2AY0A

Structure of the lys9met mutant of the e. coli proline utilization a (puta) dna-binding domain.
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
43
structure length
43
Chain Sequence
TTTMGVMLDDATRERIKSAATRIDRTPHWLIKQAIFSYLEQLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the DNA-binding domain of Escherichia coli proline utilization A flavoprotein and analysis of the role of Lys9 in DNA recognition.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Dna binding protein
molecule keywords Bifunctional putA protein
total genus 11
structure length 43
sequence length 43
chains with identical sequence B, C, D, E, F
ec nomenclature ec 1.2.1.88: L-glutamate gamma-semialdehyde dehydrogenase.
pdb deposition date 2005-09-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1220.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant Met repressor-like 2ay0A01
1ARRA 2WVFA 2WVCA 2CAJA 3OD2A 1B28A 1EA4A 3FMTA 2K29A 2BJ8A 2K1OA 3VEAA 2BA3A 1PARA 2HZVA 1MNTA 2BJ1A 1MYLA 4ME7E 3VW4A 2CADA 3H87C 2WVBA 1NLAA 2BNZA 1X93A 2CA9A 2BJ3A 2BSQE 2K5JA 1U9PA 1MYKA 2H1OE 2JXIA 3QOQA 1ARQA 1IRQA 3VEBA 2AY0A 2K9IA 2K6LA 2BJ7A 2WVDA 1B01A 2JXGA 1P94A 4FXEA 1BDVA 2CPGA 2GPEA 2BNWA 2BJ9A 1QTGA 1BDTA 1BAZA 2KELA 2RBFA 2WVEA 2CAXA 3FT7A 3GXQA 4HV0A 1Q5VA 2JXHA 3LGHA 4D8JA 2HZAA
chains in the Genus database with same CATH superfamily
1EA4A 3FMTA 1SH0A 3VEAA 2HZVA 1SIWA 3BSNA 1Q16A 1MYLA 4ME7E 2ADLA 3H87C 1X93A 3G5OA 1MYKA 3QIDA 2AY0A 2K6LA 1BDTA 1BAZA 2JBVA 2Q2KA 2KELA 3NAHA 2CAXA 3UQSA 3UPFA 2A2BA 2CAJA 3OD2A 4QPXA 2K29A 2BJ8A 2K1OA 1PARA 1MNTA 3NNEA 2BJ1A 2WK4A 4NRUA 1SH2A 2AN7A 4AAIA 2BJ3A 1ARQA 1IRQA 3VEBA 2KKEA 2WVDA 4FXEA 1OHNA 3FT7A 4HV0A 2JXHA 4D8JA 1ARRA 2WVFA 3UR0A 1SH3A 3H5XA 2WVBA 3LJPA 2BSQE 3SFGA 2JXIA 4LQ3A 2BJ7A 1B01A 2JXGA 1P94A 1BDVA 4LRVA 4LQ9A 2RBFA 2KOEA 4MJWA 1Q5VA 3LGHA 2UUTA 2HZAA 2WVCA 3SFUA 3NAIA 3H5YA 1B28A 2BA3A 3NO7A 3VW4A 2CADA 4NRTA 1NLAA 1OG7A 2BNZA 2CA9A 2H3AA 2K5JA 1U9PA 2H1OE 3QOQA 2K9IA 2B43A 2CKWA 2CPGA 2GPEA 2UUWA 2BJ9A 1QTGA 2BNWA 2WVEA 3GXQA 3BSOA 4O4RA 3IR7A
chains in the Genus database with same CATH topology
1ARRA 2WVFA 2WVCA 2CAJA 3OD2A 1B28A 1EA4A 3FMTA 2K29A 2BJ8A 2K1OA 3VEAA 2BA3A 1PARA 2HZVA 1MNTA 2BJ1A 1MYLA 4ME7E 3VW4A 2CADA 3H87C 2WVBA 1NLAA 2BNZA 1X93A 2CA9A 2BJ3A 2BSQE 2K5JA 1U9PA 1MYKA 2H1OE 2JXIA 3QOQA 1ARQA 1IRQA 3VEBA 2AY0A 2K9IA 2K6LA 2BJ7A 2WVDA 1B01A 2JXGA 1P94A 4FXEA 1BDVA 2CPGA 2GPEA 2BNWA 2BJ9A 1QTGA 1BDTA 1BAZA 2KELA 2RBFA 2WVEA 2CAXA 3FT7A 3GXQA 4HV0A 1Q5VA 2JXHA 3LGHA 4D8JA 2HZAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ARR A;  2WVF A;  2WVC A;  2CAJ A;  3OD2 A;  1B28 A;  1EA4 A;  3FMT A;  2K29 A;  2BJ8 A;  2K1O A;  3VEA A;  2BA3 A;  1PAR A;  2HZV A;  1MNT A;  2BJ1 A;  1MYL A;  4ME7 E;  3VW4 A;  2CAD A;  3H87 C;  2WVB A;  1NLA A;  2BNZ A;  1X93 A;  2CA9 A;  2BJ3 A;  2BSQ E;  2K5J A;  1U9P A;  1MYK A;  2H1O E;  2JXI A;  3QOQ A;  1ARQ A;  1IRQ A;  3VEB A;  2AY0 A;  2K9I A;  2K6L A;  2BJ7 A;  2WVD A;  1B01 A;  2JXG A;  1P94 A;  4FXE A;  1BDV A;  2CPG A;  2GPE A;  2BNW A;  2BJ9 A;  1QTG A;  1BDT A;  1BAZ A;  2KEL A;  2RBF A;  2WVE A;  2CAX A;  3FT7 A;  3GXQ A;  4HV0 A;  1Q5V A;  2JXH A;  3LGH A;  4D8J A;  2HZA A; 
#chains in the Genus database with same CATH topology
 1EA4 A;  3FMT A;  1SH0 A;  3VEA A;  2HZV A;  1SIW A;  3BSN A;  1Q16 A;  1MYL A;  4ME7 E;  2ADL A;  3H87 C;  1X93 A;  3G5O A;  1MYK A;  3QID A;  2AY0 A;  2K6L A;  1BDT A;  1BAZ A;  2JBV A;  2Q2K A;  2KEL A;  3NAH A;  2CAX A;  3UQS A;  3UPF A;  2A2B A;  2CAJ A;  3OD2 A;  4QPX A;  2K29 A;  2BJ8 A;  2K1O A;  1PAR A;  1MNT A;  3NNE A;  2BJ1 A;  2WK4 A;  4NRU A;  1SH2 A;  2AN7 A;  4AAI A;  2BJ3 A;  1ARQ A;  1IRQ A;  3VEB A;  2KKE A;  2WVD A;  4FXE A;  1OHN A;  3FT7 A;  4HV0 A;  2JXH A;  4D8J A;  1ARR A;  2WVF A;  3UR0 A;  1SH3 A;  3H5X A;  2WVB A;  3LJP A;  2BSQ E;  3SFG A;  2JXI A;  4LQ3 A;  2BJ7 A;  1B01 A;  2JXG A;  1P94 A;  1BDV A;  4LRV A;  4LQ9 A;  2RBF A;  2KOE A;  4MJW A;  1Q5V A;  3LGH A;  2UUT A;  2HZA A;  2WVC A;  3SFU A;  3NAI A;  3H5Y A;  1B28 A;  2BA3 A;  3NO7 A;  3VW4 A;  2CAD A;  4NRT A;  1NLA A;  1OG7 A;  2BNZ A;  2CA9 A;  2H3A A;  2K5J A;  1U9P A;  2H1O E;  3QOQ A;  2K9I A;  2B43 A;  2CKW A;  2CPG A;  2GPE A;  2UUW A;  2BJ9 A;  1QTG A;  2BNW A;  2WVE A;  3GXQ A;  3BSO A;  4O4R A;  3IR7 A; 
#chains in the Genus database with same CATH homology
 1ARR A;  2WVF A;  2WVC A;  2CAJ A;  3OD2 A;  1B28 A;  1EA4 A;  3FMT A;  2K29 A;  2BJ8 A;  2K1O A;  3VEA A;  2BA3 A;  1PAR A;  2HZV A;  1MNT A;  2BJ1 A;  1MYL A;  4ME7 E;  3VW4 A;  2CAD A;  3H87 C;  2WVB A;  1NLA A;  2BNZ A;  1X93 A;  2CA9 A;  2BJ3 A;  2BSQ E;  2K5J A;  1U9P A;  1MYK A;  2H1O E;  2JXI A;  3QOQ A;  1ARQ A;  1IRQ A;  3VEB A;  2AY0 A;  2K9I A;  2K6L A;  2BJ7 A;  2WVD A;  1B01 A;  2JXG A;  1P94 A;  4FXE A;  1BDV A;  2CPG A;  2GPE A;  2BNW A;  2BJ9 A;  1QTG A;  1BDT A;  1BAZ A;  2KEL A;  2RBF A;  2WVE A;  2CAX A;  3FT7 A;  3GXQ A;  4HV0 A;  1Q5V A;  2JXH A;  3LGH A;  4D8J A;  2HZA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...