 1XSKA 3QEQA 2BNRD 3L16A 2VMDA 3IGKA 2XLLA 1NLDL 1YDPA 4BFEA 4XZ4A 1YMHB 1U8KB 1EK3A 3TH4T 4Z0BL 4ZO7A 3QHZH 5C0CD 3X1GA 5F21B 2IQAA 3S2CA 5DUPH 2ZXCA 4M6OL 4U3SA 3EF4A 1OAZL 4KK8D 1LE5B 4HX1A 1KG0A 1XGYH 1E4XH 3MGAA 3I2CL 1MJJB 2W81C 3KWWB 4P2QB 4G8EB 1NCDL 1J0IA 4MAYD 1JGLL 1QI5A 1JZ8A 3QGVA 3DX4A 2B9AA 3DOSB 2NNXA 4JO4L 1Z9LA 1HWGB 2KT6A 5F7EL 4X8XA 1WFUA 1WRFA 1CXKA 1FLTX 5F3BA 1WS8A 2G5UA 3ECBA 2W60B 3LQMA 1IARB 3NCXA 4N0UE 4MA8L 2XXFA 5F0LB 5C09A 3MJGX 1EERB 4OQTA 3BZ5A 1BXVA 3MJ9L 4OD2B 4GIPD 5DC9B 5C0JA 3TBVB 1KB5L 5JHDD 1FN4A 2J8UA 2QFPA 4YIQA 1BMZA 1YY9D 3QIBA 3NCJH 1N2RB 4Y1AA 4XZUA 4F8PA 3CTTA 2WLKA 1MEXH 3TJEL 4NNXB 1LDSA 1Z3RA 1IGYA 1BEYL 5BUPA 5F3HA 2AJZA 5DI8A 2B9BA 4PBWD 3S8GB 1NCJA 4WEBH 2VSCA 1T2QL 4IM8A 4KK6D 2VMEA 5FB8B 43C9A 3DJSA 2EDLA 1WPCA 4RFOH 3IFLL 1AMXA 4KJQD 4MJJA 1XIWB 2B1HH 4FQHB 4GINA 4Y4HC 1F1DA 3WIHA 4LLVA 2H3KA 3QNYB 3ULAB 2WJ5A 3OR6A 1ECYA 1VJSA 5I82A 1WT5A 4JKMA 2A1WH 2QSCL 4POUB 2OZ4A 1G9MH 5JA9A 3T09A 3IMVA 1SDDB 3O4OB 3UJIL 1RUMH 3BAYA 3IT8D 1ERNA 3QUML 4FABH 1B3JA 4F7MA 2HKAA 2H9GA 1N7MH 1WZMA 2IOIA 5EUKA 2OSLA 2DWDA 3RWIB 3T1WA 3KGSA 3EG9A 5A2JH 2X6MA 2BPBA 2GI0A 3S88H 4DPBX 3KPTA 3P11L 4DP4X 1WVZA 4K7PL 4U6YB 4MJ5B 4PJFB 5DJZB 2VO5A 4GBXA 2QL1A 2VQ1A 1OALA 2QVMA 3A5VA 1QHQA 1BLNA 1KIPA 5ADOL 1AI1L 3ARSA 1N0LB 2PW2B 5DMGD 3C5JB 1MCNA 4F7PB 5DXWA 5GS0L 4JDTH 2A6IA 1IM9A 4LLQB 2X1OA 1R3JB 2LHAA 4K7FA 5FF6A 4LPTA 3OJDA 2EUZA 2P5WD 3ESNA 3ARWA 1CDGA 3NH7H 1CL7I 2W0KA 5HBBA 3QYNA 1JZ3A 1QPXA 2D7TH 2OS7A 3G08B 3RKDC 2WQRA 5GGRA 5CGTA 2LTQC 3JVGC 4GRLB 3QHFH 2EXYD 2R2HB 1ASOA 1M2OA 4TULH 2FNBA 3T2NH 4G80A 2O5NA 4L2LA 3H42L 4P4KC 4NQXA 1T5XB 1TKWB 5ECJE 3HLKA 3GSWB 1XF1A 2R2BA 5F9WB 2E8YA 2PTTA 4N5UA 2R1WB 4PM1A 3O11A 1KCSL 3FFCD 4DP2X 2ZCKL 3BP4A 5EEVA 1YY8B 3MV7E 2YZ8A 4UU9A 4DQOL 4X6FA 4NZJA 3PWLA 5BS0A 2WLYA 2QDWA 4QYOA 4G5ZL 1D3CA 1KB9K 1TETL 2X4OA 2VSMB 1S5IH 1ND0A 2FUQA 5CJBA 4AW7A 4GT7A 1OM3L 4PEEA 2FX9L 5LWYL 3UPAA 3VXQB 1QQDB 4XP5L 3HE7B 3EO1A 1SXZA 1FE8H 2O6EA 3VWKB 4U6XB 4ZX4A 3DVNB 1CF8H 1NFAA 3L9YA 3KCPA 4ZFGL 2D2OA 4P4RA 4YBLB 2WNKA 2AMGA 5GHWL 4HIIB 4KOBA 2YGOA 1SJHA 3X3FH 3B9KB 3DVFA 1Z32X 1G7QB 3E2HC 4MGXA 3Q5OA 2X6BA 4U7SA 4CVWA 2XFGB 2H45A 3ARDB 5FYJE 3ZSTA 4ZAKC 4KHTL 5C8JB 4Z7OB 2WBJC 4JFDB 3L3KB 2YPKB 2XA8H 3F7QA 4BSVA 2WLLB 3RU8H 5D71H 3RUGA 4FFYA 4OI7A 1FVDA 1AGEB 2YC1A 4NKIL 1J0HA 2RMNA 3KPPB 4ZUTA 4XBGB 1NFDB 1IGMH 4FG6D 8FABA 3NN8B 3RGHA 1UWEH 3U9UB 3ZGHA 4LCWD 2VXQH 2PYFA 1LNUA 3V6ZB 3O3UN 5F6HI 2I25N 5HGHA 1YC8A 1JERA 2VO8A 3QUZC 4Q6IC 1OE2A 2HTKD 5IB1B 1C16B 1KJ2L 1P1ZB 3AAZB 4TUKH 5C07B 1SLWA 2YHGA 2JKRM 5HVFB 1IJNA 1MIEL 3IU4H 3P4OA 4FQLL 5BOZG 1EHNA 1YEKL 1TCRA 1Y6MR 1U42A 4LXFA 2NQDA 3GJFK 3QXWA 2QBWA 4OTXL 3VNZA 2X4UB 3D5OF 2A7BA 4P57B 3WIIH 1A3RL 5D7HA 4JM2A 3BVTA 4JQXC 1NGXA 2PYEB 1SVZA 3SE6A 2IFGA 3ECWA 2HH0H 2DQDL 3S0PA 1BD2B 5KYYA 2V2XA 1ACCA 2G75B 2ZKHH 4JKWA 1QP1A 4KUZH 5E9DE 2QPSA 3HR5A 2VZTA 4LHUG 1CT8A 3DSFL 4X80L 4NO2A 4Y19B 3WLWD 4B5ZA 5J13C 4R97C 5KYWB 2X6VA 4OUOA 1N67A 3RVWD 3MRRB 2YK1H 3AG2B 2BRRH 5INDA 4PGEA 3DRQA 4GY4A 1EEYA 2MJWA 4HUWA 4KNQA 4RWYL 5L88L 4YXHH 2XZAH 3HC0B 4DH2A 4PWFA 4YFEA 1LVEA 1OZUA 3LEXA 1V10A 4D0BA 1YPZB 4UT9L 1OB0A 3CH8A 5DK0A 1EXHA 3VXTA 4ZPVA 5CJ8A 5JQIB 2Z31C 1RP9A 2WCSA 5HDQL 4ISVA 4I1PA 3ZKSD 1FL6B 4I9WD 2CHWA 1ET5A 2VQTA 4NQUA 4IMKC 4LCCC 4XAWH 5JZ7D 1FNGB 4IKJA 4HT1H 3MR9A 4O2EA 3X11A 3ZE0B 1AHMA 3JYCA 1CBVH 4I7ZC 5EZIH 4L3AA 3V9CA 3D0LA 1KNOA 4MWFB 3KDPB 2Q8AH 3OHXA 3QFDB 3ORJA 3OBAA 3SDDD 4F57L 1R5WA 2Y36H 3TT3L 4P5MB 3FT1A 1NGYA 2Z92B 1RAMA 4U0QB 2DQEL 3HI5H 3ZN6A 4KK5C 3FL7A 2UXFA 1RU9L 3IJEA 4JR9L 3B8YA 3THML 3CK0H 3TJHC 4EUPA 2IDTA 4Q89A 3L9BA 2BP3A 3RFZB 2ZUSA 4L5FL 4NCDA 4XNDA 1UQSB 1GZHA 1VCBC 4YHYC 2DF3A 5JDJA 1ZOXA 3QAZC 2ZF9A 1E6OH 2YQBA 3HZYB 4PJ8A 3DO3A 3MRCA 1JWSA 2BCMA 4F7CA 1D7DA 4L29A 1ZE3H 4HJ1A 1V7ML 5E94B 1IQWH 1O9ZA 2OMWB 4F20A 1VEOA 2CO1A 4UNVA 4YFLI 4FYSA 3TNNA 3VXNA 1DANU 3UX9B 3Q06A 3GXTA 2MKWA 3PLYA 2AJSH 1RUPH 4HHAB 4YDMA 1AMYA 5E2JA 2HT2D 1DVTA 5AW1B 3IM1A 2B77A 3RWEB 5F1KC 2V9UA 1ZK9A 4YDKH 4XXDA 5IJCC 2QZQA 3OD3A 4KAQH 1AG0A 3EO9H 3O6MH 1UWYA 4NUGH 4JNXA 3E8VA 1F3RB 1Y6NR 2JIXB 2MOVA 4GS7B 5I8EA 4HKXB 4X6DB 3BQUB 1SLUA 1MHCA 4HG4J 2VH5L 1X7SA 4Z1PA 3EHBB 2WQUA 1IC4L 1IAIL 4L48A 5FOBA 1KYDA 5K9OA 2KL6A 3GO1H 5F89B 2YKLL 3CIQA 2NNFA 1JVLA 1PZ5A 4M5SA 5K59F 1VADB 1X4ZA 2E76C 3ROOB 1VGEL 4KRLB 3HI6L 3D39E 2JJTA 3NQKA 3NGBC 1BOGB 3S5LG 2PCFB 3T0EE 1J0ZA 2UXVA 2A9BA 3KPSB 1KXQE 4DK3A 3C87A 2F58L 2JKWA 2PLTA 4HFWA 3ME0A 2CAKA 2WVVB 3NIGF 5JHDE 3DDFA 1TQWA 2EIZA 3VXUA 4U1HB 1DSFL 1ZLWK 4PJFF 3UC0H 2YEZA 2SEBB 1NGZB 3VGAB 1KEGL 5IFHL 3CXHJ 1ZS2A 1HVXA 4FP8L 1EO8L 3QEGH 4B41A 3EYSH 3FQ2A 3DVGB 2QSQA 1QBML 1L7TL 3K81A 4J3BA 4S1RL 1RPKA 2DQCH 5IVZB 5HI4D 3ARBD 3U7WL 2EDHA 1S7TB 3SCMD 4QRRB 3AITA 3FUNA 3UYPB 1E4KC 4JPKL 4MXWH 3B1UA 4LCVA 1NEZA 1INEL 1OOWA 4H8WL 4OFQA 4XCFH 4YLCA 4OCXH 4U6TA 4GUOA 3TXAA 4IDJH 3TCTA 2XYBA 3O6FC 2VLRD 5AW9B 2G2RA 2WVSA 1UJ3A 1L9RA 1TXKA 2P52A 5F93C 1UYWH 3QULB 3DBSA 5J56B 5HVGB 1FA4A 1UENA 3R7RA 1CK0H 2Y24A 4YC2C 1F0LA 5DLML 4G9FE 1J18A 1F5WA 4Y4KC 4A67A 2WC7A 2PP8A 2CDFA 2BNUB 4AYID 3O6LH 4XR8C 4LVNC 2LGNA 2J88L 2WQSA 4AGNA 4ALAH 4FADA 5F88A 3MLUL 4QYAA 2UX6A 1AY1L 2E6QA 5AKTA 2XXGA 1U4EA 3BZEA 3R18A 3VMNA 2P28B 1R5IA 3NQIA 2QPDB 1B0GB 2CBOA 1JGVL 1OGTB 1MOEA 3B43A 4KY1L 4AEEA 4PVBA 4PRHD 4FFTA 1IBZA 1TFHA 3SN6N 5KS9F 1AZVA 3FSWA 3GI8L 2IAMD 2PCPB 3P1VA 4XWGH 1QFHA 2GTWB 1OSPL 5C0AD 8PAZA 4QXUL 3OL2A 4NQCD 1Z7JA 5HI5D 1RZKC 4Q8BA 2WCPA 2NR6D 4QXTB 4S11A 4HUNB 4L3CB 1M6OB 1RJLA 4FQ2L 1M1SA 1YEFH 5JNYA 1F6LL 3FRPG 2Q76A 2Q2EB 3KXFE 2AXFA 3G6JF 4WU5A 3T1FB 4Z7OF 4Q9QH 4O58H 1L3WA 2MHAB 5IV2B 2ESVE 4UTCA 3INUH 1TJHH 1NDTA 4FQCL 3U30C 5BZDB 1P7QA 3CZJA 1FVCB 4P0DA 5IMKB 12E8H 3G04A 2BLFA 1NGQH 1DLHA 2GJRA 4CW1B 1NFDF 1KSRA 5CGMA 1O5PA 3KPRB 4I0PD 1AP2A 3QXVA 5CJQH 3TT1L 2DMHA 1QW9A 2W0PA 1BIHA 5D2LB 2J1ZA 3WLBA 3H2PA 1B4RA 4ONHB 4LF3B 1BZQK 1SM3H 3CDCA 5AEAA 1SXNA 5E8EB 4YUEH 1GGUA 3FSAA 1U6AH 1Z0NA 4JFQA 4JUTA 4KV5E 2BP0A 2GSGB 3BLBA 1IM3D 1J0KA 2ZX9A 4NJ9H 5HHNB 1J5IA 1G6RH 3KH4A 4M9PA 2EADA 4ENZA 4LQFH 3RVUD 1J5CA 4RQQB 3LS4L 4V1DD 4ZUSA 1TEFA 3CSBA 3D4GA 2WXFA 3IRPX 1XMEB 5H35B 4W9DC 2IALB 2WUCL 4OLWH 1G7MA 5E2VH 3L4XA 2Z35A 1KPRB 2ADIB 1XZWA 4MMYB 3QR1A 4LHUB 4AT6A 5CBAB 5TDOB 3U79A 5LCVL 1MRCL 5M95B 1BAFL 1RK0B 2NY0C 5E5UB 3QUXD 5I2IA 2XTSA 2Y1AA 3LMJL 2IANE 1J9TA 2DWEA 4WUUE 4DGVL 4HPOH 4KK6C 2AK4B 2AP2A 4OAWB 1MHPL 1TJIH 3UXFA 2N1TE 3HPLA 4TRPL 5IFJB 3BI9X 3JWOH 4HOMA 1BVZA 2BWIA 3FXIC 3HUJE 3OPZL 5DF0A 1GS6X 3AXLB 4RNRB 3SPGA 5GRJL 3FQRB 2WNXA 2N0MA 3WFHB 4OVUA 2R29A 4CNIB 2YD5A 3CD4A 5ANMA 2G60L 4EQ2A 3LD8C 3REVA 4XVSH 2HZHA 2W65A 1MI5B 4RISL 5EIIB 4LSUH 1O0VA 2NUPB 1VENA 3HNSL 2VLKD 4UYPA 2IDCA 1CD1A 3ARUA 3ZDZE 1KN2L 3DMMB 2D7PA 4AK1A 4WENB 5JORA 1MFCL 3NPZB 4IOFD 9CGTA 3ZE0F 3UAFA 1YEJH 7TAAA 5LG1A 3RP1A 4QHKI 4N8CL 2F7RA 4JDVA 1A2YA 3GSUB 3HAEH 2PXYC 1CWVA 3GSXB 3S96B 1IIIA 1S5HA 2EDQA 2VN5A 4IKIA 3WXWL 5IB2A 5HYJA 5IHBA 1PU0A 4NAJA 1TYEB 4PS3A 1RIHL 1U8HA 2X0WA 3K72A 1OXYA 5E6IA 3ARFD 2KYIA 4JDEB 4A2HA 1F4WH 1J8KA 2VISA 1AXSA 5FXCH 4F91B 1TZIB 2NYKA 3W0WA 1A4CA 1A1NA 2TRHA 5GGQL 4AIXA 3S88L 2K70A 1KYOK 4XBEL 4JE4B 2R1XB 1J5DA 3UMTA 4IOSA 1S7UA 4YHZH 3T8XA 3VXRE 3N55A 3ZTNH 4CC4C 2YRLA 3EJUA 3FQUB 2NY4D 5BQDA 5F6IB 2QJDA 3UJJH 1XH0A 2EXYC 4WW2F 1V55B 3HJEA 2PO6A 1ZLDA 1MSPA 3MOQA 1U8CB 3BP5A 5DMJB 4HWEH 3QORC 3LRSB 5D93C 5JUEL 4Y5VC 1W0YT 4M1CD 3PPSA 4WF7A 3C9NA 1P2CB 4UT7L 5HYFA 2ED6A 5FV1L 3NJHA 3OR7B 1JHLL 3BVWA 2VERN 1TQTA 2BO0A 3UAAA 3A24A 4QHMA 4LLQA 4FQXC 3O9WD 3KPLB 4GUPA 3L08A 3BPLB 1T0NA 4X6DF 3NBNA 1T1XB 4JHBA 4G43A 5I1HH 4PG2C 3UBXG 4NM4H 2ZQKA 4JRXB 3S5LB 5F7MC 4YOKA 4HEMA 4FTVD 2VAAB 4B53A 2P44B 2BCKA 3ZOAA 1RK1B 3O3BA 1PZCA 1KCVL 2NMSA 2R1YB 3ATBA 3S6CA 3RZWA 3UPCA 1I9RH 4JHWL 2I32A 4O00A 1JTPA 1I8LA 3TBTB 5JQ6L 4JFHD 3ALPA 4JFPA 5E00B 3T5WA 4U1SA 4MZ2A 5KBMA 2CRZA 1GKOA 4AQ1B 2NDGA 3P4NB 5CIPH 2FHBA 5GRUH 5D7SL 5LXGH 5GZOD 2Y3AA 3QIUB 1JFQL 5CJOH 2AAVA 4HJEA 1UACL 3BGFB 2P42B 2VDRH 4UOW0 5JOFA 1AGCB 4NEHB 1OHQA 4FG6C 4KVNL 3KLKA 3O3EA 4PRNB 1ZIAA 3N40F 1H3WM 5EDSA 1J88A 2RCSH 4KMQA 1MRFL 4YBHA 4LVEA 4I2XE 5DZ9A 1M9WA 1G7PA 1GMEA 4FQQB 4PJAA 1CE1H 3L7EB 3QDGB 4APXB 2V17L 3UGXA 4NWUL 3C5ZC 3H7BA 3I6GA 4KQ3L 3PQYE 3W3BA 2OSWA 5F7UA 4DP5X 4KJWD 5FX3A 4A66A 1IE4A 3IAPA 3GI9H 4PTTA 3V55A 3CDGB 4DUXA 4I48A 3KVQA 3QDMA 3BO8B 2R4RL 3RWGA 3SBWC 3K3QA 5DHXB 3FQNA 3CVHH 4PJHB 4A6YB 4P23D 3JWNE 1RULL 5KVGL 3TFKD 2EDOA 2FQFA 3DBXA 1AJ7H 4KRNA 1A25A 1UZ8A 4WI5A 2HFEB 5SWSA 3RL2A 2YMXL 1AHKA 2R69H 4KKZA 1SBSL 1S9XA 3MGOB 4KITB 1CG9B 3HHRB 3U4BH 1SEQH 1UB6B 4NPYA 3RZCB 5KVFL 5F1NB 1O6TA 4EI5C 4IGBA 2C9XA 2J25A 2X9YA 3V7AE 2CNYA 4KQ4L 3QI9B 4NNPL 4P2RA 4X0NA 4XVOA 2HAZA 5I23A 2EE2A 4UILH 3TN0D 3OWEA 1DJIA 5ICXA 3EYQD 3C8KA 4TSAH 2AF2A 4KPHL 1BFOB 1M2VA 3BEVB 3AU1B 3DXAB 3WD5L 2O26U 4Z5RB 2WB1A 5IFAL 2G9HB 4ZXBA 3QIWD 3V6FA 1A7OL 3FRPB 4QGYA 5C0ND 2E7CA 2X12A 3ZR5A 2ZYHA 3BLPX 4X0KA 1E9OA 4NQSB 4YWGL 4IRJC 4LEBA 5FDWA 3MNVA 4XP9H 5FGCB 3EH4B 4HP5A 1JTTA 2CKBA 1HKLL 4DKTA 4ODHL 4ZX3A 4Y4HA 1ORSB 3GXFA 3RDTC 4HJIA 4G8GA 4JVPA 4ZFOL 5JZ7C 4OZHE 4FEIA 4Z77A 5IBTH 1RXLA 4Z7VE 3R8BB 5A6LA 4Y89A 2O6PA 5KSUB 4R26H 5KTEL 5DJCA 1WSST 3GKWL 3EGXB 4YDLC 1FC2D 5E9NA 2Z7UA 4EIZC 4WWOA 2VT0A 4KRPD 5I6PA 3FMGH 2A9CA 4QDGA 2JWYA 1A4KB 5D1QE 1Y0LB 3BDYL 3O2VH 1NFIB 1O5DT 2DJMA 3GIZH 2I60L 3KBHE 2FH6A 4WW2C 4GFTB 4O4YH 2XN2A 5T5NG 4GMTL 4H0LC 5TE6H 1WD8A 3RKPA 4Z7WF 4DK6A 4C56B 5SWQA 1ZLSL 3T0DA 4FYTA 1L0QA 3IXAB 3LNDA 3RQ3A 1JZ7A 3G5XA 2CR0A 5A1AA 4X4MA 1DQTA 4PJIF 3F7YA 5IHZB 3U1SH 4HDIB 4XPBL 4RETB 2J1XA 1OP9A 4YPJA 1M71B 4WHTB 4HOXA 4X7SL 3D0VB 3PFUA 3KM2A 5T5FH 4BIKA 4EIUA 5DA0B 3WL9A 4TQHA 2ZJSL 3MRNB 1G7HA 2YXMA 1V7NH 4HWBL 2MPAL 4KNUA 4I5BA 4OLXL 4FLOA 2EDRA 3MRBA 1FH5L 4K7PX 2AXGB 5E6UB 1W9XA 1PVHA 5CMAB 4ATTA 3PHOA 1DR9A 2FT6A 4XPFL 2A6DA 2HT2C 4FN0A 2V7NA 2NXZB 4HS6A 5J9PA 3KEDA 1UUNA 2EEAA 4Z0BH 2PWFA 2BC4A 1X5XA 3IKKA 3TP4A 4UTAL 1QSEE 1U2CA 4PSRA 1ACYL 4G6JL 4BV1A 1R47A 5AVXB 2EDEA 1FYTB 3HRZA 4M6OH 3HI1B 4OUUB 1IBHA 4WO4D 5I1LB 1E8YA 4OJDH 4ODWB 2CD0A 1RLWA 3KYMA 3MLSH 4YHKL 3TA3B 1REIA 4B9IA 4KXZH 4BFJA 4LCYA 3GZPA 5LAPA 3BC9A 1A6UL 4URKA 2JMRA 3H6AA 5TE7L 2FWOA 1ETB1 1KJVA 2OX5B 2UZIH 4GAJL 3ZDXF 1I1YA 2EIKB 3MNDA 2F68X 3FB7A 1KULA 2IQ9H 1T1ZB 3KW7A 3QZOA 2GJ6D 4QTHA 1Q0XL 4HH9A 5TDNA 4CGTA 5E8PA 3FTXA 5I6MA 1QSFD 2ADYA 3SGEI 5D2NE 3T0AA 2RA1A 2HKFL 1DLFH 1IBFA 3BXNA 5L4FA 4HKZB 1OLZA 2K78A 4NENB 4EN3D 1WAEA 1UATA 2UZPA 3ATFA 3CBJB 3VSVA 2JCCE 4MJ6B 3SZKC 3FTZA 4ETQB 2BVPB 4OFDA 4OSUL 2X89A 3F65A 3MJ9H 4TPRH 2XZCL 5CU9A 1ETZB 4X83A 5IB3B 4F8OA 4FNUA 3KGTA 1T0MA 1K5WA 3E1F1 4HIEA 4JDZA 4OW6A 4R5TA 3LEVL 5LUMA 3R06B 1S8DB 3ARBC 4HK0B 4PLNC 4ZAKA 2BNQA 3VD7A 3P4LA 2XWEA 1I4FA 2WBJA 3FU8A 3WFDH 3IGFA 1QAWA 1BEYH 2YD2A 3I9AA 1SJEB 3T8MA 2KS0A 1EGJH 1JVKA 3VG9C 4YSEA 2PKDA 1EUTA 1PNDA 2BP8A 3DHMA 3NABH 1A6PA 4H20H 3MREB 1T2QH 5J8OA 3E1ZA 2H8PA 4LCIL 5AW2B 5AOIA 4PJCE 5DZVA 4N1HB 3AM8C 3IFLH 1IFHH 4L5FE 1FG2B 3CN0A 5I71B 4PVMA 1XF2A 2VR8A 3BIKA 2O93L 1OTTD 4L37A 3BSZH 4N0UB 4HK3J 4RRPA 3NZ8A 2OK0L 2VLKE 3QUZA 4Q6IA 2VL5A 1BXUA 2QSCH 5D5MA 4AVHA 3IDJB 2X10A 4HCGA 4JPWL 4L4TB 4LLYB 4OIBA 4APQD 3KHQA 4UM9A 2P4AB 1YAIA 2VDPL 3S3DB 2NX5A 1DJXA 4HHGA 3UBXB 1E90A 1QO3A 1N12A 1KV3A 2WO3B 4U2YA 4PJXE 2HMID 2MMXA 2KLTA 4JL2A 3HFML 2DYPB 1TTUA 1YMMB 2EEDA 3CHQA 3HG3A 3FQXB 4Y9FA 2ZIDA 5MEPB 3P11H 4JN1L 1AD9A 3JUZA 4DJMA 3IFOB 3VXPB 2A6KA 2QKIC 4XO5A 3MFFA 3HAEG 4JQXA 4B5EA 4D0DB 2X3AA 4RGND 1R9FA 3OAYH 2VM3A 2X4NB 4QT5A 4M1DL 4Y7MA 4X5XB 1HH9A 3V4PL 1UM5L 4XP4L 3DGGA 1D5IL 1F3DJ 1MHHB 2G4GA 2KZ1B 5C0BB 4YSQA 5ADOH 1S7XB 3HVDA 1WDAA 1QW8A 4XPAH 4LSPL 3F58L 3CU1A 4WHCA 5GS0H 1PY0A 3S36L 3P54A 3S4SA 5HI5C 5AVWB 3IS0X 4OU3A 3T3PF 1NAMB 1EPFA 2Z4TA 1IO4C 2CLZB 3QFJD 2EEXA 4JRWA 1DN0B 5T1MB 1HZKA 2DQTH 1IEHA 2WYIA 5KBLA 1QASA 3VFRB 4S1SH 3FCSB 2MOQA 3JWNH 3WN5A 4DFHA 1JBJA 4LL1A 4YHPA 1YN6A 2Y6SD 1V05A 3EBGA 5EEXA 3UTZB 2VLJA 3OXRA 4Y5XB 2HRLA 3H42H 3SKNA 1MAML 1I85C 1FSKC 4IRZA 4LAQH 3FHQA 4WDIB 1YYLH 4I0PC 1IC7L 3MBED 2X41A 2KQMA 1AZBA 1J10A 5INCA 2OI9C 4Q7DA 4X6CB 4IMKA 4Y5YA 2VUYA 4FNPA 4F7TA 2VXUL 1SQMA 4KUCF 2FAUA 4NAQA 3ZQ9A 3PXHA 3FB6B 1CLZL 2B2XL 2E7BA 4YO0B 4KZDL 4R4FL 4PJHF 1I1AB 1HEHC 4FZ8H 2FX9H 4PV8B 3RVUC 5KBPA 2YA0A 5CGYD 1SVCP 1X5JA 3UBXI 4LKXB 3DO7B 4NO5B 4Q52A 3NPSC 4TNVK 4N2KA 5K39B 5IUCA 1GR7A 4RBPH 3GHPA 1A1OA 3R7QA 1JGEA 1GC1C 4Z7NB 3QRFM 3D06A 3AY4C 4P46A 5GHWH 2VR7A 3FFDB 4UIMA 5T1KD 1VFMA 4NRXA 1NLBH 3AG1B 6PCYA 2EJ1A 3VJ6A 4Z3HA 3QUXC 3P3YA 3ZGIA 2CO6B 4L9LB 1JV2B 1R24A 3IDYC 4P5TB 1JYXA 1MNUL 3B2DC 2DL2A 3P77A 3T3MF 4JG0H 5BQ7A 5BXFB 3GUTB 2NQCA 3L9RA 3AWFA 2XPGB 3UBFA 3QZWG 1OSZB 3LAFA 3ZE2E 3FU9A 2AEOA 1R5VB 3F7LA 5LGHL 3AT8A 3WY2A 4E0RA 3EBAA 3BIAX 3LXAA 3UGEA 1LO5B 2UZYA 3ULVF 4PJBB 2MNWA 3QG7L 5DHYB 5D1XA 3F5WB 1E2VA 3EFFB 3ULUL 5KYNA 4EQ3A 3N50A 4J6RH 3BVDB 1YNTB 4PB0L 2XG5A 3OGOE 4O02L 4TM9A 4ECNA 5IGXL 4C83B 1MQ8A 3Q0HA 1KCBA 3US0A 4R84A 2J2ZA 5CSBA 2F7QA 4WWKD 1FO0B 3E6HA 4YHML 3N3EA 3MXWH 3FO9A 4DESA 2P49B 3NRQA 2X4RA 5IQOA 1I7ZA 4FI6A 4XI5D 4RAVA 5L7XL 1A7PL 4NZ8A 2BK8A 3HHSA 2ODIA 4NZUL 2P5ED 2Z8WC 1YEKH 4PJ7F 2AQRA 5I1CL 4I0KA 4PAZA 4JFED 3QWRA 1MCLA 1HHJA 5ID1A 5G5DA 1F8TH 3MUGB 1N59B 3FU7B 3PV6A 4KX7A 2PWGA 4N1CA 3TF7C 2V37A 1GSMA 2X6UA 3LDBB 3LCYA 4H8HA 4C4BA 4CADA 4ZI8A 1YC7A 3QCTH 1FL3A 4HZAA 3BN3B 2EE0A 4NQDD 4RIRA 4LQ1A 2AQTA 4OF3A 4OF8A 4FXKC 1ACZA 1UOKA 4GRMB 4LKCB 3VNYA 1JXFA 3FNKA 3ZTJH 1R3KA 4IEFA 2NY4C 1DTUA 1BVNT 1I1CA 3MJ7B 1WWCA 4Y2NA 3MXVL 3VXSA 1OV8A 5KVMC 4R7XA 4A7SA 1E4KA 5EMYA 1RHFA 4KDTC 4CVXA 5L88H 2WWOA 1HQRA 3SJVD 4WI3A 4GI6A 4KXCA 2R9HC 1VACA 1OB1A 2F53E 3FT4A 4M1CC 4YGAB 3O6FA 4OCLC 1DQJB 3X13B 2VDOB 4WWNA 5HDQH 1YYCA 1B4TA 4UYQA 1MG3C 1XB8A 4A7QA 4Y9CA 2K9FB 2EACA 2J43A 3VD5A 5SWZA 1KCLA 5EH1A 1G7IB 1XX9C 5CSZB 3TTYA 3O9WC 3QO0B 3WCYA 2DPKA 5FK9B 3A21A 4R0LA 4Y4KA 5CCKH 1XCQA 5E9DB 1NCOA 2HN7A 2LW3A 3QQDB 1NDMB 2H6UA 3HG2A 2DN7A 4YSCA 3M17A 5DC2A 4NSKB 4X4KA 1X44A 5D4IA 1BAWA 4XN8A 4XCCH 2HT3D 4YXKH 1FFOA 3LKRA 2DQEH 4XNZB 1OANA 3S5YA 1SBBA 5KEZA 4LFHG 1AE6H 3OKKB 3P9MB 2X7LB 1CFVL 2DJ4A 3D2UD 4L5FH 2FVNA 2CDEB 1O7SA 1FPTH 3LN5B 5EN3A 1HL8A 5D1ZD 3LVEA 1QNIA 1BZ7B 4NRZB 4GI9A 1I8IB 5J3HC 1PAMA 3FUHA 1ZHBB 1V7MH 5E8DL 3L3HA 4XMZA 5DSCA 4J2XA 1KV7A 3BD5A 3EDDA 5BRPA 1JV5B 2JCWA 1G9MC 2E9IA 5AZ2H 2YD1A 3KWWA 4G8EA 4L8DA 3NG5A 3V95A 4GXFA 2AEIT 3DOSA 4LVNB 1OARH 4Q0XH 2BSTB 1RZFH 2DH2A 1D9KA 4TNWK 1R75A 2WINA 1YUHB 1EEQA 3RYMA 1NBYB 2AANA 3CVDA 3NSCA 5LGYA 5IG7A 1G87A 4L0ZA 3BFOA 4ADGA 1CIUA 5K9QG 2C3VB 2KDGA 5ERWB 3RJQB 3W2DH 1O9WA 3GZKA 3RNQB 2F1AA 2OMTB 1ORQB 2K7QA 4POZC 5DEFB 1IC4H 3LEYL 1P5UC 1P84J 2BIQA 3N5AA 1FQ9C 4P23C 3V5HA 1CI5A 3TBVA 3TFKC 3ARGD 2WLIB 4LBEA 2YKLH 2P80A 1URZA 2WHVA 4H13C 4NQEB 5A2AA 4DW2L 2H2SD 1Z6JT 3QXDB 3O2DA 3EZJB 2ZUYA 2NY7L 3HI6H 4WNJA 5HJBA 4O9HL 4M6MH 4G7YL 2C7UB 4ZUUB 3PS6A 2F58H 5I18H 3QZLA 3D30A 3TX4A 3L3GA 4ODXA 3FS9A 1B0IA 4WHDA 5D7JD 5C0CB 1FGNL 2Q86A 5FB8A 4UDTB 5BMFL 1AANA 2VCOA 3PREA 3AUWB 1NA8A 3EYQC 1UXWA 1ZSDB 3ZLQC 4F92B 5F8RC 4NN6B 1XIWA 2OYLA 5D7LA 3S5ZA 1M05A 1EO8H 3LNFA 3F84A 3O45A 4NKQB 4NAMA 4S1RH 5C0NC 1QBMH 4HPYH 4MAYB 3SKOA 1RL1A 3VFTB 1NWOA 3E8UH 3CFIC 2Z1KA 1CO1A 4LNRB 4NRYB 3BVNB 1SEBB 1PCSA 2YOCA 4NKDB 5CD5C 4XRCB 3D39B 5I6KA 3RWIA 3HKFA 1R0AL 1HHHB 4ZUVA 2R0WL 3ULSB 5DK2A 3MNMA 1N0XL 1P4IH 2JLLA 4MQ7B 1AR1D 1A1MB 2D7MA 4U6YA 4PJFA 3LHPH 1UD3A 1QLEL 3DJ9A 5JHDB 4S0HA 4NDMB 3PJSB 3R4RA 3FOMB 1TMQA 4TNFA 2P8MA 3O8XD 3SGDI 2K8QA 4KRPC 1J48A 1S4IA 1N0LA 2PW2A 2FR4B 4AX3A 3C5JA 4G7QB 4FX5A 4X7EC 4ZYKA 1YZZA 4BQBA 1CDJA 1KBKA 1ZSHA 5DEJA 3ISRA 1NSNL 3CMOH 3VI4B 4A2DA 4PJ5A 2VC2B 3OKMA 2PP7A 4ZFZB 2VLLB 1IGFH 4F24A 2GIMA 4MA1C 1U8PA 5C0RH 4LE8A 4D9RE 3VFWB 1RURH 4UQ2B 1JGVH 1RP8A 1T66D 1IUZA 4XBMA 4GRLA 1HJBC 4K3DL 3V5DB 3GI8H 4NN7C 1E8ZA 2BVQA 2YPLD 2ZSWA 2Q7NA 5KVGE 2J21A 4P2CG 1SN2A 2ERJC 3GMQA 2JFCA 4Y16A 3U48A 4JZJC 4MNHB 3F83A 4CC4A 4D8PA 6FABL 3QO1B 3JVFC 2FD6L 1MCHA 4KFZC 1JPFB 2NLJA 2XPYA 4KNTA 2RJMA 3K6NA 1F4AA 3QZWB 1I7UB 2ATKB 2IWFA 3OZ9L 5SX4H 3QJOA 5EIVA 5K9JH 4A7GF 4X7CC 1SFHA 1U21A 2V5MA 3JWNG 5KVFE 3J07A 4JHAL 2XG4B 1Q9KB 3BUDA 4RBPK 3QORA 1ZGLB 1A21A 4WO4C 4Y5VA 1T7WA 4ABQA 2VDNL 4DEPB 4PCYA 4PWHA 1I3VA 2OL3L 2ZOUA 4QJ4B 3VWKA 2OXHA 3IS1X 2A77H 1TJXA 5KS9A 3TT1H 2V2TA 4FAAB 2DDQL 3DVNA 1ZWIA 1UWGL 3BMWA 1YNTF 2DIEA 2J4WL 4G59C 4FQXA 1JZEA 2IH3A 1JNLH 2XBDA 5CHNA 3V7AG 4HIIA 1LK3H 4MASA 4H44C 3TOPA 3GMLA 5HHME 4LEOA 2D03H 1QFWI 2D4FA 4PG2A 1G7QA 3D87B 4PSPA 2P5WB 3IMRA 3P73B 3QC5X 1L6ZA 3L4WA 1S9YB 4H5SB 3JV5A 1BECA 2ICCA 4WKZB 3G6JA 2W07B 2GJJA 4WU7B 3JYBA 4EN3C 4MZIA 5A2KH 1E5ZA 4JFDA 1JPTH 3DTXA 3OLGA 1G94A 1O7VA 3TO4D 3TTSA 1SNRA 4WJ5B 2EKSA 5T5NF 1AGEA 1J0YA 3ES6A 3ILEA 2UZXB 3GZQA 3N1QC 4XBGA 4CVZB 1NFDA 2KKQA 4HZLB 4NC0B 4BGLA 2F0CA 3NN8A 3BZ4B 3U9UA 3FFCB 1MRCH 2CM5A 4MRCA 4XX5A 4LRIC 1BAFH 1P1VA 4FZEH 4OT1L 2BOCA 3QT2A 1BA9A 1ZDSA 1CCZA 4O2CB 5LLIC 1I3RB 3LRMA 5IB1A 3CFKA 1XGUA 3QZNA 1HAWA 2YFOA 5AKSA 1C16A 5HGGS 3ZMRA 3FPXA 3AAZA 4DGIL 5GPRA 2F7IA 2DIAA 1S3RA 2B4CL 1MIML 3PXLA 5DCCA 3DIVA 1I8MB 1IFGA 2F74B 4X9HA 4PRDA 2X4UA 3ZVVA 2F7PA 4P57A 2VDKL 4HF5L 2ZF8A 3HIZA 4MNQA 2LFEA 3QE5A 3C5ZA 5B1AB 2G60H 4OD3L 5F6HJ 5DEZA 4MJID 1BVNP 5KJ7E 3HNSH 4JAMA 4QRTA 4HALA 1BD2A 2NNCA 3SBWA 2WXJA 4NO0B 2P5EE 5I6XB 5J7CC 2HMIC 3I9GL 2ROYA 4K3GA 1RCYA 1ZPUA 2IDQA 3N41B 3QZMA 3TCXA 1OTUC 4B9CA 4ZMZA 5FHBL 2XC8A 3A0OA 1ZE3C 3DIFB 1WZ1L 2IANB 1A4BA 2H0FA 4DF9A 4ZNEE 4KXAA 4WUUB 3D7PA 1A14L 4IKNA 1PZAA 5DYOA 4EI5A 3L3JB 3V0AC 1QLFA 4TQIA 3F85A 1FHNA 4S0TD 4LCWB 5JOPE 2VR9A 3OQRA 4HKBA 4JVWA 3LIZA 4XPHL 3V6OE 1OCOB 1EO5A 1E8WA 1IBGL 5EU6A 3PE9A 1AR2A 3I02B 3MSPA 4R7VA 1IQDB 2KZBA 5E7FA 3HEIB 4YXLL 1XL4A 4QHPA 1LYQA 1I7RB 3C08H 4ODVL 4IRJA 3IVKA 3IXTA 3MX0A 3IJ8A 4X8GA 4G7VL 2M1KA 3IJSB 2HX9A 3CQQA 3MBEC 4FFYH 3BPNC 4QKTA 2XWZA 3G5VB 5C9KA 1E9QB 3RDTA 1GHFH 1YEHL 1HTYA 1UM4H 4YBQD 1A65A 3DV6B 5IESH 2HVJA 1XH1A 3DETC 3I6KB 3RNKA 1Q94A 4KVPA 3NJNA 4OLVL 5FPIA 3HA0A 3OPUA 4BM7A 4ZQKB 3P2BA 4JL1A 3X3GL 3MRQB 5E94A 4OFPA 4RDBA 1S7WB 2OMWA 2E7LA 3GSQB 1NMBL 1O7DC 3FQTA 3BAWA 4M61B 4RZCB 4WK0B 4WW2A 4G8IB 1HJCA 4LASL 2GCYB 4P5KB 2IDUA 5J0BA 1U41A 2XKSA 3K1DA 1MLCB 2QKSA 2FECI 2DWXA 2E47A 3BZFA 2YMTA 4J3OG 3KAAA 1KB5B 5EZLB 4K23L 1FRGL 4HHWA 3DUUB 5FFGA 2ZPKL 1UKQA 2E27L 3TWCH 1H3PL 1DVYA 2DLFL 3MO1B 1S9WB 3GNMH 2OA9A 1PF3A 3MNWB 5D8JL 2WAQA 2JIXA 4MA3A 5D7SH 3HG1D 5IJDC 3FCUB 3KYAA 4X6DA 2Y1ZA 4PI2A 1PLGL 3EGDB 2R0LH 4KJPC 3ZHKA 1D5RA 1UACH 2ITCB 3BEWA 3I6LD 4UWQB 3SDDB 4KVNH 3RE0A 3D85B 3ZYOA 1BQLH 1WG3A 3ROOA 3D3VD 4N85A 4WK4B 5DD1H 1T5WB 3NJGA 4ALAC 4AM0A 3KPSA 2R4SL 4M7ZC 1OTSC 4GIOA 4GQQA 4PGZA 3AREB 1BF5A 1HXMB 1KY7A 5A43C 1CZ8H 1XGPB 4JVUA 4XB8A 5GJSH 4P04A 5L9DL 3IBEA 2WVVA 5KYXA 1TZHB 4PRID 1AKJD 1VGKB 1H5BA 2H3XC 3QUMB 1OGAD 3RA7L 5CLYA 3DX8B 4U1HA 4NYLB 1XF4A 4ZMVA 2W0LA 4R7LA 1RULH 2X4QB 1W0VA 3MNZA 4L1LA 4XNYL 3FO0H 4N2LA 2UVEA 2WLZA 3LX9A 4Z76B 4TTGA 4HIXH 2A83B 1S7TA 3D1MC 3OAUH 3TLRA 4E9QA 2L3BA 2EC9T 1Q72L 3MOAL 4OKDA 3DX0A 5KVFH 5IJVB 1OO2A 3S3JA 4RAHA 5HI3C 4KQ4H 1QPPA 4M8QA 1FNSH 4I2XB 4NNPH 1PKQE 4IBTA 3RJDA 1BVLB 1A9BB 5HGAA 4EUPH 2BIOA 3GBMH 5H4YA 3LN4B 3QULA 1QR4A 1JPEA 4HD5A 3QG6A 3NSDA 5IFAH 1AYOA 3HMWL 3EJRA 1NANI 1KTBA 4J1UB 4U1IB 4BE6A 3BAXA 5AVRB 3ZRSA 4V2BA 1UEYA 1JWMB 2VXTH 3KLAB 2BNUA 2X40A 4F27A 3QCVH 4AKPA 4X7DC 4B0MB 3VTTA 3L5WB 4UQ3B 3VYNA 4LARL 4OV5A 2X9XA 3D9AL 1E42A 1PG7L 3H9SE 3W56A 4R83A 5JHLL 4JM4L 4PRBA 4J23A 3EJTA 1B0GA 4M1GL 4X5RA 4WUKH 4I18C 2WXPA 4X9GA 2NY1B 1VFBB 4NT6B 4LSDA 5DQ9A 3ARBB 3MC0A 3Q2VA 3SCMB 5I0WA 3PDDA 2Y0SA 3U6XS 3BDYH 4TQEL 2DM4A 1TQCC 3CDZB 3JWDL 3ULUE 2I60H 3ZKMD 4RFEB 2D73A 4L3CA 3H53A 5ALBL 3VG9B 2EDNA 2NY5L 3Q2LA 1T7VA 4ODSH 4HW6A 3H4HA 4ELKB 3OMZA 2VLRB 2MHAA 4PJDB 4FMVA 1X7TA 3JWOC 4LSVL 2J6EA 3KWXA 5IMKA 4AQEA 2L7QA 1MREH 4W9LC 2ZJSH 5K1JA 1DQDH 4FMKA 4Z7VB 2MPAH 3KPRA 3RX5A 5F2FA 2N59A 4WTZG 5E6RB 2H41A 1H15A 3T6ZA 4J8RA 4ONHA 3JZ7A 2V3DA 4QO1A 4X4YB 4XPFH 1NTDA 3QEHA 5E8EA 1GOHA 1PMYA 4OQTL 4W9HC 2IJ0C 4KTDL 3X12A 3AS3A 2E0PA 2GSGA 3I85A 4O51B 4Z7WA 1OPOA 4JO1L 5HHNA 1JRHI 4G6JH 2GJZB 1I85A 4KV5F 2WTRA 5F7BA 3S36X 1SN0A 3HMXA 4PJIA 1XCXA 3H9HB 3QZPA 3SKJL 1Z9MA 4U4BA 4A37A 4CKVX 3JXAA 5ACZB 1WITA 3WDJA 3ARGC 5TFSH 3SE9H 2R23A 2IAMB 4GAJH 4YDVA 1JI1A 3MYJA 5C0AB 2E75C 2VZ3A 3UEQA 1KJ2B 4BFOA 4DOHB 1ZANL 2H2SC 4KDWA 5J1TC 5CBAA 4LHUA 1K4CB 4G6AC 5TDOA 2ALAA 2ICEB 5C08E 2VDMH 5DJDB 4F15C 4M8UA 5CBEB 2BIHA 1B0RB 1F6AB 1PY9A 2E4TA 2F7OA 2LABA 3EFOA 2EDFA 4QEGA 5I73B 3DSNA 3PHQA 1DQMH 3GLEA 3KPMB 1UM6L 2H1PL 2G3XA 1EXUA 4GG6E 3W11C 3TURA 5C0GA 4OSUH 2XN9A 4AUUA 2XZCH 3AT9A 2OZ4L 1OAXH 1FIEA 3DX9A 1OE3A 1IAKA 1QSEB 1M7IB 3ETTA 1YN7B 5FDYA 2KDYA 1GAFL 4IHOB 3T0EC 2Y5TB 4I0PB 2B15A 1UJTA 3ZZ1A 3LEVH 3EYOB 3WFHA 3HUJF 1EFXD 3PWPE 4M62L 2E6JA 3OGCB 5ADPL 3K0WA 3DHPA 3KH3A 3L17A 3UTSA 1IM3B 3ARPA 4TVUA 2FZ3B 1B4JL 4NP4H 5JR1H 3DMMA 3X14B 4LCIH 2Q1EA 3KVDD 4XMKL 3MLVL 1VPOL 4PFEA 3ZDZF 1ID5I 1VAHA 2XQ0A 3MCG1 5D2NB 3EXLA 2IOMA 1P6FA 4XPGH 5KJ4A 3SKMB 3NPSB 3B9VA 3LKNB 4GXVL 4J28A 3NCCB 1CLVA 3LHAA 4BEIA 4K9EL 2R56H 2YD6A 2FWSA 2VITB 2HLFC 1ZJAA 5GQBA 3GS0A 1CLOL 4N68A 4JPWH 1X9UA 5KSAD 3OMNB 4A2GA 2ZOTA 2ADGB 3GHEL 3INOA 4OD1H 1GCYA 1K4DB 5GSVA 3AABA 4E9XA 1TZIA 4Y2DC 4HISA 3DYOA 3LQZB 3BZDA 3KHOA 2XKNB 5BRZA 2UWEE 5AOLA 2A4CA 3FRUB 1NJ9B 2EYSA 2Q5BA 1FZMA 5KSBE 4QHKJ 4FG2A 4YDJA 4ZMQA 4KH2A 2GT9B 5E2UH 1T66C 3DPBA 2IBZX 3MA7B 1KBWA 5HGDB 4UAHA 2XWXA 4IBZA 3E80A 5MEOB 2R27A 2YD9A 4G8FA 1OAQH 5DUBA 4M7JH 3TNMB 3CC5A 4YDIL 3IKCA 2JXMB 3MMEB 4LPWA 1JWUB 4LSPH 4MDJA 5E6ZA 5J1AA 1HL4A 3T2LA 1HXKA 3W38A 3ZQWA 2VLKB 1JHKH 1TITA 5EUOB 4AJ0A 4DUWA 3OR7A 4BINA 1DVZA 4P9ML 4PRPD 5K1NA 2HG0A 4P3CL 3NFSH 4QOKA 1AKPA 3CQFA 5CLZA 3BAEH 5BVJB 1LP9E 2OMXB 3TIEA 3FN0H 4XC1H 2HPTA 4F58L 3R19A 4NCC1 4PGCA 1T1XA 4PJXB 5DHVB 1DBBH 3OC5A 3GXDA 1NCAL 3MRLA 1RZ7L 3PAYA 4I88A 4JRXA 3S5LA 3PGCB 3PWNB 2VAAA 1YVLA 3CFJA 4YEEA 4M6NH 3MRJB 3QBTB 1U33A 2NYZA 3ARFB 4RSVA 4J8QA 5IROD 4G1EB 5CU5A 5SV4A 2R1YA 3I75A 4HG4K 1BJ1J 4FRWA 2VXUH 3L1OL 1A3ZA 5I74C 5T3ZL 2R29H 4Z7UE 1KFAL 4NUJB 5IVXE 2IWEA 5E00A 4PGJA 4FXKB 1A4JB 1BFVH 3BD4A 3QDJD 5I75C 2YGQA 4AQ1A 4P3DA 4WW1B 1K9TA 4QRQA 1KLFA 2WXQA 5EORL 5FR3A 3QIUA 5A6IA 3N04A 5CSGA 1FNAA 2QQQA 5DJAA 4WLCA 2CBTA 4U0RB 4IOIA 3JZYA 1GS7A 4MNGE 1EAOA 4NZRL 3MLTA 4PWGA 1DHKA 3O3AB 4OF6A 4RX4A 2KPNA 3VUAA 3ZL2A 3HG1E 3QEQD 5ABDE 3BH8B 4APXA 5L2KE 5HHOE 3PDGA 3CSFA 4PG9B 3GF8A 4Z7QE 1AQKL 2N4IA 2XFXB 4GP4B 2YBRA 4WGKA 4KJYB 3CDGA 3I6LE 3K46A 3UO8B 3BO8A 3CGTA 3HC3L