2AXWA

Structure of drad invasin from uropathogenic escherichia coli
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
134
structure length
134
Chain Sequence
b'AELHLESRGGSGTQLRDGAKVATGRIICREAHTGFHVWMNERQVDGRAERYVVQSKDGRHELRVRTGGDGWSPVKGEGGKGVSRPGQEEQVFFDVMADGNQDIAPGEYRFSVGGACVVPQEKLAAALEHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DraD invasin
publication title Structure of DraD invasin from uropathogenic Escherichia coli: a dimer with swapped beta-tails.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Cell invasion
total genus 23
structure length 134
sequence length 134
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05775 AfaD Enterobacteria AfaD invasin protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1950 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2axwA01
2CNYA 2FVNA 3UIZA 2AXWA 2IXQA 3UIYA 2CNZA 2CO7A 4PHXA 2CO4A 2CO2A 2CO3A 5D55A 4OR1A 2CO6A 2CO1A
chains in the Genus database with same CATH superfamily
3G04B 2J25A 3BKML 5IMOB 3HC4H 1G7QA 5D5ME 5DEZA 3UJTL 5BS0E 4Z7VA 2BNUA 4IOSD 3C2AL 2HLAA 3UC0L 2A6DB 5LXVA 2R8SH 1AANA 1S6NA 5D2NB 4JK0D 3H42H 3SPVB 3NCXA 4V1DE 4OZFB 2X3AA 2D4DA 4W70A 4XCCL 3U9UB 2IV9A 1M7IA 2P42B 2EYRA 3QDMB 5F9JB 4OZIE 1JGUH 1E50A 4RGNB 3VRLF 4AQ1C 4AZ8A 4X4XB 1JWMA 2J88L 3ETBJ 4FLQA 2A9AA 4KNSA 3DUSA 3KPQB 3OM3B 3DX9A 3NPSB 3T8MA 3U7WL 3C2SA 2M83A 4MXWH 3WEXB 1OCOB 2XBTA 4O02B 4PRBB 4MMXA 4RDBA 5F21B 4NUMA 3DI3B 3K4DA 5HYSA 4AYEC 5GRYA 1IGCH 1N5AB 2ZKYA 4M7KL 4NO0D 5T3ZH 1GCFA 2WP3O 4IRJC 2A6KB 3IJYB 2DIBA 1PY9A 4YLQT 4MMYA 1QA9A 1Z5YD 4C56D 4PJAA 1LK3L 4S0TD 1DDTA 4AIXA 1C5CH 3L5IA 1VGEL 4M03A 2B08A 3VWJC 1U8QB 1BQLH 4PGDA 4J27A 2ZCKL 3B7RL 2OZ4H 4Y5YC 5CWSB 1J05B 3G9AB 4NRYA 4EXKA 5DDHB 2AJSL 2F61A 3LS4L 2A9NL 3GJFK 1O6VA 2J5LB 2JMRA 4NLHA 4P3CL 3AMKA 5CJQH 3QQ4B 5DVOA 1U6AH 4EN3B 5JQ6L 5D7HA 5MENB 2IDUA 3EW3B 3OKKA 3IPFA 4NUGH 5K93A 4PQXA 2DLHA 3O41B 2H6PA 4OB5H 3W57A 3KE0A 1DFBL 1U36A 2LE9A 2VQTA 2YA1A 5SWZE 3QA3B 4JGJA 1HDMA 3BZFA 3KL0A 3G5YA 5T3XE 3I50H 1U3YA 3OLDA 2MQ3A 2EE3A 4HF5L 3SYOA 3VTAA 1N3NA 1FBIL 3ORJA 1MVUA 2F9BT 2IAMB 5E00A 5E2TL 3D05A 4MZ3A 5HHVL 5GZNC 3VXMB 1I3RA 1PQZA 1UA6L 5AOMA 3M8OH 3I6SA 1MJJB 3BPNB 2WC7A 3UZVB 2DYRB 2HH0H 4YE0A 4OGXL 4HYTB 1TJGL 2YAPA 1UUNA 1X7SA 3KH3A 4IRSC 1M42A 4ZMAT 1WTGT 4UQDA 3R1GH 1WUZA 4X5QA 4BSJA 2EKJA 4NM4L 1CXHA 5IKCA 2OJEB 1KCRL 1O6SB 4PJAE 1JGEA 1IBBA 2G2PA 1U3HC 2JV6A 2X4PB 4C8XA 3L4VA 3U1QA 4I48A 4EO5A 3ILPA 1AG0A 3UAAA 4AMKH 1T0OA 2MSPA 3HI5L 3HHRB 3PF2A 1I3UA 1T4KB 5D7KE 4AYSA 5D2NC 3M86A 5AW3B 1NCBH 1SJEA 2HPTA 5TDOB 2A6IA 4UDUB 4MX7A 4RAVB 1P2CA 3L1GA 2I7SA 3KWVA 3L6FB 2XWBA 2OJ1A 4FQ2H 1IGIL 4JFTA 4BHUI 4L8CB 1TQWA 4RGNC 1YEFH 3DHMA 1D7CA 1Q9LA 1UACH 1RZJC 5EWIH 3QZNA 3X1BA 2JQAA 3NPSC 4PCKA 2PUQT 3OX8A 4KVPA 1FL3B 2R69A 5ISZD 2VERA 3UJJH 4Y5XB 2ID5A 2X4SB 5F8RC 3UTTB 1IKOP 1MCQA 1AYRA 4YK4B 4TPRL 1QFWL 2BC4A 4XI5D 3K1DA 1O9VA 3HI1A 5CIPA 2PR4H 3H56A 4KKLD 5SWSA 3DROA 4L5FH 1ZGLA 3D3VA 3GRBA 5LXGL 4DK6A 8FABB 1M7DB 1QFOA 1TZGL 2AJVL 4QXTB 2Y7SA 4QNPE 3EO9H 1FV1A 4X8JA 4BDVB 4LHUG 4E41A 1YG9A 4WY7H 2VM9A 1QEWB 4AGOA 2X7LA 2J5LC 1AZNA 1LE5B 15C8L 1FYTA 1PFCA 4YFDB 4F7CA 2WYTA 1F2XK 5DD6A 2R0ZL 5LCVH 4XVTL 2VW7A 4R7XA 1E4JA 2ZXDA 5CJOH 1KIRB 3QZWA 2KLSA 1YNKL 4C4KT 1M7UA 3CQPA 3BKCH 3V5KB 3ERXA 3TZVA 5FO8B 2J8HA 1DYZA 2KERA 4JLRB 2XLLA 5KYWB 3FCSA 1EEYA 2ZXCA 3QWNA 4HZ1A 2IAMC 2OL3L 2OKMA 4IRZA 3T2NH 4AMWA 2NZ9D 4R4FL 4TF4A 3KVQA 1Q9OB 1Y1UA 3CH1B 5ABAA 4OD1L 4KXCA 5E95B 4MWFB 3P0VH 3ATAA 3BPNC 1HEZA 1DBAH 4U49A 4YDKL 2AQNA 5PCYA 4J4PA 1OWRM 4FQJL 5AYQA 4Z0BH 4DKEL 1PSKL 3ZZ1A 4NFCA 5SWSE 2R0LL 1T89C 4LPWA 3L17A 3W9EA 2HCZX 4IGBB 1AD9A 1T0NB 3LX9A 5CKGA 4ZS7H 3LRSB 3FO9A 4R97B 2G3NA 3DRQB 3PUCA 5C09E 3UYPB 4FNLH 1I9RH 2HFGH 1T1WB 3RTQB 3F04A 3V0VB 4I5BB 3FQUA 1CGSH 4MVBD 4E41E 1WCBB 4UQAA 2XVGA 1QR1B 3T65B 3HE7A 1LP9B 3GXUB 4P2QA 1GYUA 1FYTE 2WLHA 4HWBA 2Y9RT 1Q4NX 1AGCB 2QKSA 3MRLB 4ZMYA 1MFDH 3QDGA 3NPZB 4G42A 2FATH 3NFPB 3RB7A 5JXAH 2H0EA 2IPTH 3SZ6A 1E4XL 1AMXA 3N5AA 5B38G 1OAKH 4Z7NE 3CSYB 4G7VL 5A2BA 3DSNA 1BXAA 3GRGA 3D2UA 2XZCH 2OXGB 1FGNL 2X2UA 4F9PA 2GC4C 4PJ5B 1OV8A 4MB5A 5JHLH 1KXTB 4EI5B 2VN5A 4GRWE 3KEHA 2LW3A 5B1JA 5HI3C 5T3XL 2N7AA 2AQ1A 4IU2A 4NQDD 3FS9A 3VFUA 2GEQA 4NCC1 5EO1A 4HLEA 1YNTB 3BP6A 4XODA 4LNRA 4OZGA 3AVEA 2WVVA 1XMEB 1NCOA 2IAND 2XV0A 3TYGL 1E5ZA 4N2NA 3FN9A 4GY4A 5L4MA 2J43A 5AVSB 2BZCA 1ETZA 3TFKC 3VB8A 4H0IA 4XO3A 5D7EA 4L1BA 2P9RA 1QNZL 1HKFA 4HIJA 1ET7A 3ZKMD 2GK0B 3BUQA 1HH9B 4JQVA 4FFZA 4JFPB 4X99A 3EYUH 5CEXA 3IGFA 3FO2B 2WQSA 3BLPX 5A43C 3DOHA 4P2QE 4JRXA 3ASNB 4B5EA 4M62L 4YHKH 3BP4A 4B3EA 5HHXL 4PP1D 2C1PA 1KLUB 4FFWC 5E9DE 4UOZA 2RJMA 1YNTF 2AVGA 2NYZA 1PVHA 3WIAA 4TSBL 4NS0A 3EYOA 4OV5A 4NQSB 1J10A 3V0GA 4AIZA 4K73A 4P23B 5IM7B 2VZSA 1TNMA 3JV6A 2ESVD 3VVVA 5E4OA 4W9HC 3E9TA 1E9QB 2CD0A 2YUWA 4RCAA 3QNXB 1RJCA 3HFFA 5I15H 1BG9A 1AC6A 1QSFE 2VQUA 1VZGA 5AVWB 1BWWA 1RURL 3H8NA 2Q10A 4A7QA 1GZPB 1ZANH 1W0VA 3MLUH 3PE9A 2XN9E 2ZCLH 1WGOA 4OZGE 2L7JA 3AC0A 4AQ8C 4IGBC 5EBLA 4K23L 3EFDH 5C08A 3QJXA 4H2AA 2XKNB 4R97C 3MRDA 2BDNL 3UAFA 3CLFL 2WWKO 3U2IA 1HKLL 1YQVH 1KIUB 2ZQKA 4HT1L 3RTQC 2YEVB 5AL0A 1URZA 3FU7A 4U6HA 3H3PH 3QWRD 4L3EB 3ZT5A 4PJDA 3NJKA 3U0TA 3NK4A 2BJMH 4HKXA 2YAQA 4QRUA 1BM3H 3II1A 4JRXE 4G3YL 2VUYA 4RIRB 5DC9B 3ZU8A 1DQDH 4Y19A 3RDJA 1U8HA 4PMFA 3RIAK 35C8H 2R15A 1JGDB 1MJ7L 3F7VA 3K5RA 4HX1A 3TNNB 3HCVA 4PSPA 1ZVSB 2NZIA 4A67A 1T83C 4XN5A 2Z9TA 4M61B 1NL0H 4Z7QB 4XMUA 5HGAB 1BYNA 4HUUB 1BWMA 2I5YL 4PVMA 4KZEH 4E9LA 4E9SA 4MA3B 2XICA 2W94A 3L95B 5I5IA 1O7DE 4S1RL 1S9WB 2X2HA 1KBWA 5J1TC 2VSMB 1XXDC 5HHMB 2NXZD 4AK2A 3RZWA 2QVKA 4QUOA 1MCWM 3VRJA 3RUGB 1QLEL 1RSYA 1Z9LA 3VWKA 4YAQA 4ADIA 1DQML 3O3AA 3U9PL 1WA0X 4P2AA 5A7BA 2VWEE 4Z7QF 5BZDA 2R69L 2HFTA 2XQ0A 5C08E 3ARTA 2GCYB 3KVDD 2E3VA 4AUJA 3MV9B 4P04A 3LHPL 1OSPL 3L7FB 4MJ5B 1WV7T 3RE0A 1K8IA 2R1YA 3PWJA 4PJDE 2CBPA 2EXYD 4JFDA 5FB8A 5HPMA 1C08A 5T1KB 1ZT4B 3FHAA 3FT3A 4PB9H 2D31B 4JFFD 2APBA 5IWLC 4FABL 1S9XA 1SNRA 4Q6IA 3RUGF 1WCQA 3KLAA 3IM1A 2VN3A 4DW2H 2AXWA 4WI3A 1DBBH 3UBXG 1KGCD 5FYKD 4Y16D 2PYEE 1RZQA 2RD0A 4P23C 2IGTA 4X6CB 5EPMA 5IESH 4W9DC 1MFUA 2WXIA 1KLGB 2HJKA 3H7BA 2EO7A 4ZAKA 5IB5A 4TRPL 3MRIB 1NCDL 1EQWA 3FHQA 4HJGB 2ZWSA 3Q8FA 4Z77B 1EMTH 1F02I 1AGBB 1JOIA 2IH1A 2R9HD 1G5AA 1MHCB 2LVEA 4OZHB 1IGJB 2QVMA 4N90D 1EEQA 4IRZL 2MPAL 2R4SH 4XN9A 4DO6A 2H1PH 2A9DA 1P9MA 5FOBA 1I75A 4APQC 3O81A 4HKZB 4ZYKB 4WFFE 4X6CF 5FKPA 3KLHC 4DVRL 3KPLB 1F90L 3SDDB 1KTLB 3K6SA 1G7PB 1UH4A 1J0YA 3MXVH 1JFHA 3PQYE 4XCYA 1CIDA 1NZRA 4FNRA 3C6EA 3IGUA 1SPDA 1U8JA 1AQDB 2APXA 1T66C 4JFDE 4L4TA 3U46A 2CDFA 2ZX9A 3V0AC 1MCOL 4IBZA 1RUKL 5KJ4A 3ZN6A 1SOQA 1J9CT 3AS1A 4OZHF 4R4BA 5DK2A 5MI0B 3GYRA 2OCCB 4XB7A 4NENB 3GMMA 1JZIA 4P2OB 5EC2B 1L7IH 4Z78A 3ZSTA 1JZJA 3AG4B 3EJTA 5CBEB 5TGBA 2P43B 5EZIH 2GJZB 2X2JA 1U8NB 3REVB 5ETUB 1RZKC 4HWBL 5GRUH 1MXGA 3ZDYE 2B20A 1RU9L 4TNVK 1OAXH 2AV7A 3SDAB 3T0WA 3UOAB 3VQLA 1XSOA 3BD4A 2QFRA 1BVZA 1D9KB 3LKPA 3FU8A 2ZJSL 4I0PB 3MGTB 4OLZH 2ENYA 3BN9C 2BOLA 4YBHA 2VOTA 2VISA 3HPJB 1OTSC 1FHNA 5IR1A 4XX5A 2J1KA 5JW3L 2RCSL 3AREA 4R3SA 2L04A 4M4RA 5T5NF 5I76B 4LSSH 2GBTA 3T08A 3BFQG 3MSPA 3LD8B 1TOXA 4W9KC 4WW1B 2HWZL 2FNWA 3H1ZA 3KBPA 1DSFL 1S7XA 2WZPD 2WHVA 2AJZB 5DHVB 2ZUWA 4L4TE 3RPIB 3HI6L 1TTCA 3ZE1E 1JERA 4WEBH 5H8DA 4RRPM 2FZ3B 1J5OH 1DBKL 5B8CA 4FFZL 1QW9A 4YEFA 3EJSA 5JIMA 2XPYA 2G4GA 4MLIA 1L9TA 1FVCA 1HXKA 3NA9H 1HHKB 1SVZA 4APXA 3KNBA 3HS0B 1BJ8A 2DQCL 5E1HB 3WY3A 3SQRA 2ZXAA 4WF7A 3MLPA 3OKMB 2AI0H 2DMGA 1V55B 2EACA 1LM8V 4MAZA 5EU5A 3ULUC 1INQB 1KJMA 1QRNA 4NQCA 3OXRA 1NCJA 4S11A 3VAEA 4DP8X 3D85A 2CGRL 5K9JL 1YMME 2XWTA 4O4YH 4NPYA 4N8UA 1D5ZA 5IFHL 3K2UL 3KPSB 4X6FB 1PS3A 1UASA 2UZPA 1G9ML 4XWOC 4JVPA 2VLRE 3T04D 3VGAB 2FR4B 4HAGA 3KCWA 2F53A 1BBJA 3L3JA 1IGFL 1MFCL 1TUPA 1OB1B 3P1VA 3PAYA 4HPYL 1GTNA 3O11A 1FFPB 3HMXA 4X50A 5AVZB 2ZONA 4X2UA 1H15B 5ICZB 3H7LA 2LHAA 2X88A 2Q9OA 5DJDB 5MI0C 1T3FB 2IG2L 2J6EL 3SGDI 1OEZW 4XO9A 4P2OC 4OI9A 3WFHB 5C6TL 4JHBA 1UA3A 1NCHA 2PW1B 4HEPG 1J8HA 4JVWA 4NQUA 2CK0L 3VA6A 2Y07L 2UWEA 2EZ0C 5H94B 5KN5A 3D69A 4Q58C 3U36B 2ZXGA 4QRSB 5D7IF 5A2CA 3Q06A 5E8PB 3SDAC 5LGYA 5KEZA 3QXDA 1CLOH 1EVUA 1RUPH 1XH0A 3N1PC 4BKLB 4WSJA 1D9KC 4QRPD 5EO9B 2EDKA 3CFMA 4QRRA 1XB8A 3FTWA 4I0PC 4V2BA 1QRNE 3OZLA 2JELH 1C5DB 4WUUB 3UTSA 4LSVL 2NOYA 3LB6C 3GMNA 4ZSOE 2DWDB 5LHDA 4JQIA 4XN1A 3QUMA 4P2RD 3VDBA 1Q1JH 2WLIB 1WZKA 2EDOA 3FB8A 4PWJA 1IU1A 2QZ5A 4ZW6A 1GR7A 1M9WA 1RUML 3O3DB 3SBWA 4ZTPL 1ZAGA 3LD8C 3UEZA 3IMTA 4PJ8B 3WTSA 1G7IB 4QHLA 4ABWA 1YEKH 1ZHNA 5I5MA 3MRGB 2AJSH 1RPQA 5IQMA 4PJFA 1QABA 3DMMA 1E30A 2ZWZA 3RIFK 4FZ8L 3BRFA 4WK4B 1KY6A 3K80A 2N0MA 4PEEA 4FKHA 4PREB 4PRDB 3DJRA 5TFSH 4BJLA 2WO2B 3L2NA 5A7EA 1J8HE 3NBNA 2PYFA 3KGSA 1JF5A 5AAWA 3UJIL 2R1WA 5EU6A 4HF5H 5J6GA 5I8EB 2ODIA 1FBIH 4HJ1A 3V4VB 2WGNB 4LSQH 4QWWC 2W60B 3UPCA 3IFOB 1A14H 2EEBA 3UADA 4CRPA 3BFOA 2E7HA 2EINB 2R56L 2CKNA 3APMA 2Z31D 3U30B 1IM3D 4OGXH 1YUKB 2O5ZH 4N2HA 3U25A 3FPXA 1DLHB 2BK8A 5E5MB 4ZOBA 3KYKH 3EOTH 4JDEA 1B0IA 3FT1A 2BP8B 5IHLB 1IC7L 1UZ6F 2OQJB 3C12A 1FE8H 4IRJD 1JPEA 5FHAL 3O9WB 3RAJH 4H13C 3WGUB 1UKSA 5DHMC 1OZUA 4DTGL 4DN4L 1JK8A 3FQNB 1K85A 1EAPA 4M8VA 5CCGE 3VGAC 2F1EA 5I75B 3B9KB 2JFCA 5T1LB 3RP1A 3VWJD 3FRPG 5IOPB 4XNAA 1AIZA 2QMJA 1I9EA 3GQFA 1FSKB 2I07A 4XHJC 1B3IA 1TQTA 3KPPA 2Z65C 3PPEA 4DZBB 1ZV5A 5HGGS 1T7YA 4GW5B 1QX1A 3ZKXB 1NMBH 1KWKA 3EOBB 2R23B 2CO1A 5C3IA 2RQ8A 3VH8A 1CXIA 1ICTA 1NLBL 3FFCE 4JHWL 2YFNA 3ROLA 4KRLB 4EN2A 4KQ4L 1ETA1 3K71A 3F6JA 3WN5C 2X28A 1D3CA 2VC2B 1SUJA 5J6SA 3KLQA 5GZND 3J07A 5TK4A 4P8QA 3U48A 4DGUA 3OF6A 4PR5A 1G7HA 7FABL 1H8OA 3S88L 1JBJA 3AS2A 3F01A 1EHAA 5JO5B 2O5YL 1YNLH 4P06A 4WEMB 5DUJA 1F5WA 4CN4A 3K91A 3BZEB 4KV5E 5CZKA 1IBYA 1OIOA 2VLJB 5AVQB 2BNRB 4KVCL 1UOLA 4IRSD 5GQBA 2W65A 3QWOB 1Y6KR 5DQDL 3OJ2C 3IJHA 3TO4B 2QLVB 4ZJ9A 5DS8B 2YN3A 3CGTA 1KJVA 3CVDA 4TVUA 5C0DA 3RURA 3WJLC 4PJ8C 2CU9A 1RJZA 3MTRA 2XFXA 1A6AA 2EH7H 4N8VA 1P7QB 3X1FA 1U3HD 2AAVA 4JX0A 4XO5A 3ZOAA 4K4KA 4TLUA 2ADGA 1KYUA 2XQBH 4KO6A 5DZVA 5H2BB 4ZZFA 3C6LA 5EA0L 1KTCA 2W0FA 5EUOB 1D7BA 1R75A 1ZK5A 3PS6A 1WA1X 1CGVA 3QXTA 4I4WA 4OQTH 4X9IA 5IROA 1GKOA 4DP5X 4HLZG 2NUPA 1KG0B 5DJYB 3LIZH 4BZ2L 4F3FA 5IJBC 3C6SB 3FO1B 2AMGA 4F20A 2HT3C 5T1DL 5KBDA 1NUDA 3QCTL 4YHPA 3QDMD 2DI9A 1QPKA 3JWOH 4GSQA 4RGND 4LPVA 2C9SA 2ZWKA 3D9AL 3C5SA 3NJMA 2XY2A 4R4FH 4YMPA 4BFJA 2CM6A 3MLTB 4KVNL 4H20H 3UP6A 2IAAC 4OD1H 3EJZC 5EO0B 3U30C 2F54E 3B3BA 5GPRA 3PAZA 1IFGA 1TETH 4FQJH 4HJUA 2VN7A 5KYUB 1PSKH 5BV7H 4JCMA 1W9XA 3SGKC 4LVNB 1RY7B 5I6MA 2ICEB 3O9WC 3MFGB 3NJNA 4ODXB 3ZHLA 4JN2A 3T8VA 5GRWA 1S3RA 4I13B 1TYJA 2COVD 4GXUM 1G1CA 5KUKA 3CSTA 3B9KC 4ZDHB 1Z5LB 5I75C 3K3QA 4XN7A 2E7LA 2RR3A 5EUKB 2VL4A 2VH5L 3K46A 1FSKC 1PZUB 5C07A 3UPRA 2TSBA 1A1NA 4XNQB 4ZOAA 4F33B 3OLIA 5IT2L 2YSSB 4FQXA 2DYSB 5MEND 3B83A 4GB9A 1OZTG 1CDCA 2TAAA 3H2QA 4F7MA 4NT6A 3MOBH 1QSEB 5EF3A 4AH2B 4MD4B 2P8MB 5LGJB 3O6KH 4N3TA 4ALAC 1RZFL 2DBLL 3JT2A 2QLYA 2NX5A 1AY1H 2DW5A 4G6KL 4W4NA 3UCQA 4DWHA 4NEHB 5MEPB 1KNOB 1I7ZA 4KDVA 4OLWH 4XOEA 1P69B 2IAMD 1CFMA 1JFQL 1RIHL 2ICWJ 1EAOA 3QPKA 2ETWA 5T1MB 1JWUA 3NZHH 3BISA 3VXMD 3K8KA 3K72B 1PKQE 4N1EA 5T3XH 3IKCB 1MAML 3NRQA 3CFEB 1TZHA 3W1ZA 2Q20A 4CU7A 2VSCA 5FAAA 3OMIB 3SIKA 5IJKA 2Q1EA 4ADJA 1ADQH 4E9QA 3JXAA 1DEEA 4PCTA 3V0IA 3ARDC 4JQIL 3QUML 4Z23A 1UXLA 3B9EA 3E38A 3SOBL 5M7QA 1S5IL 4HIXL 4XBPB 6TAAA 3DO7A 1XF4B 4B9KC 5F93C 3Q13A 5KSAA 2FYVA 2HLFC 1NEZB 2MCG1 1HINL 1MQ8A 2YD8A 5D1QB 4X9GA 1KTRL 3WE1A 2GBVA 5HYJA 3IMUA 4XMLH 1OSEA 1CXLA 3MRQA 2NY1B 4TSBH 4Y4HA 3QJQB 1JGIA 1P5UA 3UO8B 2Z7UA 2OMYB 1TQSA 4FQ1H 1M6UA 1FCCA 2NX5E 3EDKA 1AP2B 4IBLT 3NCYS 4KJYB 1MLCA 3UH8A 4KRNA 4LIQH 1F1DA 1MRDL 4F7PB 1UOWA 1S7SA 4BFIA 1JXJA 1G0XA 3X1GA 1CICA 4AIOA 5AVTB 2IBZX 1M05B 1BVNP 5C9KA 2CDGA 2K1MA 2Q3AA 2QKIB 1HE8A 3BO8A 3PV6A 3VCLB 1X9LA 2X44D 3IMVA 1E6JL 3D51A 1ZVHA 1ITCA 3BYYA 4HKJA 5HI3D 4Y9CA 1PY4A 5FWRA 2P8PB 2FEEL 1ZKAA 1EVTC 4K3EH 5F3HB 3TONA 4OT1L 3O4OC 5A6MA 2VDMH 4NN7B 3O0RH 1GOFA 5K9OA 1MI5E 4TOYH 4H88H 1T1YB 4LVNC 1WD9A 3ZK0A 2ICEC 5IQ9B 1EFQA 4ZFOB 2CHDA 2DJMA 2I9LB 3TFKD 2OMXA 1J8RA 5HGBA 5AUMB 4JW3A 2JNZA 2K7PA 3WD5H 3ESUF 2A2QT 4OIIL 2IQ9H 3F65A 2BSRA 1XFPA 3FAXA 3WKPA 5INDA 4YSSA 2OX5A 1BX2A 1IE4A 1RZ8A 3EDFA 3FC8A 4G3YH 3JVGA 1NCAH 3POCA 4WJ5A 3KJ4B 4HP5A 4D0BA 3I9AA 3RWHA 3MV7B 2NY4B 3CUPB 2VAAB 4LESA 1CU4L 1K4CB 4KGJA 3RNKB 5E2VL 2ZSVB 1G9NH 3W11D 1QFWI 3VW3L 1RPKA 1W0WB 3M17B 4GFXA 1YRKA 2Q7YB 3SPJA 3PWPB 4WSGA 4BINA 1HZHL 2K3TA 4EUPB 3C9NB 4OKVA 4ODVH 3Q43A 3TXAA 1LEGB 4S1RH 5ALBH 3ZIMA 1LO4L 1HNGA 1EDHA 4HS8H 3KW7A 5C0EA 5IB2A 2MNUA 1UH3A 1AZBA 3QDJA 4NWTL 4U33A 1JGLL 4TNWK 4OGZA 1DQMH 3V55A 4PJCE 1J0HA 3GHBH 5HGHA 4DETA 1IBFA 4IGBD 4JRYA 3CFNA 4ONFH 3OMNB 4PTUA 3LHPH 1OSPH 1ZXQA 5E8NA 3STZB 3NSJA 1ZT7A 4HIEB 4JS7A 3RTQD 1FNEA 3C60A 3F58L 3VG9B 3WUWA 1E3FA 1EX0A 3CNKA 1GC1L 4MNHB 2VR5A 1BF2A 3ML8A 4ZW5A 5D1QC 4CN1A 3TCLA 3DBXB 3ROOB 4FABH 3JVFC 2DWEA 5IZ7A 3ARFA 3ZLQC 1HVXA 1SJHA 4WW2A 4GQ9L 4XP1L 4Q14A 4PBXA 4MXQC 1CLCA 2XG4B 1WIUA 1LEKB 3ILEA 3SO3B 2Y6SC 3LXCA 4XVJH 1CTMA 4RMWA 4PJ5D 3NIFB 4X80L 4PJ7B 4XT1C 5DJXA 2WXMA 4FX5A 4MJIB 3FTZA 2L8AA 1RZGA 4G8IA 5IF0B 3ZQ9A 4LHJB 1ZA6B 1Q1PA 2CM5A 2YKLH 3B3IB 3RWIA 1E8WA 4NN7C 1YAZA 4A2HA 3VSUA 2GSIB 4GRWH 1MREL 5AW4B 4RX4A 2V6HA 2VQ4A 4LSRL 1FNSH 4F57L 1IBGL 3LH2L 2FBRA 1N67A 4J5VA 5DQJB 2BIIA 4NKIH 1I7UA 4KAQH 3NIFF 4PJ7F 3IETA 4GAGL 1L6PA 4RMUA 1E4XI 2M8XA 4JKPH 4IEFB 5J9PA 3WXWL 2DKUA 4I8DA 5D70L 4JR9H 3SY0A 3U4EA 1CD1B 5IEKA 4OCYH 4AQOA 4DK3A 3DK2A 1R34A 2IV8A 2NY4C 3DXAA 3QUKB 1M2VA 2OTWA 4JPVH 3EBHA 3CXDH 1MRFL 3L3IB 3MKGA 5E5UB 2HX7A 1C8PA 4YIQA 3WENA 3U2JA 3LNGA 4GKNB 4AQAA 3KH4A 1UWEL 4Z7IA 1OP5H 2W88A 5EU4B 1DSWA 4PI0A 2ZJSH 3IEAA 5F7MC 4HJEA 3B9VA 2C26A 2W9EH 4YXLL 4CGUB 4DPCX 2CR3A 4XZUA 1S7TA 2FGWL 2XTJB 3FBQA 3M07A 3CWGA 2CWRA 1SLXA 2RCSH 3INOA 5FYJD 1IKFH 5GISL 4APQD 3VQMA 4Y8DC 3GSUA 4G9FB 1U95A 2FQEA 3KLHD 3F83A 2OW6A 4BSVA 3PHOB 1Q9KA 2JK5B 4L3AA 1YO4A 3FO0L 1CI5A 3GMRA 4P5TA 3SE6A 4PG9B 5ABZA 4OI7A 4LLYB 4DO5A 3VG9C 2V2XA 4L3ED 1G43A 5DUPH 6PCYA 4OV6F 1FFNB 1T66D 5BS0B 3VXOA 3WHE1 4JGNA 4HS3A 4B96A 3UC2A 1ZHLA 2FEDC 5TH2B 1DQQB 1F4WH 3CDYA 3M1BA 3TBSB 5JIKA 3C5ZB 1QTSA 1BAFL 1A47A 2NNCA 3MRJB 3NCWA 3C5JA 2OMWB 5AOLA 3MCLL 5E6IB 2HMIC 1RMFL 4L8DA 4WUKH 5DSCB 3RQ3A 2QJDA 2H2PC 1J1OL 4RSVA 1DQJA 3VI3A 4GMSL 2ADIA 4ZFZB 4QHMA 2H41A 4CVXB 1CD8A 5GGSY 1OCCB 3C8KB 3MLXL 2NNAA 3EYVB 3LQZB 3QIWB 3QUZA 3OD3A 4IIQB 3RX8A 1PG7X 3AQZA 5F97E 2CHZA 5C0BB 3OB8A 1PZDA 2ZUXA 3BN9D 4PFEA 5K9JH 3VE0B 4GSRA 5FFOA 1NFKA 3SCMD 1X4YA 3QUXD 3SGEI 1OTSD 5CBAB 5GJSH 3GSXB 2P24A 4F80A 1XR9A 2NQDA 4OFKA 2A6JB 5ELIA 5SV3A 1IBHA 5B21A 1G9MH 1UWFA 1I85C 2YBGA 1HEHC 4U31A 3E1F1 1KBKA 2EUXA 2FE0A 1MCPH 1G7QB 3Q1EA 4S1QL 4Z7VB 2BNUB 5AW7B 5K39A 4K7FA 4N9OB 3KDMA 1SYVA 3T0EC 3K6FA 2HLAB 5BO1L 3F6IA 3WIHA 2Z91A 2XACC 4A37A 2J6EH 4XMKL 4BYHA 1XZWA 1KGWA 3RBGA 5HJ3B 5C6TH 4OVUA 4XMPH 2CHNA 1GYAA 2R2BA 5TQ0H 1M7IB 4AEIH 2EYRB 1NAMH 4UNVA 2OR9H 4RGMB 1IB5A 4GW4A 2VDRB 2R29H 3BMWA 2D7PA 2F74A 1B6DA 1Z9PA 2A1WL 1OQXA 1JWMB 3GHEH 3TYFA 4E9VA 2Z93A 3HOGA 5A6IA 4KK6C 3DUSB 3DX9B 3G08A 1UG9A 3GXDA 1JPTH 1INEL 4QKXB 4JEGB 4Z7VF 5JPNA 4MMXB 3NAAL 4GLRI 4FNTA 3ULUD 2WXRA 2HRGA 5HYSB 4AV5A 2NT0A 3EFFA 3A47A 3EO1A 3LAFA 1OHQA 3NABL 2G3ZA 2XTJC 1BJMA 2FX7L 3JWNG 3QJTB 2QQKL 4UV4L 5I0XA 3CZGA 5I6PA 3CXFA 4MMYB 1QA9B 1T03L 3IWVA 4GAYA 3TJEL 4ZMPA 1CZ8L 4PJAB 5IVXA 3SOTA 3ZKQD 3EG9A 2H0JA 3T0XA 4I9WE 4PGDB 3ZX1A 3QRGL 1SDAB 4TNGA 4XWOD 4XPGH 4NRYB 1VB9A 3X14A 4PJIA 3SE4C 2MIZA 4G6FB 2VXQL 3T9WA 2AEWA 2MCPH 3MAWA 3UMNA 1FZKA 5DMYA 3FB6A 3MREA 5JOPD 3OKKB 4NJ9H 4FZ8H 3V7AG 1QQDA 1LK2B 3APCA 5AYTA 2OZNA 4YSEA 3CXHJ 4NXSA 1ZVNA 3JUYA 4HJ0C 2R0WH 3OKDA 4B9GA 5FPIA 4P2OD 3C5ZC 1HDMB 3BZFB 3G5YB 4GKSA 4C4BA 2WKGA 2DM4A 1OK0A 5E6IC 3GNML 1N3NB 3UJIH 2WBJA 1MVUB 5SV4A 5E00B 2EZ0D 3JTBA 4O2EA 2X1XR 1MCHA 3UX9B 3ZPDA 4TTDC 4NC1E 3SDAD 4C56E 4J8RA 1I3RB 1JF6A 1PQZB 3DPDA 1ZY9A 1AOZA 1M56B 4KMLB 3THMH 2KZBA 4IIQC 3HNSH 4FHJA 4I0PD 3MRCA 2XZQL 2JJUA 1E9PA 2VE6A 1MFEL 1JNNH 3BP5A 1A1OA 4AYBA 5EEWA 3LB6D 4E5XA 2DWXA 5PAZA 3NH7H 3CE1A 3O6LL 2W9DL 1RIUL 2VRAA 3QG7H 4ZQKB 5IKCB 1DLFH 2UZXA 3X1EA 1A6VH 1AKJD 4OJAA 5ANHA 3AU1B 4FMKA 3U7YL 4G6AD 4AGPA 3BGAA 5IVXE 4ZFGL 1IILE 3F84A 4DTGH 1JGEB 4DESA 4PJIE 1N26A 4I48B 2G5BA 2E9JA 3GXPA 3ILPB 5LDSA 3KGUA 3VXUD 3RWDB 1SQ2N 3I75A 4Q89A 5TF1H 4Z8FH 4AVJA 3VQ2C 3H9SA 4FAAB 2VDNH 3KPOA 1SJEB 1ZSDA 4X4YA 5GS2D 1MHEA 4MX7B 1P2CB 1IGYA 1BZEA 2J1WA 3L3HA 4ODBD 3HG4A 5F71A 2XWBB 1NLBH 2AEQL 3DJ9A 4RGMC 5I8CA 4PJHB 3VXNA 2FBJL 1N5YH 3ULVF 1EFXD 1Q9LB 4YHMH 3NUKA 1QLEB 4ZBJA 1K6QL 4MKMA 4HUKB 5L0QC 2CHXA 3OX8B 2E8ZA 1E3ZA 3CN1A 4FLRA 4QWWD 3RIAF 4MMXC 2MJWA 4N2IA 4XPAH 1MWOA 2WSDA 1KB9J 2DQUL 4G8FA 1BVOA 1Z3GH 5CIPB 3NN8A 3DROB 1PG7L 4WJG3 1RUAH 3D3VB 1ZGLB 2C4XA 4MD5A 3P30H 3FNKA 4PJHF 1W72A 4X4ZA 3DX6B 1H6UA 1XHHA 2YGPA 2LT9A 1FV1B 3HKFA 4FI7A 2DTML 4AE0A 4E41B 5CCKL 1KV3A 4PJXF 2X7LB 1VRSA 4F7CB 5TE4L 3KWTA 1CF1A 4KTYA 5KUMA 3GUTA 5DD6B 1OTTC 4L1DA 4MJHA 5JHMA 4UCFA 5BZWA 4XHJD 1EEUA 1KMGA 1E5UI 3QZWB 3RGBA 3VXSE 1UD4A 4BE6A 4LQFL 2X6VA 1GAFH 4YLBA 4LSPL 3SE9L 4PHXA 3TZVB 2P52A 4I0CC 2K45A 2O6EA 2Z7WA 3UTQA 4BZ2H 1A1MB 2ZCZA 4Z7NB 1MY7A 1L4IA 1EEYB 1NGPH 5T1DH 4BK5A 1OHZA 1JL8A 5F0PB 3BDYH 2FTAA 4X8CA 1JZ6A 3CN2A 2W95A 4WI5A 5F7NC 1A5FL 1YVLA 3CV5A 3LQAH 4GPVA 5KJ7E 3VI4A 4KVNH 1HEZB 2MEJB 3PG2A 1PBYA 3WE6A 1EHLL 3US1A 4GW1B 3UTPE 2GIXA 2IPUG 4WUUD 3BRDA 1E27A 4IKNA 1PU0A 1C7SA 5JIQA 3CMGA 2ISDA 3BC9A 3W9EB 1SXAA 4QOKD 1AD9B 1YPZA 3FO9B 1JHKH 3AACA 3TIEA 1X4XA 2J5WA 3MBEA 4Q9QH 4P9ML 3RL1A 4UT9A 5T8IA 1BLIA 2X1PA 3QISA 3ULVC 3IRPX 1TZAA 3FQUB 4PJ8D 1HWGB 1FZOA 3H53A 3HE7B 2VH5H 3LMJL 2BO0A 3ZZSA 4N8CH 4P2QB 4FGMA 2R1XA 5I1JL 3BGFB 2C3XA 2HJLA 5BRZD 1KIPA 1GS8A 3U1SH 1PAZA 3QDGB 4G42B 4K94L 3EGSA 4Z7UA 1FNAA 3MCKA 5DVLA 1T1ZA 3DOSA 3WHE0 2DBLH 2ZXBA 2BRQA 1NGZA 4LARL 2VKWA 3DSNB 2HT3D 4G6KH 5CZRA 3D2UB 1T7XA 3UROR 3WIHL 1B0RA 1JNLH 5EF1A 1MY5A 2MPVA 4YZFE 4MS8C 5TQ2H 1H5BA 3HW7A 2JI3A 2DQJH 4IU2B 4WI7A 3VI4E 3FUKA 4JKLA 1S9VB 1X3DA 5EO1B 3EJZD 3UP1A 3BP6B 2C34A 4PY8J 1KFAL 5DRXB 3TLRA 5ALCL 4LNRB 4OZGB 4HKBB 1GCYA 1RCYA 2WVTA 3CX5J 3IB4A 4QHUA 2EUVA 1ETZB 3RVVC 3U2SB 3FRUA 4HAKA 5HVHB 3O9WD 3ZYJA 5K59E 3RY6A 2Y7QB 1AI1H 4FA7B 5T33L 1CVSC 2X09A 1ESOA 2JKRM 3EIFA 2ZKXA 3WKNA 1E4WL 4OZ4A 1HTYA 4X99B 3B9KD 5CEXB 5T1LD 2Z6FA 3FT2A 4FQCL 1SOXA 2QDVA 2C1PB 3VD2A 2R2EB 4AQEA 4XCEA 1QEXA 1ZE3H 2VDOL 1QLFA 3QIBB 1VIWA 2K9FB 2B15A 3FUMA 2J1ZA 4MTMA 3EYOB 4Z7UE 4OV5B 3ECUA 3MRRB 3TZVC 4AIZB 5DFTA 1FDLH 1U30A 1IC5L 3JV6B 2P5PA 4YSOA 2IANE 1A7PL 5F6HI 2WLJA 1LO5B 2CGZA 3PWLA 2Y1VA 2DF3A 2O5XL 1R17A 4MQTB 4O51A 5F7WC 3DBSA 3FONA 1W0VB 3V7AE 1TZ8A 2AK4D 3E8VA 4J4PC 3HBZA 3L54A 5IFAH 3OC8A 3BT0A 3DGCR 3A67H 4XNUL 1GA2A 1QYGL 2LVCA 2VLJD 4OT1H 1H19A 2CKBA 4GBXA 2FH6A 4P57A 5C08B 3TCXA 3W56A 3IGKA 1USQA 2NMSA 2IDQA 4LKXA 3MRDB 2LFEA 1QBBA 4FJZA 2WW8A 3FU7B 4U6HB 3ARDD 4PJDB 3U0TB 4F7KA 4HKXB 3HE7C 5JW4Q 4QRUB 1XF3B 1XVSA 3S5LB 3BGFC 3HAEG 4JO1H 3H55A 4Y19B 2DM2A 1U8HB 1RULL 2HLFD 1CO1A 3F7VB 2FHFA 2X38A 4HX1B 2W38A 1MWAA 3HCVB 4N25A 1MNUL 4KUZL 4IBVA 1UQSA 3OKNA 2HKHL 3KJ6L 2AK1L 3GD1C 5DJ6A 3ZDXB 3WKML 4GG6B 1CTOA 1X5LA 4PSRA 4HSQA 4G8AC 4JM2B 3WNMA 4F9PC 4YSQA 3VW3H 3L3OA 4ZG1A 2HN7B 4UQEA 1EZSA 2QBWA 2JF1A 3MCYA 5B1JC 3P02A 1HZHH 4FHBD 1MHHA 4KC3B 4YGVA 1CF8L 4OFYA 4P05A 4G7YH 1JMXA 1R0AL 4ZMVA 1KCWA 3CQFA 4XNXL 3DNKA 1LO4H 1WAAF 4O58L 5IFJA 3VRJB 2AERT 1CBJA 2F08A 4YAQB 3VWKB 4ESKA 5H37G 4MNQA 3O3AB 4HJSA 3I3BA 1U9KA 5BZDB 2ATAA 4M6AA 3ZDXF 1KELL 4LO9A 5HVHC 5G4NA 5IMKA 4GG6F 4TSAH 4WI2A 3CZJA 4I87A 5FA3A 5LO7A 4JM2F 3MA7A 1K8IB 2R1YB 4JQVC 3O2DH 2VLKA 4JFDB 5CAYB 5FB8B 5DRWA 1C08B 5HPMB 2BY2A 1XTLA 2ZOLA 4G11A 4OM1L 3FT3B 1MXDA 3SEPA 3T8XA 1W72L 1I8MA 3K6OA 2VDQL 1LTXA 1S9XB 4J3UA 1G6RH 2RA1A 2Y6TE 3KLAB 4Q6IB 4UIMA 4C4UA 3OC5A 1Z66A 2PPDA 1Z2KA 2CQVA 5AB2A 4B6ZA 4H2CA 3BFWA 5EPMB 4ENED 2ENSA 4EE2A 5L2KA 4N0CC 4XP1H 4D8OA 2PXYA 1XBRA 2HJKB 1ZDQA 4FN0A 4FMFA 5DD0L 1JYWA 2P7TA 4JL2A 4ZAKB 1XR8A 2DYPB 5IB5B 3RPKA 3NDZE 5JQIB 4XCNA 1O7DC 4GFTB 4AENA 2XQYA 4Y0GA 5KVMC 3TH2T 2JKJA 3LRMA 2IH1B 3UG3A 3B2DC 4L2YA 3WNNA 4G7SB 3S35X 2CO4A 5FOBB 4XHQA 1W15A 4MNQE 3NIGB 1HQRA 4JFFE 4X4MA 5FKPB 1MREH 1PX8A 4AZ8B 1JXKA 3K6SB 1EXUA 3LN4A 4M5YH 1A4AA 5J56B 5FYKE 3FTGA 2OMUB 1WVZA 1U8JB 1U2CA 3ZKNC 4LQ1A 3FMGL 3N2JA 4L4TB 3R0MA 1GIGH 5GSVA 2CDFB 2YSTA 4N68A 5D7LD 3U46B 1YEJH 3V4LA 3I6LE 3ZE1B 1TZIA 2Y1YA 4DGVL 4OCMC 4R4BB 3VMNA 5D70H 3HUJA 3GMMB 4UT9L 3WY4A 5D1QD 1J0ZA 2I85A 5C7XL 4FZEL 2H26A 4Z78B 3T1WA 4U3SA 2J2ZA 4H1LA 3NIGF 2QTVA 5TGBB 2HVJA 1FG2A 1GYWA 1OPOA 4M48H 3S4SA 3UZQA 4X7CC 5EORH 4IK6A 3UPAA 5EC1B 4P4KD 4EXPX 5L2KE 5L7XH 2GITA 1T0MA 2AV7B 1PCXA 4ZFFA 4EQ3A 1A9BA 4UU9A 1F1AA 4MXQD 4HOXA 4WFED 3LKPB 5HHOA 2Y6SD 4WKZA 4YDIL 5AAPA 4L4JA 4WTZG 3ZE1F 3UGXA 4HOMA 4B50A 5B38A 3QRFM 9PCYA 4HJIA 2DZEA 3KYOA 3FUNA 1J87A 4KFMA 1RFDL 3N41B 1YAIA 1KCBA 2VISB 3ABMB 3HBQA 3RL2A 3VWKC 2GY7B 3AREB 1QBML 3BE1L 4R3SB 2FWOA 4M4RB 2CUHA 3LZQA 3QO0A 5HGDA 2L7QA 5GISH 5E8DH 3ZZLA 1XB6A 3FBKA 1S7XB 2RGSA 5CLXA 3MLZL 3HB3B 4GQRA 3FO0H 2G3XA 5GS1A 4NFDA 1OP5K 1I8UA 3MJ9H 3N41F 2QGEA 2BNQD 4NM8L 4RZCB 5B22A 3HUJE 3IYLW 4Q6IC 5B8CB 4U1IA 3VXPA 1MFAL 3ZT7A 4FJ6A 4DZ8A 5C7ZA 1FVCB 3QI9A 1RJYA 4M6OH 3MV7D 5CLTA 5GRJH 2WTPA 4M3KB 2NY4D 1E90A 2AQSA 5IW1B 2QVIA 4JKMA 3KNBB 3ZMEA 1ZSHA 4ZUSB 3MCLH 4ERSH 1XH1A 4Y4FD 1C16B 3C08L 1J1OH 4ZAKC 2EO1A 1EAQA 4OZFG 5HHOE 2X70B 3SO5A 2Q5BA 2ZE0A 5EU5B 3LNFA 4W6XB 4JPKH 1KJMB 1QRNB 2OSWA 3WNOA 2KBGA 4NQCB 4F2FA 5DHEA 3OXRB 1J1PL 3NFSH 2Y2WA 3D85B 1FNGA 2P45B 3SN6N 2XWTB 5FUZL 4NPYB 3QEQA 1D5ZB 1P9MC 1I1RA 4KX9A 1N6VA 3MRHA 5I6KA 3HFML 1Q9WA 1CUOA 3UIYA 4PTTA 5JOEA 5EZLA 4XMTA 2X1OA 5KOVC 3VYNA 1NMAL 1NEPA 3PDOA 2YD0A 4LCCA 3UABA 4O2FB 4F7EA 2F53B 2ORBL 1BBJB 1AHMA 1JTPA 2CKBL 2JXMA 3O11B 4YVUA 3DJZA 1AVAA 3IDNA 3REWB 1O6TA 5L4IA 4N28A 1MDAA 4GI6A 4OJFL 4O9HL 2GFBB 1X6LA 2TRYA 3Q2VA 2VN4A 1HS6A 2AP2A 1BW8A 2ZYIA 4GUPA 1ZLSL 2CA4A 2XVKA 4BWTA 3TEWA 1UURA 1YMHA 3QK0A 1J8HB 4U1NA 1KGXA 4OD3L 3T6WA 2UWEB 4LAQL 2YEZA 5KN5B 3D69B 1OSZA 1GPOL 1F3JA 2HMID 3WS3B 3QXDB 3CZNA 1J86A 1QP1A 2H2PD 2GW5A 4HK3N 4QRRB 2DLEA 3COOA 1INEH 4UYPA 1FA4A 4G6ML 3UTSB 5A2JH 4X9BA 1NMCB 4MHHG 2X2YA 2Y7OA 1JPSH 1DP0A 3ATBA 1L9QA 3UAEA 3QUMB 1A65A 5JW4R 3F6LA 3FB8B 3L48A 2XIIA 1IVTA 4WRLA 3OKEA 1RZ7H 3AREC 4F8NA 2ZKHL 2DIEA 2MCMA 4GKZA 2UWEF 3S35L 3ESNA 4JFED 4OF6A 3DX7A 4UI2A 3MRFA 3IRCA 1H8SA 5GSRA 4DP1X 1DSYA 3CFTA 1SHSA 4HLZH 1PLGH 4QHLB 3RLSA 4QPEA 2NDGA 2PP8A 3ECWA 4PJFB 3DMMB 1BEYH 2NY6B 2VXQH 2G2RB 1BIIA 3L13A 2YQGA 4QRPE 3UMTA 3T0ED 1JVOA 4L9LA 1AO7A 5B8CC 4XNYH 3IMWA 3MR9A 3QZMA 3GSNH 3LVEA 5CGBA 4EDWH 5EDXA 4OCXL 2PYFB 4CW1A 3IXTA 5DJ8B 5AZ2H 1R3LA 2R1WB 3S5ZA 1EGJA 5EU6B 5J6GB 3GNMH 1E6OL 3FHEA 1DQTA 5ESAA 3UBXA 3T0DA 3MLWH 4L4VA 2Y2TA 1AOHA 1VGKA 4GXVL 1XBDA 2B2XL 2CJ3A 4KK6D 4PJFF 1NLDL 3L9RA 3S6CA 1CL7L 3UO1H 5LBGA 3ZE0E 2OFQA 2XZQH 4MJJA 3S36H 5ADPH 1RHHA 1V8HA 3TURA 4JDEB 5E5LA 3BKYH 3D0VA 4OM0L 1H3UA 1EUUA 3PLYA 4F2MB 2XTJD 2ZOWA 5E2WH 4WVRA 1WEJL 1X5GA 2GYSA 2QL1A 4WSKA 4EZKA 1FZJA 3ARXA 1FLRL 1AXTH 2VUKA 4PB0L 1YY9C 1JK8B 1EAPB 2D4FA 4YE4L 4TKWA 5EOCJ 4P59L 5TD4A 2HTLC 4P3WA 4U1SB 2NQ3A 5C0RH 3ARGA 4HFUL 2I07B 4JPWH 4P0DA 3T3PB 1GGIL 3P54A 3KPPB 3LRHA 5BS0D 2KLTA 2E4FA 1Y6MR 1DHKA 3VD3A 5I1IH 3E8UL 1FUNA 1TXKA 1YCSA 5F8QC 5IEHA 2BM3A 5F9AC 3VH8B 4HJ0D 4QGYA 4ETQA 1ND0B 4LSTL 3C5ZD 3PDGA 1YEEL 4FMVA 3T2OA 3Q6FA 2AEQH 5FO7A 3ROLB 2F15A 4FXKA 2FBJH 5E6ID 1QASA 5GGVL 5GHWH 2DRUA 1DJWA 1T2QL 3V6FA 5LBVA 1SBSL 2QSTA 4L4VE 4WFGE 1TDQA 4TTDD 2IEPA 2V5TA 3PP3H 5D7SL 4DP2X 4PGCA 1G7HB 4PR5B 3T3PF 4ELMA 3LNDA 1FP5A 1NMCC 3L2MA 5KSVB 5E2UH 1P4LA 2O4EA 3L1FA 2CIKB 5IMOA 2W65B 3T4YA 3SBWC 4KZDL 2YOAA 3IJHB 1ZA3B 4L1TA 1KJVB 4AJYV 5C0DB 1V3JA 3RI5K 3K1KC 3MI6A 1RJZB 3HG0A 3TGXA 3U9UA 2XFXB 4Z6AT 2DTMH 2YEQA 2AZAA 5CCKH 4N8VB 1NBVL 1XT5A 4YDJA 1EBPA 2ADGB 2IH3A 3DMMC 2NY6C 4IS6B 3C6LB 4K55A 4X4XA 2FECL 2UY7A 4OLXL 2W0FB 3TVMD 4I4WB 2X4UA 3Q2LA 1ZTXE 3PWVA 2NUPB 4HEME 5FF6A 2IOMA 4JG1H 3WEXA 3RNQA 4PRBA 4JN1L 3ZL1A 3SE9H 4UTBH 5SWZD 4JZOA 5HPOA 1XCXA 5DD1H 5AAWC 2DQEH 4YBLC 5T3XD 1ZLUH 3WXVH 1NUNB 3OB0H 4LSUL 1QHPA 2AS5M 4HPHA 4FFTA 2KPWA 2VDPB 3TU6A 4XE5B 3BCDA 4WENB 1MFVA 1EHXA 1GXEA 3C5SB 4B7IA 3ZGHA 2C9AA 1G1OA 1EJ8A 2BERA 1CBVH 3K0WA 3FH7A 2XVLA 2MQ0A 1NA8A 2WLMA 4TQ8A 4N2LA 1K8DA 4XVOA 4ELME 1U8MA 1UZ8A 4F24A 1R3IH 3VRLE 4JRWA 4PJ6A 3G9VA 2CR6A 2V3FA 1SN5A 1TVHB 5DVPA 5ANMA 3LYRA 1QVOB 5DDHA 1BIHA 3NSCA 3KEDA 5D7JA 3P3UA 4JGMA 3I74A 1KB5H 5EU3A 4EN3A 1AE6H 3V9CA 5F7FA 5FCSH 5HI4D 5BNXD 1INDH 4JN2B 4HAFA 4Z0XB 1E2WA 3GXTA 2P5WA 5D2NE 2JWYA 3RGVA 2LLGA 5FFGA 1KGYE 3QA3A 5E0QA 4NIYE 5C07B 2P26A 3QDME 3UPRB 2WXLA 1A1NB 4JFSA 1QSVA 3Q2NA 2FLBT 4RGNE 4YDNA 5DFVC 5IJVB 4QY8A 1OTTD 2VUOA 4LLVB 5DWPA 4H0GA 5D7KD 4F7MB 4NT6B 4NYLA 4K94H 2NNFA 5F9OL 1FO0A 3T0VA 4CBPA 1MJJA 4H25A 3KAAA 3UZVA 4XPFL 1Q0YL 2NX5B 3IDGA 4E9WA 4FYSA 1JIBA 2FL5A 1MZYA 1I7ZB 1MG3C 4MNGA 4RFOH 5EBWA 5A2FA 5D1ZB 4YX2H 1PW3A 4RRPA 2ZUYA 2A4CA 1O6SA 3EDDA 4GXFA 4LOVA 4XC1L 1N7MH 4R84A 4QXUH 4JHVA 1AHKA 2NTSP 4YOKA 4EOWH 1TZHB 2ZWNA 1KFAH 3V52L 3WEBA 2X1WL 1DEEB 1GC1C 2F68X 3QNFA 2P5WE 3NQIA 4H7VA 2YK1H 5TDOA 5D1XA 1E3XA 2UX6A 3AY4A 2IOIA 3SYQA 1KIQB 3WJMA 1ULVA 3PFUA 4UANA 5I1EL 5HDOA 5KSAB 1BAWA 4XC3H 3C6LC 2KDYA 3S37H 3VJ6A 4C4KO 1JN6B 5KW9L 5L9DH 1NKOA 2ARJQ 2V3DA 4H5SB 5IROC 2GUYA 2VDOH 5HYJB 3VXME 5K9QI 1JV2A 3MRQB 5FO2A 4Y4HB 5CJBA 1TTFA 5KBPA 1FL3A 3BSHA 3EH2A 1UWGH 2IWGA 4JKWA 4Y5XA 1FNLA 3AQYA 3UZEA 1U92A 2X4SA 2FB4H 4LDLB 5J1AA 1JPGB 4AM0A 5FDWA 1MLCB 4DPAX 1S7SB 4BFIB 4MNGE 1TG8A 1WSST 2YGOA 4E42B 3W38A 1UKTA 2CDGB 3BH8A 3HRZA 3PV6B 4MS8D 5E94A 4PCYA 4QXTA 2Q87A 4HKJB 2G0LA 3P73A 1EGJL 1BVLA 4HGKC 5D4HA 2WKLA 1Z7JA 4KHTL 5BPPA 3OAWA 5K9OB 5EFIB 2Z7YA 3UBFA 1TQCB 3MBWB 4FC3E 5ENWA 4AEFA 5SWSD 2E59A 5GGTH 4LPXA 1VACA 3D3VD 1F11A 3RVVD 1BVNT 1W2KT 2OMXB 1PF3A 4PHZA 5HGBB 4J3SA 1N2RA 2WXKA 3P0GB 2E7LC 2VZ3A 4TNFA 3IAGC 4PGBA 1S5HA 2BSRB 2CJUL 5FKAA 1JE6A 3RTLA 4E41D 5INDB 5KYWA 3CVIH 2OX5B 2DWSA 3H2WA 4CJ1A 1BX2B 1RZ8B 2E7DA 1Q38A 4FQXC 1FYTD 4HQQH 1C12B 2GJRA 5JYMA 4DKFL 4NZDA 4D0BB 2FIKB 4DQAA 3RWHB 2RALA 5B1AB 1CXEA 2UXGA 1UM6H 4HHAA 3UTTE 3CVBA 3NRFA 3KJ6H 2BSBA 4NPKA 3TZVD 3CHSA 3QO1B 3R7RA 2IPKA 4I3RH 3CK0L 2WXFA 3WNKA 2KZWA 1ZTXL 3QEGL 1T0NA 3WEAA 3M7OA 4L3CA 4BXSV 3TBYA 1VZHA 4XBEL 4KROB 1L9OA 3IGAA 3LS5H 4OKVB 3KPMB 3FU9A 4RGOL 2IH8A 3V0VA 5JDJA 4NQEA 3WEMA 1ES0B 1FF5A 3F7QA 2DMHA 1OSYA 4KTDL 4O58H 1UD2A 4J4PD 1ID2A 3QDJB 2PWEA 4ODHL 1RLBA 5H35A 5DLML 3T3MB 4FNSA 5HGHB 1AGCA 4JRYB 4FS0A 1NFDA 2O61A 1MVFA 2YAMA 5T5FH 1KELH 3G3LA 2GIYA 2XETA 1VADA 5ESQB 5DYOB 2D0GA 4PTUB 3PABA 5CD5C 1BA9A 3PHQB 1ZT7B 3NCCB 1FNEB 1PD0A 2CK2A 3C60B 3OJDA 3TASA 3WUWB 4PWIA 1U8KA 4R26H 3ISRA 2XZAH 1J1XL 3HE7D 5KSAC 4P2QD 2FO1A 4NZUL 5DI8A 4PG2A 1ECYA 4LRIA 5KSUA 1F6AA 1IC4H 3RA7L 3TCLB 5CSGA 2BY3A 4K8RL 3WCYA 2VDLB 4CU6A 4EI5A 5LWYL 2DWEB 1L9SA 4Y4HC 3QDGD 4DN3L 3ARFB 1P5UC 3LEXB 3T3MF 5I18H 4K7PH 1FPTL 1WP6A 1QWUA 4J6IA 1SJHB 3QJFB 4WW2B 2E6PA 2FH8A 5J4MA 4G82A 4AYFB 1B2WL 4OF7A 3D2UD 5DRNB 1U4EA 4ZMOA 1CICC 4O02L 1OARH 3DA0A 4TXVB 4OF8A 4BM7A 3GDBA 3FN3A 5F7YC 4H8WL 5DJXB 3BVDB 3ZYIA 1UGNA 4ZD3H 2WM0A 4LCWA 2MTAA 3FOMB 2Y7NA 3B2XA 1RZGB 1HH9A 4G8IB 2RMNA 2EIJB 3LKOA 3RWIB 3FO2A 2XN9D 2QPFA 4NHCL 4LNVA 1TQCC 3VG0L 5I28A 1OPGL 2OR7A 1KEGL 4B41A 4WW2F 1KLUA 1VCAA 5B39A 5JUEH 2WZ6A 4A2LA 3I9GH 4Q2ZB 4X8XA 5L4FA 3OMAB 1UT1A 1I7UB 1AR2A 2GI7A 2I69A 4YSPA 4PRIA 3UIZA 3A5VA 2LU3A 2I9TA 1QBLH 4QTHA 4JRXD 4RESB 2ZXWB 3JVGC 3ZUNC 5E6SB 3QNXA 5C0AB 1A9VA 2IXQA 3MLSL 3U4EB 4U3HA 5IEKB 5KJRH 3D50A 3IFNL 3BAJA 5C7XH 1CC3A 2G5RA 4FZEH 4QF1A 3DXAB 1M2VB 4FFVC 4KKRA 3W0WA 5BOJA 2OTWB 1HXMA 2YO3A 2VCOA 4ZQTA 4YIQB 3KXFA 4K2UH 3MV8A 2QGDA 2VMCA 4N0CD 5KVEE 3ARWA 2D03L 4A55A 3VX0A 1FO0L 2E27L 1PZ5A 4KROC 4KJWC 4U6VH 4LCWE 3KL3A 1Q0XL 4XZUB 1S7TB 1QWHA 5C0CA 1C1EL 4Y2DA 4RMRA 3QHFL 3IDUA 1NCCL 5DHXB 2EECA 3GSUB 2Z92A 5C08D 1JGDA 1R19A 3GO1L 3OKLA 4R5VA 1Q9KB 3MLZH 3GMRB 2AJYL 3C60C 2F6AA 2CXGA 2V2XB 4HUUA 3ZKND 4BFNA 2V2WA 4ADGA 3HTLX 3RVXC 1P4IL 3VXOB 5MEQA 5AWNL 4Z76B 1BJ1J 2YPLB 1ZHLB 3UYRH 2IALA 5EU7E 1YJDH 3RVTC 1ZWIA 2QADB 4ZW7A 3SYCA 1KZYA 1TKWA 1MFAH 2JE8A 3M1BB 3ARFC 3QCVL 1S9WA 2LLNA 3B5TA 2UZIL 4L48A 4GQZA 3SYAA 3C5JB 1Y1DA 4WW2C 5IB3A 3D4GA 1UCBH 4RQQA 3NJGA 2L0DA 2BMKB 3EXJA 1JWSA 4J39A 1IBZA 3TT1L 3VI3B 3C08H 3MZTA 1SN0A 2ADIB 4NNYA 2WLKA 4QHMB 4KKPA 2J1XA 5D6CA 1ANUA 3FN0L 2NNAB 2BCKA 3QUZB 3IMSA 4I18A 3OWEA 2YUZA 2A83A 3MV9A 1TSRA 32C2A 3RY4A 3TFBA 4L3EE 5D55A 1SDYA 5FUZH 3LJ3A 2J8OA 2RTTA 5ITFA 4ZT1A 2P24B 2PO6A 3APDA 2JB5H 4NHUA 2ADJA 5C1MB 1XR9B 2EE2A 4WFFD 3W39B 5ID0A 2VR9A 2NW2A 1TJIH 2MH4A 3HIZA 3MROA 3VI3F 4MCZA 3GI8H 4MA7H 2ORBH 3TBWB 2OM5A 3N04A 4Z7QE 3BUBA 4JO3H 3HZYB 3NJXA 4JFDD 5K39B 1W8EA 4K7FB 2P80A 1SYVB 3KDMB 5I0DA 1NEUA 2BXZA 4I88A 1EWHA 2A74A 3QPXL 2F5AL 4OJFH 3EJPA 5EF2A 3MRIA 5BV7B 12E8L 2Y7LA 1D6VH 1KB5A 1DR9A 3PGFH 1ZLSH 4HS6A 4UT7L 2JKIS 4ACPA 1YECL 5HHME 3T6XA 2XBDA 4WI9A 4OD3H 1TQUA 1IGJA 4GW4B 2VJXA 5DK2B 4QRTA 2F74B 3ESOA 2C9VA 3RUGE 3TYFB 1XSJA 2YA0A 2AJUH 2Z93B 4LCIL 3HZVA 4N86A 3G08B 4ZYKA 1FC1A 3GLZA 3U6XA 3P2TA 2ADYA 2Q76B 1CLZL 4LGRB 3QCUL 4S0SD 3FTUA 3SDDA 2NRDA 5DJ2A 3X13A 4PLKC 3IFLH 3MV9E 4G6MH 3QJOA 2QHRH 3QRBA 5CINH 3EFFB 3EO1B 5F44A 3MA9L 2UXVA 3Q8CA 2V9UA 3BYTA 3NACL 43CAA 4K9EL 3WNJA 2C5DC 1L6XA 2XPGA 2VXUL 2AXGA 5FLVA 2ZKHH 1VPOL 4JG0H 4K3DL 2YPVH 4GAYB 5F7DA 3V6BR 1OF2A 3OZKA 4QDGA 1MUJA 3NTCL 3EG9B 4WTWA 2WD0A 4H8VA 1FFRA 1WISA 2K6WA 3AUVA 4P5TC 4PJIB 1II4E 3X14B 1U8NA 1PEWA 1GYCA 4J6RL 4X6CE 4XAKE 1FZKB 2QMKA 3FB6B 1V10A 1OM9A 4L4TD 4NO0A 3EZJB 3MREB 2XV3A 5EDSA 1A0QL 3R7QA 3HLAA 1SQMA 2YD3A 3PGDA 1D9KA 1MDTA 1QQDB 2J57A 5FYKH 2QADC 5F9DC 2NXYC 1Q72H 3TJHD 5B1BB 5BCAA 1OE3A 3OKDB 3WTWA 1RUQH 1XSIA 3MX0A 1AMYA 2B59A 4GKSB 3V10A 1AKPA 2VZ1A 5IV2A 4OZHE 1CT8A 2DQ6A 3CSPA 3LKNA 4YPJA 2WBJB 3DGDA 4AZUA 3HPJA 1UH2A 2AEPL 5FHBH 3MRNA 1E6OH 4PJIF 4FD0A 4J8RB 4M8QB 2OK0H 2CUMA 4KXBA 3WTXA 3RYMA 1FWXA 4GXVH 2IOOA 4YBQC 3QUZC 3JWDC 3MRCB 2VE6B 1E9PB 2TRHA 1CL7H 2Q3ZA 2JCCF 3AROA 5KVEL 3BP5B 1TLMA 4JCWA 4NC2B 1D6EA 4G6JL 3UG4A 2AJZA 1SF3A 4E5XB 1G9EA 2ZICA 2AGJL 4R83A 3WUZA 5KAQG 4F58H 3RPIA 4OM0H 5JOPE 5GIRA 3T2PA 1KUMA 4XCFL 3ARED 3W82A 2ICES 1F3DH 2FZ3A 4A2MA 1A8JH 2HRPL 2ZP9A 4N26A 4AXWA 5L8KB 1A6WH 2OP4H 3WKQA 2H6OA 3JWOC 1S3KH 5JMOC 1NCWL 3GSVA 3KMDA 3EBIA 1A3QA 2G5BB 4PWFA 4PJEB 3HS0A 1BFOA 5B4MD 4PM1A 5DUBA 1UXSB 1GGIH 5JOFB 3I75B 3EDEA 5BRPA 2NSMA 3HNTL 3QS2A 3H9SB 4LU5L 1T4WA 2VDMB 3DI2B 1ZSDB 4X4YB 1I9JH 1GGBH 1IGYB 3L3HB 4HA1A 1E5CA 1A6TB 2ZWYA 3DIFA 1LO2L 3SY6A 1MIML 1YEEH 5I8CB 3VXNB 1DUZA 3QAQA 3O3UN 4PRHA 2OJZH 1DO5A 4PJEF 4P4RA 5BZZA 5JQHC 1G84A 5IQOA 5JPNC 4YQXL 1F1GA 2JLLA 1N64L 1QRND 2FR4A 5D7IA 4M1CC 1GZQA 2NSQA 2H8PB 2YJLA 4G8FB 1FG9C 1N0XL 2Y72A 3D85D 1OB1A 3NN8B 1IX2A 2CA3A 4HD5A 1KSRA 4EF3A 2Z64C 1JRHH 4KZDH 1Y0LA 2DQIH 2QSCH 4MD5B 3LZFL 1T3FA 3V6ZB 3AJ7A 1W72B 2A99A 2K7QA 3ARBA 4L8SB 3TO2A 4FG0A 2WJ5A 2VDQB 3D48R 1YY9D 3LEVH 5I5JA 1SMAA 4B9CA 1QFHA 1GZHA 3BPOB 5KBLA 2DICA 2F53D 3N1MC 3QDHA 3GUTB 2HTLD 5H94A 2NYKA 1A2YB 1SJXA 3PP3K 2ED6A 2A77H 4PRPA 2D7QA 1F3RB 2XU9A 4BKLA 1RZIA 4AC4A 5EO9A 4NSKA 4FNQA 2VB5A 4LL1A 3UTQB 3RZCD 1XL4A 3VFNA 5IQ7L 2DWDA 1J8HD 2WBJC 2C3WA 4V33A 3IDXH 3MTXA 2OTUB 3KPSE 4CADA 3O3DA 5AOIA 5ITBH 2NY0D 1QI5A 1YEIH 1NDTA 3LRKA 4D2NA 2F19H 4JY5L 4QRRD 3VI4B 4B0MB 2OYMA 5BZXA 3WE6B 3RX5A 1KWGA 3I6GA 5D7IE 3ZTCC 2WZAA 1QATA 1YUHA 3UTSD 2V5MA 1P1ZA 4XB3A 5EOCL 5AYUL 2AABH 5F7HA 3ZDZB 3AT8A 4OTXL 1YPZB 4QTFA 3BVXA 3HAEH 3TIEB 4JE4B 4MRBA 4JAMB 1G4RA 4I77H 4WHTA 1E2VA 1KJ2H 1ZLUK 3EO0A 3OB0K 4CUCA 1BXVA 3FOLA 1HNYA 5C86A 3BUIA 1FZOB 2XTLA 3OR7A 1XGRA 2HJLB 1KIPB 3DMMD 4PRPE 2LGNA 4PWEA 4OCRL 4GUCA 1Q94A 2BWQA 3EGSB 2ZOKA 3DX4A 4Z7UB 1AGFA 5EN2A 4TVPE 3ZDZF 1WAEA 1YPZF 2BSTA 2X4TA 1KN2H 3MCKB 5FUOH 1T1ZB 3DOSB 2OMVA 2G60L 2DQHH 2IGFH 2UYLA 5K59F 1NGZB 1V7ML 3FFCD 4AV0A 5FW8A 1SN2A 3FTYA 1B0RB 4J3WA 3SKMA 2EAEA 3BSZA 2EVIA 1ZLEA 5H37H 2PWHA 1EDYA 3F7LA 3HMWH 4CSSA 1E42A 3FQNA 5I16B 2DI7A 2VT0A 4GSDH 4YXKL 2OAAA 4OCWL 2I60H 1KEML 5AAMA 5K69A 5CEYA 4Z7UF 1KCKA 2WUBL 4QJ3B 3V52H 1E65A 2OPCA 4QHUB 3U0WL 3FRUB 3BUTA 5SX4I 1YEDA 1JK9A 1D2PA 4PJGA 5I1CL 4GW5A 4Q9BA 2YZ8A 1IBDA 3U79A 5KVFE 3O45A 1G7MA 1VFAA 1HHJB 4OZ4B 1QKZH 4N2FA 4NQDA 1UZ6E 3BPOC 2QPEB 3BPLB 3FT2B 7CGTA 1COBA 1R5VA 5I6OA 4JZNA 2YD1A 4XCEB 2P5EB 4LEOA 1KLFB 3CFQA 5EF0A 3DARA 3CHRA 3ZSSA 3O4LA 2Y5TA 4X8GA 5BVPL 3PU7A 4M00A 5IJKC 3WFBL 1T21A 4Z7WF 1KTDA 3SKJH 3SGJA 5HJGA 4BK5C 2CMRH 2E0PA 3WV0A 5JMRA 2BNRA 5M95B 4JFQA 1R24A 1CB4A 3MJ6A 3QWOA 5EZPA 1NSNL 1IJ9A 2AAAA 3TO4A 4O51B 4AVKA 3FONB 1EUTA 4ZZKA 2IADA 3D52A 4M6MH 2MQCA 3OF6D 5AKRA 3MO1A 2GSMB 4N0UA 4LP8A 3KWUA 1M3IA 4KHTH 5TDNA 3OPUA 2OXHB 2ESVA 1K5WA 3CDCA 2CKBB 4GBXB 4P57B 4EUPG 1DQLL 3X2QB 4E2OA 1JYNA 3TEXA 1MELA 2R2HA 4LKXB 1JI1A 4PJGE 3WKYA 5I8KH 4TTGA 2Y23A 3MBEC 2FSEA 2OBGA 3BCFA 4BGDA 2GY5A 4IBTA 2ITDA 5CGTA 1GJWA 3B2VH 3HRPA 4Q9CA 4NWUL 1CYGA 3TPUA 2B3RA 3PP4H 2QGCA 1UVQA 3C6LD 3ES6A 1MWAB 5TK2A 4LL4A 3MNMA 5IROD 2WQUA 4LLQA 2Y2YA 5C9JA 3O4LE 1KDIA 4JDZA 1UQSB 3OKNB 3P9WB 1OOWA 1N6QH 3H0TB 1WRFA 5DJ6B 5DVNA 4M1GL 2WB1A 5DWUL 2BNRE 5I30H 3GPEA 3FZUC 3O6MH 5CP3H 1PIFA 1ZTXH 3L3OB 2EIBA 1H5BC 4YO0A 1MHHB 4XBEH 4YGVB 1UM5L 3RJOA 1DO6A 5FECB 2HKFL 1MQKH 1Z5LA 4JY4A 2NDFA 5IFJB 4W9IC 5EUKA 4KTDH 4XO8A 4YC2B 2FX9L 4DGIH 5DLMH 1CK0H 1A6UL 3WJJA 2WZ0A 3Q6GL 4IMLA 5IB1A 2DL2A 5IMKB 2V5SA 4NOBA 3RY6C 3VSVA 5I0VA 5FA3B 3E0GA 5JHDB 1NOLA 3AQDA 1OTUC 1I1AD 3GRWA 4FQQA 4IMKA 3MA7B 4LZKA 2CGYA 2VLKB 1BYPA 1NGQH 1RVFL 1RL1A 3WSQH 1CE6A 3IS1X 3KZ8A 5IHUH 2ZOLB 1J1XH 2WKOA 3T8XB 3ECVA 5GRZA 2LV4A 5MEPA 4XX1G 1TTAA 2YR3A 4AYDC 4FQXD 4UIMB 3RA7H 4R8WL 4BWWA 4JVUA 4FI6A 4OZFH 3QT2A 3K72A 3HS9A 4BH8A 5C0JA 3V4PA 4XXWA 4UOJA 5DEJA 2K4WA 3HBPA 5CMAA 3CFCH 4KH9A 2QSQA 3N1FC 4ZFQA 3QUGA 2NX5D 2PXYB 4PV8A 4WGWB 5IGXL 2WWKT 2X5PA 1RZJH 2P7TB 1HJBC 1XR8B 5GJTH 2NY2B 1B4JL 2WLYA 3DIDA 3P9LA 4KZCA 4TVPL 1F58H 4NOFA 4XCNB 1NC4A 4JNXA 4URKA 3U82B 4O02H 1QZNA 4AENB 2YMXH 2AEOA 4J3OC 1GW6A 4TULL 2C9RA 1NM9A 3IJ9A 5BQDA 4XBPA 3FUJA 4NHCH 4HSAC 5EZOH 3VXRA 4GBXC 4IK7A 5BXFA 1NEZA 1IRAY 3DC0A 1A7OH 2EDFA 2C4FT 5FV1L 2HSIA 4TLTA 2JJTC 5A3IC 5D4JA 3LN4B 5ICXA 1R9FA 3FTGB 1OGSA 1QSEE 5IJCC 4KOCA 3WD5L 5BOZG 2D7OA 4HV8B 5CD5D 4PJ9A 3QG6B 5GSVB 1CGYA 1GVIA 5C2BH 2A0LC 2PMZA 5TE6H 4F7PA 5DMIL 4KDWA 3RHWK 3T0BA 2XJKA 5KVFL 3L3DA 2OMNA 3IT8D 1MCCA 1SM3H 1U41A 2H26B 1T04A 3IFNH 2J2ZB 2YXWA 2QKIA 4H1LB 5HYJD 4BV1A 2HVJB 1FG2B 3S4SB 3UZQB 2EILB 3WOVA 4ZX6A 1DL7L 4YEEA 2E6QA 2GITB 1T0MB 2MOGA 3OXSA 4JY6B 2EUZA 4ZFFB 1JGVL 3MQIA 2VO5A 1A9BB 1M6OA 4KQ3L 4UU9B 4W9CC 2XSKA 3BAKA 1T1YA 3L3OC 1E2ZA 5HHOB 1XF2A 2EEDA 4JPIA 4WKZB 4NZFA 4U1MA 2J44A 4A7TA 4BIKA 2G0KA 4HC1A 5B38B 1CICD 1ZJBA 1CLVA 3P2DA 3KYOB 2JKXA 5GGQH 1H3PH 25C8L 1MW1A 4DHLA 1VESA 2FUTA 2XIBA 3JYCA 3ZHDA 1WBYA 3BSZL 5I24A 4Y2OB 3RL2B 3UCRA 1Y07A 3IF1A 2KYIA 1FC2D 1KYFA 2FWOB 4MCMA 1RLWA 3QO0B 1VZIA 4W9ZA 5HGDB 1AQKH 1ZEAH 1MRCL 2D2CC 3QJSB 2H0PA 4KJPD 5C0NC 4FA8A 5GS1B 1QI3A 1R3KA 2ZAIA 2CLVA 2GTZB 4Z7OB 4GP8B 3CCHA 3OAUL 1YN6A 4PGJA 3HN5A 4LCYA 1CYXA 2DH2A 2HA1A 2YBRB 4FP8H 4WFEE 2XN1A 4P5MA 4WV1A 3OKOA 1B90A 2Q7YA 2N1TE 4PS3A 4U1IB 3VXPB 3WBDA 4ZUTA 1TSHA 3PREA 4UNIA 2ZP0T 5HDBB 4DZ8B 3C9NA 4KH2A 3X12A 3QI9B 1RJYB 2HFFA 1P7KA 4FFVD 1X7QA 2PXYC 3BUPA 3O3BA 3TTSA 3VFOA 2C1OA 1KC5L 3C8DA 2DWYA 1Z3RA 3UBXI 4N85A 2NY2C 4RAUA 4JFYA 4Z7OF 4KXDA 3BIAX 4YNYB 1FIGH 4OLYH 2EVHA 2SODB 1EO8L 4PUBL 5D8JL 1ZHBA 2CCLA 3GJFA 3V5HA 1D5BA 1FNGB 4KJWD 4NQXA 1KENH 2JI1A 2J72A 3W3BA 3QEQB 5CS7A 5HDBF 2E86A 3JSSA 1T7WA 3ZGIA 4JM0A 2XX1A 3MRHB 1AGDA 1Q9WB 4JDTL 3QDJD 3BH9A 4BH7B 1P0SE 4PTTB 4X6DB 1MOEA 4UQ3A 4KKAC 4ORZC 5EZLB 3X1NA 2WPGA 3QZBA 2LTQB 5HYSG 3VGEA 3PDOB 2Q8AL 4LCCB 2JIXA 4F7EB 4G59C 4YHZL 4EDXA 2OI9B 1CFQA 3X11A 4BA8A 2JXMB 4JJ5A 4EBQL 4ZPVA 3C60D 3EJYC 3FSAA 1PEZA 1LEKA 3RWCB 3OVUB 4KKBC 1DBMH 3QPXH 2F5AH 3PWPE 4GUPB 3GI9H 4P46A 3RVTD 1A21A 1YMHB 4X6DF 4UT7H 4GKLA 2VJ0A 1MG2C 2EH8H 4U1NB 3IDYB 4ZUUA 2VYRE 2YEZB 5DQ9A 1OSZB 4G8GA 1DANT 5IF0A 1PLAA 3P4OA 4YUEL 4NJAL 1URLA 2XZZA 5I23A 5JPMA 1IAIH 3GK8H 2Z4QA 1D5XA 4E68A 3SKUD 1ET5A 4U4BA 4YDVA 1R6VA 4PS4L 3F85A 2XG5A 5LGKA 5JR1L 2YGNA 5GRVL 2DLIA 4GMTL 3SDXA 4HUVA 3FU3A 5EIQA 3UG5A 4IW4C 1HYSC 3OKEB 3NACH 1W80A 1BAGA 4HWEL 4PLNC 1M1XA 4A39A 4GKZB 2WQVA 4A7VA 5GSRB 3MRFB 2K0RA 4RX4D 2ZNWA 4B0MM 2CLRA 2V5YA 4D3CL 2WXJA 3ZL4H 3NTCH 1F4YL 5KOMC 4UTAH 1HIMH 3AMLA 5GS1C 5DA0B 1MCLA 4HD9A 3L3IA 4F5CA 3AZUA 3QUYD 1ZXKA 4A7UA 1BIIB 1U91A 1R33A 4ONGL 4GKNA 4XXDB 2EADA 4L9LB 4DGYH 5LQBL 1AO7B 5EU4A 3V95A 2G9HA 3NIFE 4PJ7E 2XI9A 2FJHA 3MR9B 1UT2A 3AITA 3QI9C 4H4NA 3K2MC 1LMIA 4UIKH 3DXAD 4ZUVA 3IXTB 4MJIE 1R3LB 3BT2L 2O72A 1DQIA 4G8GE 3B7UX 4JG9A 1OM3H 3D09A 5E7BA 1Z0NA 1GGTA 5ESAB 3JQOB 3UBXB 5BVJB 3NVQA 4FNPA 2FYYA 2VXTL 2VZTA 3AM8A 1U8LA 4Z18A 5D72L 3L9RB 3V4PL 1SEQL 5JHAA 4WDIA 3CDGA 4BZ1A 1RHHB 3CFDA 5LN4A 3HJ0A 5KVEH 3T5WA 4YSCA 5AKVA 2D3VA 5L88L 3L5WA 2HRHA 1CWVA 1FFNA 1CYWA 1VF5C 4Q52A 3X3FH 2A5UA 5DD5L 3EH4B 1T2XA 1HCVA 4N2KA 4U2ZA 5CEZD 1FZJB 1T5KA 4OLVL 4XCFH 1P6FA 2F8IA 1U8PA 2LTQC 4RFEA 3BKJH 4LCCC 1FH5L 3RDTB 3J8F7 4KKZA 2ATKB 3BWSA 5AVYB 3LZOA 3TBSA 4UOW0 3MJ8A 3Q48A 2X4OA 2Z31A 2MNWA 2OI9C 3K81A 3ARGB 5J12B 4NZJA 4P5TD 2OMWA 3V8CA 5K1VA 2VDKB 4F5CE 4I7ZC 3IBOA 4Y9BA 4P99A 1BQSA 3QGVA 3DVIA 3HNTH 5E08L 2AVFA 4S1DC 5E9AA 4Z5RA 4JZJA 4JDVA 3QXVA 3C8KA 4LDCA 5IEHB 2QADD 3QIWA 2NXYD 4X5WB 5C0BA 4ETQB 3UXFA 1QI4A 3IDYC 5B7EA 3DV4B 1LO2H 1XGTA 3Q6FB 5FO7B 3O2VH 4ODUA 4M43H 4UTCA 1WTLA 3CH8A 4FXKB 4MQXC 4HLJA 3QZWG 4M5ZL 3V6FB 5B3SB 5GGSA 1ZV2A 3BAEH 3OPZH 4YHIA 4AT6B 4PGCB 4AG4L 2A6JA 4ELMB 4G9FE 3CN0A 1L7TL 1CR9H 3B1TA 4YBQD 3QUZD 2WN3A 1B4LA 2D3NA 5TF0A 1ORSA 4PVNA 4LGPB 2Q8BL 1OXYA 3QB7C 1LWJA 1JS4A 3DV6B 5FYJH 4ELKB 4N2DA 3I3EA 4LF3B 1MIEL 3T4YB 3DSFH 4FXGA 2H47C 4HC1L 4ZFOL 3ATEA 1QTPA 2FAUA 2JB6A 4QT5B 5F7LB 3WFDL 3MFFA 3CMOH 4CKQA 1UFGA 3PXHA 1HNFA 4OSUL 5HJ3A 5I0WA 4I9WD 4O2CA 1OAZH 1H0DA 4NNPL 1ZOXA 1ZVYA 4YDJB 2VABB 1GGCH 2IH3B 4ELMF 1FORL 3L08A 1O9WA 2V9QA 2P48B 3AGVA 2UY7B 5DHYA 1RK1B 2PNDA 4L9LC 4O5LL 4UZSA 2X4UB 1FL6A 3PWVB 5FF6B 2PPFA 3RNQB 5I2IA 1A66A 5C0BE 1RZKH 4A68A 3AG2B 4JZOB 3V5DA 4AYMC 1RQ5A 2WLNA 5D6DA 5CNHA 4KK9C 3OGOE 3H6JA 1A7RL 3PFQA 5HDQL 3TWCL 2WOYA 4KGLA 3CXHK 3HC3L 3S34L 5IBLC 3J27A 3RWFB 3Q8BA 1K8DB 1U8MB 1UZ8B 4AOFA 6FABH 1WIOA 3BPCA 5ANMB 4B95C 4M1CD 5MERA 5EOCH 5AYUH 5D7JB 1VSCA 5EU3B 4WWKD 3STLA 2OCFD 4Z7VE 1WZMA 4OTXH 3CVHA 2PR9A 3MKKA 1HN1A 4DQOL 3QFJA 3GHPA 2P5WB 1LK2A 3DDGA 4OLEA 1WK0A 3G7TA 2XYCA 3RGVB 1IZJA 2NY5L 3ARGC 3VO0A 1BQRA 4JHAL 1JAEA 5CN1A 1IZKA 2AQTA 3KS0H 4QY8B 3AXLA 2UZYA 2KUTA 3LZRA 5KZCB 1MFBL 4NYLB 1MPAH 3WNIA 3QHZL 4RFNC 1FO0B 1M57B 5GZOA 4AL8C 4H25B 3EJQA 2D9CA 2EEFA 1FQ9C 4A6YA 1AFVL 5DYFA 5L6YL 3IDGB 2G60H 2HZHA 5KYYA 2V0AA 2P28B 1V7MH 3LKQA 4N2GA 2FL5B 4FXKC 1D5IH 4N0YH 5AFAA 2WBJD 4PVLA 2EIZA 2UVFA 4MNGB 4ZQKA 5EBWB 4LLDB 1S7UA 3ULUH 1H3TA 4OFDA 2NPLX 2R59A 1MEXH 1UYWL 1G94A 3AU1A 1JZ5A 5F1KC 2GAZA 2YMOA 5LN8A 1SFDA 2F0CA 3N85L 2GTWA 4YXKH 4M7LL 3VSTA 1JYVA 3RU8L 5I5RA 4XE0A 5KYNA 1OE1A 2WUBH 1ZLWH 1GSMA 3RWDA 5KVGH 1Z1WA 1I7TA 4UM9A 1PX4A 1NGWA 1RP8A 3QFJE 5EIIA 1CXFA 4K8RC 1PDKA 2ZYHA 1KB9K 5D1XB 1DVQA 5DURB 5GGRY 4A7SA 5ILTL 3WJMB 2QTEA 1I1FA 2B1HH 2BVEA 4PJHA 2WYHA 3K2IA 1FRGH 1KXQA 2Y06H 5CUSH 3VJ6B 4KI1A 1JV2B 2DQTH 2IQAB 3Q8AA 4RISH 3H9SD 3DWTA 4PJXA 3VXSD 1F56A 5BVPH 4MZRA 2VO8A 1JHLL 1U92B 4H8WC 4QGTA 3HJEA 3IU4L 5J1AB 4AM0B 4F37F 2VZOA 3GBEA 4K0OA 4XPHL 5FDWB 5K1JA 4K5LA 5DVMA 4N6RB 2NCMA 1OP9A 3NYKA 4F2MA 5IMLA 1GOHA 1KBGL 1DJIA 3BH8B 3HRZB 3I6KB 4LFHD 3GXIA 3CIAA 5E94B 5DS1A 3DX6A 1XAKA 3P73B 1BVLB 3ULVE 3H9HA 4HJJL 1F18A 3IWUA 2FQGA 2ZD0A 2R0KL 3UTPD 2SEBA 2KDGA 2PCYA 5D7JC 1BEXA 5ENWB 4EN3C 3FSWA 1J7VR 3FT0A 1T5XA 1VACB 4KJQC 8CGTA 1F11B 1TCMA 5GXBB 5E24E 4BZ1L 3SE8L 1N2RB 1SXSA 3RGVC 4HBCH 2AJXL 3VFSB 3QXAA 4KKQA 4U1GB 4LEBA 5AEAA 3OG4B 4PGBB 4PV9A 5DHVH 1S5HB 1SFHA 5E6YA 1A1MA 5FKAB 3GZKA 2COQA 4ZMLA 2GJ6A 1CGXA 2BVOB 3CAFA 4PJHE 2CUAA 4OJDH 4FQLH 3KBEA 3ARSA 5GS2H 5M94B 3FRPB 4FQIH 2Z4TA 4PJXE 6CGTA 3S2AA 4HMCA 4KI5F 3FUHA 4HHAB 3A24A 5IBTL 4GW1A 2IPKB 5C0FA 4W9LC 2FVNA 1CN4A 2OTPA 5DWUH 1EJOL 4HCRA 2KLRA 3D3VE 1MCKA 4L3CB 3TBYB 3SQOH 1QO3A 4UB0H 2X4QA 3IGAB 3V4UL 1QFUL 2VMJA 4JJHA 1BD2A 3VNZA 4BBWA 5IMMA 2BPBA 4Y89A 4NQEB 2HKFH 3MU3A 5J3HC 4ODTL 3ZMRA 5BUPA 3TA3A 5H35B 1X5MA 1XF5B 5I1KL 1PLCA 1VKXA 3TNMA 2O61B 1A6UH 1NFDB 5DJCA 2RBLA 2C8NA 2NT1A 3EH3B 2L7EA 2OULB 1VADB 3MBED 3PABB 1A4JA 4N24A