2AY3A

Aromatic amino acid aminotransferase with 3-(3,4-dimethoxyphenyl)propionic acid
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
394
structure length
394
Chain Sequence
MLGNLKPQAPDKILALMGEFRADPRQGKIDLGVGVYKDATGHTPIMRAVHAAEQRMLETETTKTYAGLSGEPEFQKAMGELILGDGLKSETTATLATVGGTGALRQALELARMANPDLRVFVSDPTWPNHVSIMNFMGLPVQTYRYFDAETRGVDFEGMKADLAAAKKGDMVLLHGCCHNPTGANLTLDQWAEIASILEKTGALPLIDLAYQGFGDGLEEDAAGTRLIASRIPEVLIAASCSKNFGIYRERTGCLLALCADAATRELAQGAMAFLNRQTYSFPPFHGAKIVSTVLTTPELRADWMAELEAVRSGMLRLREQLAGELRDLSGSDRFGFVAEHRGMFSRLGATPEQVKRIKEEFGIYMVGDSRINIAGLNDNTIPILARAIIEVGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AROMATIC AMINO ACID AMINOTRANSFERASE
publication title The active site of Paracoccus denitrificans aromatic amino acid aminotransferase has contrary properties: flexibility and rigidity.
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Aminotransferase
total genus 145
structure length 394
sequence length 394
chains with identical sequence B
ec nomenclature ec 2.6.1.57: Aromatic-amino-acid transaminase.
pdb deposition date 1998-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 2ay3A02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 2ay3A01
4XJOA 1LK9A 2ZJGA 3WX9A 4RJ0A 4LNMA 1EQBA 2CJGA 4JEXA 1AHGA 3I5TA 3GETA 2CINA 1ASCA 4RM1A 3TFTA 3DU4A 2HORA 4ATQA 3EI7A 2V1PA 2BWPA 4LC3A 4MQPA 1JS6A 1MLYA 4JEWA 1Z3ZA 2EO5A 2BYLA 4UHMA 1M0OA 3AEPA 3TATA 4ADCA 1P3WA 4AO4A 1EG5A 1CZEA 1BT4A 2CSTA 1E5FA 1LKCA 1IX8A 1S06A 4F4EA 3FTBA 3GJUA 4LNJA 3E2ZA 2AY4A 1S08A 3ASAA 3FFHA 5EAVA 2VMPA 2JISA 3AEJC 3EI6A 1IUGA 2HZPA 3AEJA 4UHOA 4W1WA 4WLJA 3B1EA 1ARHA 3PAAA 1B9IA 3HQTA 4K2MA 1YNUA 1G4VA 1ASGA 1JF9A 2VMYA 1GC3A 1BJOA 1D7VA 2VGVA 4WYEA 5DB5A 5HHYA 3RQ1A 1LC5A 4WYGA 4EB5A 5EUEA 4JEYA 3BS8A 4WXGA 4EFFA 5DJ9A 2CY8A 4CBSA 3A9YA 4M2MA 4PFFA 1SF2A 2VLFA 3G7QA 3LVJA 4A6UA 5M49A 3K40A 4F5LA 1GEXA 2GSAA 2Z9UA 4K2IA 2HOZA 3NDNA 3CBFA 4ZDPA 1O62A 3NYTA 3RBFA 2ZY4A 2VGUA 3MBBA 2F8JA 1CL2A 1B5OA 1XI9A 3PPLA 1AY5A 1C7OA 4DGTA 5M4BA 4IY7A 2ZY2A 5EIGA 2JJGA 3NTJA 1EJIA 5E4ZA 3QPGA 3NUIA 3ISLA 1MAPA 4GE9A 5DX5A 4Q75A 2ZY5A 3NX3A 4ADDA 4BMKA 8AATA 2CB1A 1SFFA 1CS1A 2W7JA 3JWAA 3BCAA 1ELQA 2BWOA 3GZDC 1YJYA 2CTZA 3GZDA 4GEBA 3VK2A 4Y0IA 1AJSB 2VMTA 3PGYA 5G4JA 3N5MA 1ARTA 2PB2A 2VGSA 3L44A 2W7IA 2C7TA 3FD0A 2ZC0A 4W8IA 3T32A 2X8UA 3AEOA 3ATHA 3GBXA 3LVKA 3N75A 4FL0A 2W7MA 4MSOA 4W5KA 3VAXA 4F5MA 2D66A 3B1DA 4GE7A 1GEWA 2Z9WA 4MGRA 3FDDA 1RVUA 2W7EA 1J04A 2DKJA 1W7LA 2XBNA 3AATA 3B1CA 3HMUA 2W7LA 2C81A 3EI9A 3N0LA 4K2BA 3KGWA 2VGZA 3NU7A 4PFNA 3FFRA 2EH6A 4ZASA 4A0RA 2VMUA 1I43A 1CJ0A 2CH2A 3FDBA 2G6WA 3CQ6A 1Z7DA 1FG3A 4H51A 4ZSYA 2GMUA 2AY1A 3FVXA 4WLHA 4ZWMA 1TATA 2VMSA 2AY8A 4WD2A 4OYTA 3EI8A 3BWNC 2BI2A 3TQXA 5FT5A 2CANA 4JEZA 3WKSA 4E77A 1DFOA 4AO9A 2QLRA 1G7XA 2AEUA 2HOXA 3KE3A 4OBUA 2WK7A 1AHYA 1ASFA 1IAXA 2TPLA 3FQ7A 4CBRA 3FZ7A 1WYVA 4WP0A 2VGTA 3RBLA 4OT8A 1ZODA 1C9CA 2BIGA 2OKKA 4GSAA 1D2FA 1UKJA 1CQ7A 4MKKA 2FNIA 5M46A 4F5FA 5EIGB 1IX7A 4OTLA 3DZZA 5G4IA 2FQ6A 4BA4A 2GB3A 2CFBA 1JG8A 3H7FA 2GMSA 2OQXA 1SZUA 1B9HA 2GQNA 2W7KA 3W1HA 1KKPA 2WKAA 4MQRA 4MKJA 1GDEA 1AHFA 1X0MA 3LG0A 4M2JA 2Q7WA 1TOIA 1AJSA 1OHVA 2FYFA 2JG2A 2E7UA 3DR4A 1LC8A 4XJPA 4B9BA 2BYJA 1WYTA 2E54A 3FZ8A 1OHYA 1IAYA 1YIYA 1T3IA 1W3UA 2NMPA 1QISA 5M4DA 2X3LA 1WSTA 1SPAA 4RLGA 3QM2A 4P3MA 3B46A 2YCNA 1C7GA 1IBJA 3Q8NA 2BI3A 2DGLA 3HT4A 1B4XA 2ZYJA 1YOOA 3II0A 5TF5A 3HVYA 4RJYA 3PIUA 2W8JA 3EZSA 3TFUA 1J32A 1MDZA 2BIAA 2W7FA 3G8MA 4ZM3A 4IW7A 2V0YA 3L8AA 3DC1A 2JJHA 2BIEA 2ZP7A 4NOGA 1AKCA 2YCTA 2YCPA 1IVRA 3LVMA 3VK4A 2AY2A 4ITGA 4ZLVA 1BJWA 1MDXA 4ITXA 1QJ5A 2E7JA 3UE8A 2DGKA 1PFFA 2BWNA 1BQDA 1V2FA 3B8XA 1AMSA 3DRDA 4RIZA 3RI6A 1D7RA 1I48A 4LW2A 2YRIA 3PD6B 4N0BA 3ZRQA 3WY7A 1QJ3A 3MC6A 2PO3A 5G0AA 5J8QA 4O6ZA 1DJ9A 1V72A 3ELPA 3GZCA 4Y0HA 2BKWA 2C44A 3E2YA 1GC2A 3PA9A 2D64A 1M7YA 4JF0A 2CH1A 1WYVB 3FZ6A 3RUYA 4BA5A 5BJ4A 2ZSMA 3JTXA 1TPLA 4J5UA 1DTYA 4IXZA 5JAYA 2OKJA 1Y4IA 1ASEA 1TOGA 2O1BA 5K8BA 2HOYA 3F9TA 2EGYA 3BWOA 3COGA 1ARSA 4A00A 4ZAHA 1X2AA 5D95A 1C0NA 3ZZJA 3WGBA 1AHEA 3NYUA 2Z67A 1OXOA 1B8GA 4IYOB 3R4TA 2Z1YA 2VMZA 1UU1A 1AIBA 5HDMA 4WYFA 1WYTB 4UHNA 1O4SA 1C4KA 5F9SA 2VI8A 2XH1A 3HL2A 3EZ1A 1AIAA 1M6SA 5E5IA 5EUNA 1AICA 4AZKA 5AX8A 2D61A 2X5DA 2BI9A 1VP4A 1S07A 1SVVA 4GDYA 4W91A 2VLHA 3EIBA 3ELEA 1M0NA 4J8LA 1I41A 3GWPA 3EIAA 1N8PA 3KKIA 9AATA 1SZKA 2WK8A 4ZDOA 1DJUA 1MLZA 3QBOA 3OKSA 1DGEA 1YIZA 2QMAA 3HBXA 2Z9XA 1ASBA 2VIAA 4EB7A 4EU1A 3DXVA 3P1TA 3EI5A 3DR7A 3QI6A 4AZJA 4GRXA 7AATA 1RV4A 1ARIA 4PVFA 4RITA 1ORDA 2VYCA 3E9KA 3VP6A 4M2KA 1TOEA 1DJEA 3AOVA 3F6TA 4Y0DA 1TARA 4Q31A 2RFVA 4OCAA 4F5KA 4UOYA 1ASDA 2BHXA 4HF8A 5E3KA 4A0GA 3PD6A 4RKDA 2ZY3A 4XQ2A 3FQAA 3G0TA 3USFA 4PIWA 3A9ZA 3MEBA 4QGRA 3WGCA 2VI9A 2DR1A 5EFSA 2D65A 1UU0A 3LWSA 2ZUKA 4W1XA 5LH9A 3NNKA 1X28A 1ASNA 2JGTA 1AY8A 1QIRA 4LW4A 4R5FA 4DBCA 1AX4A 1M4NA 3FSLA 2FNUA 2R0TA 5C6UA 5IWQA 4JEVA 4ZDLA 4WB0B 1ELUA 1O69A 3W1IA 3H14A 4XAUA 4R2NA 4WYCA 2HUFA 3WZFA 4B98A 2JJFA 1AHXA 1AMRA 1V2EA 4MY5A 4F5IA 4FFCA 1ASAA 2X5FA 2ZSLA 1ASMA 3CQ4A 3IF2A 3K7YA 3NRAA 1W7MA 4IYOA 3UAKA 3DXWA 1KMKA 1PMMA 3AELA 4ADEA 4A0HA 1UU2A 4IXOA 1M0PA 3BB8A 2BI5A 3MAFB 4RKCA 3IHJA 1TOJA 2AATA 1C7NA 1XEYA 3M5UA 2AY9A 1OHWA 1VEFA 3MADA 1IJIA 2PB0A 4EMYA 2VMOA 1BKGA 1GBNA 2D7ZA 2O7CA 2AEVA 4A6RA 3JZLA 1CQ8A 1GC4A 4F5HA 1V2DA 2Z20A 3FVSA 3CQ5A 1GEYA 3TCMA 3MKJA 4JF1A 2QBTA 1FC4A 4CXQA 1DGDA 5DJ1A 5FT4A 1BQAA 2CJDA 4TV7A 3WCOA 1AAWA 3JU7A 4E3QA 1U08A 4R8DA 1KL2A 1MAQA 2AY5A 1E5EA 3FRKA 2HP1A 3PDBB 1B5PA 4XJLA 3HLMA 3AOWA 2D63A 4RAEA 2AY7A 4A0FA 1LW4A 3MC6C 1AY4A 1AJRA 1G7WA 1M0QA 5G2QA 5HXXA 3OP7A 5D5SA 2D5YA 1ECXA 3NUBA 4KYOA 4OC9A 3ZZKA 5BJ3A 3QN6A 1BS0A 3PJ0A 2R2NA 4WB0A 4XK1A 4BHDA 1TOKA 4OMAA 2E7IA 4F5GA 3DYDA 1O61A 4ZM4A 1YAAA 1ZOBA 4U2HA 1RV3A 1RVYA 4IX8A 2QB2A 2O0RA 4XEWA 4U1TA 1GD9A 2W8WA 4ZWVA 2C0RA 2R5CB 3RCHB 3QHXA 1WKGA 1CL1A 2VMWA 3LV2A 4A72A 3WCNA 3QGUA 5G2PA 4LNLA 2Z61A 4BQ0A 2OGAA 2OATA 2YKVA 4IXSA 4KAMA 1LW5A 3AENA 3MAFA 1CQ6A 1N2TA 2VGWA 5F8VA 4ATPA 5G09A 1W7NA 2VMNA 1WYUB 1LS3A 2AY3A 2AY6A 2FM1A 2W7GA 2YHKA 3P6KA 3E2FA 3KGXA 4Q76A 1D7UA 3A8UX 4OBVA 3ASBA 4WYDA 2R5EA 5FT6A 1AMAA 1FG7A 2EZ1A 4A6TA 1TASA 3PDXA 1GC0A 3ECDA 1LC7A 4GE4A 5I92A 3BC8A 3FKDA 1AKBA 1G4XA 3K28A 4TMRA 5FT8A 3E77A 4WYAA 4P7YA 2EZ2A 3UWCA 4AH3A 2W7DA 3D6KA 1MGVA 2W7HA 3AV7A 2HUIA 1H1CA 2BI1A 4E3RA 1IX6A 2YKYA 4L0OA 3I4JA 5EUDA 1ARGA 2YRRA 3BV0A 3A2BA 4AOAA 1DKAA 4WXFA 1X29A 1MDOA 4JE5A 4ISYA 4ADBA 4CVQA 3R9AA 3BN1A 3JW9A 1KL1A 3EUCA 2FN6A 1I29A 1BJ4A 2W8TA 3LY1A 3PDBA 2QA3A 4I8AA 1W23A 3NYSA 1KMJA 5EAAA 3GR9A 2EPJA 3AEMC 3AEMA 3WKRA 3ZRRA 2WK9A 3VK3A 2VMQA 4UQVA 1ASLA 2ORDA 3BCBA 4E1OA 1JS3A 3E2ZB 3W1JA 1S0AA 4W1VA 1KKJA 1D7SA 3FQ8A 1M32A 3FCRA 3BCXA 3HDOA 3LVLB 1QGNA 2QB3A 3GSBA 1AKAA 4TN4A 4F5JA 4JE5D 1GCKA 1BJNA 3MAUA 4WXBA 3JWBA 2OGEA 2DOUA 2Z9VA 3A9XA 1BJOB 2R5CA 3RCHA 3ACZA 1H0CA 3BWNA 1YJSA 3CAIA 2JJEA 3WLXA 2YKXA 1QITA 1OXPA 3I16A 2HUUA 3ZRPA 2W8UA 4CXRA 1OATA 1PMOA 1S09A 3VOMA 1PG8A 2DGMA 2YKUA 1BW0A 5LHAA 3F0HA 4Q6RA 3E6GA 4KXKA 5EQCA 4R5ZA 1VJOA 2VMXA 2YOBA 1AMQA 1ZC9A 2VMRA 1N31A 3AENB 4XJMA 4MQQA 4DQ6A 1WYUA 2D7YA 2DKBA 4N0WA 3FVUA 3DODA 4HVKA 2Z1ZA 2VMVA 1YJZA 1CZCA 1AAMA 4ZSWA 2HP2A 2VIBA 2W8VA 3NU8A 2CJHA 1QZ9A 1SZSA 1WKHA 4WBTA
chains in the Genus database with same CATH superfamily
4XJOA 1LK9A 2ZJGA 3WX9A 4RJ0A 4LNMA 1EQBA 2CJGA 4JEXA 1AHGA 3I5TA 3GETA 2CINA 1ASCA 4RM1A 3TFTA 3DU4A 2HORA 4ATQA 3EI7A 2V1PA 2BWPA 4LC3A 4MQPA 1JS6A 1MLYA 4JEWA 1Z3ZA 2EO5A 2BYLA 4UHMA 1M0OA 3AEPA 3TATA 4ADCA 1P3WA 4AO4A 1EG5A 1CZEA 1BT4A 2CSTA 1E5FA 3N4RA 1LKCA 1IX8A 1S06A 4F4EA 3FTBA 3GJUA 4LNJA 3E2ZA 2AY4A 1S08A 3ASAA 3FFHA 5EAVA 2VMPA 2JISA 3AEJC 3EI6A 1IUGA 2HZPA 3AEJA 4UHOA 4W1WA 4WLJA 3B1EA 1ARHA 3PAAA 1B9IA 3HQTA 4K2MA 1YNUA 1G4VA 1ASGA 1JF9A 2VMYA 1GC3A 1BJOA 1D7VA 2VGVA 4WYEA 5DB5A 5HHYA 3RQ1A 1LC5A 4WYGA 4EB5A 5EUEA 4JEYA 3BS8A 4WXGA 4EFFA 5DJ9A 2CY8A 4CBSA 3A9YA 4M2MA 4PFFA 1SF2A 2VLFA 3G7QA 3LVJA 4A6UA 5M49A 3K40A 4F5LA 1GEXA 2GSAA 2Z9UA 4K2IA 2HOZA 3NDNA 3CBFA 4ZDPA 1O62A 3NYTA 3RBFA 2ZY4A 2VGUA 3MBBA 2F8JA 1CL2A 1B5OA 1XI9A 3PPLA 2QSRA 1AY5A 1C7OA 4DGTA 5M4BA 4IY7A 2ZY2A 5EIGA 2JJGA 3NTJA 1EJIA 5E4ZA 3QPGA 3NUIA 3ISLA 1MAPA 4GE9A 5DX5A 3N7NA 4Q75A 2ZY5A 3NX3A 4ADDA 4BMKA 8AATA 2CB1A 1SFFA 1CS1A 2W7JA 3JWAA 3BCAA 1ELQA 2BWOA 3GZDC 1YJYA 2CTZA 3GZDA 4GEBA 3VK2A 4Y0IA 1AJSB 2VMTA 3PGYA 5G4JA 3N5MA 1ARTA 2PB2A 2VGSA 3L44A 2W7IA 3N4SA 2C7TA 3FD0A 2ZC0A 4W8IA 3T32A 2X8UA 3AEOA 3ATHA 3GBXA 3LVKA 3N75A 4FL0A 2W7MA 4MSOA 4W5KA 3VAXA 4F5MA 2D66A 3B1DA 4GE7A 1GEWA 2Z9WA 4MGRA 3FDDA 1RVUA 2W7EA 1J04A 2DKJA 1W7LA 2XBNA 3AATA 3B1CA 3HMUA 2W7LA 2C81A 3EI9A 3N0LA 4K2BA 2FKIA 3KGWA 2VGZA 3NU7A 4PFNA 3FFRA 2EH6A 4ZASA 4A0RA 2VMUA 1I43A 1CJ0A 2CH2A 3FDBA 2G6WA 3CQ6A 1Z7DA 1FG3A 4H51A 4ZSYA 2GMUA 2AY1A 3FVXA 4WLHA 4ZWMA 2G7JA 1TATA 2VMSA 2AY8A 4WD2A 4OYTA 3EI8A 3BWNC 2BI2A 3TQXA 5FT5A 2CANA 4JEZA 3WKSA 4E77A 1DFOA 4AO9A 2QLRA 1G7XA 4K05A 2AEUA 2HOXA 3KE3A 4OBUA 2WK7A 1AHYA 1ASFA 1IAXA 2TPLA 5KTBA 3FQ7A 4CBRA 3FZ7A 1WYVA 4WP0A 2VGTA 3RBLA 4OT8A 1ZODA 1C9CA 2BIGA 2OKKA 4GSAA 1D2FA 1UKJA 1CQ7A 4MKKA 2FNIA 5M46A 4F5FA 5EIGB 1IX7A 4OTLA 3DZZA 5G4IA 2FQ6A 4BA4A 2GB3A 2CFBA 1JG8A 3H7FA 2GMSA 2OQXA 1SZUA 1B9HA 2GQNA 2W7KA 3W1HA 1KKPA 2WKAA 4MQRA 4MKJA 1GDEA 1AHFA 1X0MA 3LG0A 4M2JA 2Q7WA 1TOIA 1AJSA 1OHVA 2FYFA 2JG2A 2E7UA 3DR4A 1LC8A 4XJPA 4B9BA 2BYJA 1WYTA 2E54A 3FZ8A 1OHYA 1IAYA 1YIYA 1T3IA 1W3UA 2NMPA 1QISA 5M4DA 2X3LA 1WSTA 1SPAA 4RLGA 3QM2A 4P3MA 3B46A 2YCNA 1C7GA 1IBJA 3Q8NA 2BI3A 2DGLA 3HT4A 1B4XA 2ZYJA 1YOOA 3II0A 5TF5A 3HVYA 4RJYA 3PIUA 2W8JA 3EZSA 3TFUA 1J32A 1MDZA 2BIAA 2W7FA 3G8MA 4ZM3A 4IW7A 2V0YA 3L8AA 3DC1A 3H9XA 2JJHA 2BIEA 2ZP7A 4NOGA 1AKCA 2YCTA 2YCPA 1IVRA 3LVMA 3VK4A 2AY2A 4ITGA 4ZLVA 1BJWA 1MDXA 4ITXA 1QJ5A 2E7JA 3UE8A 2DGKA 1PFFA 2BWNA 1BQDA 1V2FA 3B8XA 1AMSA 3DRDA 4RIZA 3RI6A 1D7RA 1I48A 4LW2A 2YRIA 3PD6B 4N0BA 3ZRQA 3WY7A 1QJ3A 3MC6A 2PO3A 5G0AA 5J8QA 4O6ZA 1DJ9A 1V72A 3ELPA 3GZCA 4Y0HA 2BKWA 2C44A 3E2YA 1GC2A 3PA9A 2D64A 1M7YA 4JF0A 2CH1A 1WYVB 3FZ6A 3RUYA 4BA5A 5BJ4A 2ZSMA 3JTXA 1TPLA 4J5UA 1DTYA 4IXZA 5JAYA 2OKJA 1Y4IA 1ASEA 1TOGA 2O1BA 5K8BA 2HOYA 3F9TA 2EGYA 3BWOA 3COGA 1ARSA 4A00A 4ZAHA 1X2AA 5D95A 1C0NA 3ZZJA 3WGBA 1AHEA 3NYUA 2Z67A 1OXOA 1B8GA 4IYOB 3R4TA 2Z1YA 2VMZA 1UU1A 1AIBA 5HDMA 4WYFA 1WYTB 4UHNA 1O4SA 1C4KA 5F9SA 2VI8A 2XH1A 3HL2A 3EZ1A 1AIAA 1M6SA 5E5IA 5EUNA 1AICA 4AZKA 5AX8A 2D61A 2X5DA 2BI9A 1VP4A 1S07A 1SVVA 4GDYA 4W91A 2VLHA 3EIBA 3ELEA 1M0NA 4J8LA 1I41A 3GWPA 3EIAA 1N8PA 3KKIA 9AATA 1SZKA 2WK8A 4ZDOA 1DJUA 1MLZA 3QBOA 3OKSA 1DGEA 1YIZA 2QMAA 3HBXA 2Z9XA 1ASBA 2VIAA 4EB7A 4EU1A 3DXVA 3P1TA 3EI5A 3DR7A 3QI6A 4AZJA 4GRXA 7AATA 1RV4A 1ARIA 4PVFA 4RITA 1ORDA 2VYCA 3E9KA 3VP6A 4M2KA 1TOEA 1DJEA 3AOVA 3F6TA 4Y0DA 1TARA 4Q31A 2RFVA 4OCAA 4F5KA 4UOYA 1ASDA 2BHXA 4HF8A 5E3KA 4A0GA 3PD6A 4RKDA 2ZY3A 4XQ2A 3FQAA 3G0TA 3USFA 4PIWA 3A9ZA 3MEBA 4QGRA 3WGCA 2VI9A 2DR1A 5EFSA 2D65A 1UU0A 3LWSA 2ZUKA 4W1XA 5LH9A 3NNKA 1X28A 1ASNA 2JGTA 1AY8A 1QIRA 4LW4A 4R5FA 4DBCA 1AX4A 1M4NA 3FSLA 2FNUA 2R0TA 5C6UA 5IWQA 4JEVA 4ZDLA 4WB0B 1ELUA 1O69A 3W1IA 3H14A 4XAUA 4R2NA 4WYCA 2HUFA 3WZFA 4B98A 2JJFA 1AHXA 1AMRA 1V2EA 4MY5A 4F5IA 4FFCA 1ASAA 2X5FA 2ZSLA 1ASMA 3CQ4A 3IF2A 3K7YA 3NRAA 1W7MA 4IYOA 3UAKA 3DXWA 1KMKA 1PMMA 3AELA 4ADEA 4A0HA 1UU2A 4IXOA 1M0PA 3BB8A 2BI5A 3MAFB 4RKCA 3IHJA 1TOJA 2AATA 2KFPA 1C7NA 1XEYA 3M5UA 2AY9A 1OHWA 1VEFA 3MADA 1IJIA 2PB0A 4EMYA 2VMOA 1BKGA 1GBNA 2D7ZA 2O7CA 2A1VA 2AEVA 4A6RA 3JZLA 1CQ8A 1GC4A 4F5HA 1V2DA 2Z20A 3FVSA 3CQ5A 1GEYA 3TCMA 3MKJA 4JF1A 2QBTA 1FC4A 4CXQA 1DGDA 5DJ1A 5FT4A 1BQAA 2CJDA 4TV7A 3WCOA 1AAWA 3JU7A 4E3QA 1U08A 4R8DA 1KL2A 1MAQA 2AY5A 1E5EA 3FRKA 2HP1A 3PDBB 1B5PA 4XJLA 3HLMA 3AOWA 2D63A 4RAEA 2AY7A 4A0FA 1LW4A 3MC6C 1AY4A 1AJRA 1G7WA 1M0QA 3N4XA 5G2QA 5HXXA 3OP7A 5D5SA 2D5YA 1ECXA 3NUBA 4KYOA 4OC9A 3ZZKA 5BJ3A 3QN6A 1BS0A 3PJ0A 2R2NA 4WB0A 4XK1A 4BHDA 1TOKA 4OMAA 2E7IA 4F5GA 3DYDA 1O61A 4ZM4A 1YAAA 1ZOBA 4U2HA 1RV3A 1RVYA 4IX8A 2QB2A 2O0RA 4XEWA 4U1TA 1GD9A 2W8WA 4ZWVA 2C0RA 2R5CB 3RCHB 3QHXA 1WKGA 1CL1A 2VMWA 3LV2A 4A72A 3WCNA 3QGUA 5G2PA 4LNLA 2Z61A 4BQ0A 2OGAA 2OATA 2YKVA 4IXSA 4KAMA 1LW5A 3AENA 3MAFA 1CQ6A 1N2TA 2VGWA 5F8VA 4ATPA 5G09A 2WB6A 1W7NA 2VMNA 1WYUB 1LS3A 2AY3A 2AY6A 2FM1A 2W7GA 2YHKA 3P6KA 3E2FA 3KGXA 4Q76A 1D7UA 3A8UX 4OBVA 3ASBA 4WYDA 2R5EA 5FT6A 1AMAA 1FG7A 2EZ1A 4A6TA 1TASA 3PDXA 1GC0A 3ECDA 1LC7A 4GE4A 5I92A 4H63Q 3BC8A 3FKDA 1AKBA 1G4XA 3K28A 4TMRA 5FT8A 3E77A 4WYAA 4P7YA 2EZ2A 3UWCA 4AH3A 2W7DA 3D6KA 1MGVA 2W7HA 3AV7A 2HUIA 1H1CA 2BI1A 4E3RA 1IX6A 2YKYA 4L0OA 3I4JA 5EUDA 1ARGA 2YRRA 3BV0A 2EYQA 3A2BA 4AOAA 1DKAA 4WXFA 1X29A 1MDOA 4JE5A 4ISYA 4ADBA 4CVQA 3R9AA 3BN1A 3JW9A 1KL1A 3EUCA 2FN6A 1I29A 1BJ4A 2W8TA 3LY1A 3PDBA 2QA3A 4I8AA 1W23A 3NYSA 1KMJA 5EAAA 3GR9A 2EPJA 3AEMC 3AEMA 3WKRA 3ZRRA 2WK9A 3VK3A 2VMQA 4UQVA 1ASLA 2ORDA 3BCBA 4E1OA 1JS3A 3E2ZB 3W1JA 1S0AA 4W1VA 1KKJA 1D7SA 3FQ8A 1M32A 3FCRA 3BCXA 3HDOA 3LVLB 1QGNA 2QB3A 3GSBA 1AKAA 4TN4A 4F5JA 4JE5D 1GCKA 1BJNA 3MAUA 4WXBA 3JWBA 2OGEA 2DOUA 2Z9VA 3A9XA 1BJOB 2R5CA 3RCHA 3ACZA 1H0CA 3BWNA 1YJSA 3CAIA 2JJEA 3WLXA 2YKXA 1QITA 1OXPA 3I16A 2HUUA 3ZRPA 2W8UA 4CXRA 1OATA 1PMOA 1S09A 3VOMA 1PG8A 2DGMA 2YKUA 1BW0A 5LHAA 3F0HA 4Q6RA 3E6GA 4KXKA 5EQCA 4R5ZA 1VJOA 2VMXA 2YOBA 1AMQA 1ZC9A 2VMRA 1N31A 3AENB 4XJMA 4MQQA 4DQ6A 1WYUA 2D7YA 2DKBA 4N0WA 3FVUA 3DODA 4HVKA 2Z1ZA 2VMVA 1YJZA 1CZCA 1AAMA 4ZSWA 2HP2A 2VIBA 2W8VA 3NU8A 1KAFA 2CJHA 1QZ9A 1SZSA 1WKHA 4WBTA
chains in the Genus database with same CATH topology
4XJOA 1LK9A 2ZJGA 3WX9A 4RJ0A 4LNMA 1EQBA 2CJGA 4JEXA 1AHGA 3I5TA 3GETA 2CINA 1ASCA 4RM1A 3TFTA 3DU4A 2HORA 4ATQA 3EI7A 2V1PA 2BWPA 4LC3A 4MQPA 1JS6A 1MLYA 4JEWA 1Z3ZA 2EO5A 2BYLA 4UHMA 1M0OA 3AEPA 3TATA 4ADCA 1P3WA 4AO4A 1EG5A 1CZEA 1BT4A 2CSTA 1E5FA 3N4RA 1LKCA 1IX8A 1S06A 4F4EA 3FTBA 3GJUA 4LNJA 3E2ZA 2AY4A 1S08A 3ASAA 3FFHA 5EAVA 2VMPA 2JISA 3AEJC 3EI6A 1IUGA 2HZPA 3AEJA 4UHOA 4W1WA 4WLJA 3B1EA 1ARHA 3PAAA 1B9IA 3HQTA 4K2MA 1YNUA 1G4VA 1ASGA 1JF9A 2VMYA 1GC3A 1BJOA 1D7VA 2VGVA 4WYEA 5DB5A 5HHYA 3RQ1A 1LC5A 4WYGA 4EB5A 5EUEA 4JEYA 3BS8A 4WXGA 4EFFA 5DJ9A 2CY8A 4CBSA 3A9YA 4M2MA 4PFFA 1SF2A 2VLFA 3G7QA 3LVJA 4A6UA 5M49A 3K40A 4F5LA 1GEXA 2GSAA 2Z9UA 4K2IA 2HOZA 3NDNA 3CBFA 4ZDPA 1O62A 3NYTA 3RBFA 2ZY4A 2VGUA 3MBBA 2F8JA 1CL2A 1B5OA 1XI9A 3PPLA 2QSRA 1AY5A 1C7OA 4DGTA 5M4BA 4IY7A 2ZY2A 5EIGA 2JJGA 3NTJA 1EJIA 5E4ZA 3QPGA 3NUIA 3ISLA 1MAPA 4GE9A 5DX5A 3N7NA 4Q75A 2ZY5A 3NX3A 4ADDA 4BMKA 8AATA 2CB1A 1SFFA 1CS1A 2W7JA 3JWAA 3BCAA 1ELQA 2BWOA 3GZDC 1YJYA 2CTZA 3GZDA 4GEBA 3VK2A 4Y0IA 1AJSB 2VMTA 3PGYA 5G4JA 3N5MA 1ARTA 2PB2A 2VGSA 3L44A 2W7IA 3N4SA 2C7TA 3FD0A 2ZC0A 4W8IA 3T32A 2X8UA 3AEOA 3ATHA 3GBXA 3LVKA 3N75A 4FL0A 2W7MA 4MSOA 4W5KA 3VAXA 4F5MA 2D66A 3B1DA 4GE7A 1GEWA 2Z9WA 4MGRA 3FDDA 1RVUA 2W7EA 1J04A 2DKJA 1W7LA 2XBNA 3AATA 3B1CA 3HMUA 2W7LA 2C81A 3EI9A 3N0LA 4K2BA 2FKIA 3KGWA 2VGZA 3NU7A 4PFNA 3FFRA 2EH6A 4ZASA 4A0RA 2VMUA 1I43A 1CJ0A 2CH2A 3FDBA 2G6WA 3CQ6A 1Z7DA 1FG3A 4H51A 4ZSYA 2GMUA 2AY1A 3FVXA 4WLHA 4ZWMA 2G7JA 1TATA 2VMSA 2AY8A 4WD2A 4OYTA 3EI8A 3BWNC 2BI2A 3TQXA 5FT5A 2CANA 4JEZA 3WKSA 4E77A 1DFOA 4AO9A 2QLRA 1G7XA 4K05A 2AEUA 2HOXA 3KE3A 4OBUA 2WK7A 1AHYA 1ASFA 1IAXA 2TPLA 5KTBA 3FQ7A 4CBRA 3FZ7A 1WYVA 4WP0A 2VGTA 3RBLA 4OT8A 1ZODA 1C9CA 2BIGA 2OKKA 4GSAA 1D2FA 1UKJA 1CQ7A 4MKKA 2FNIA 5M46A 4F5FA 5EIGB 1IX7A 4OTLA 3DZZA 5G4IA 2FQ6A 4BA4A 2GB3A 2CFBA 1JG8A 3H7FA 2GMSA 2OQXA 1SZUA 1B9HA 2GQNA 2W7KA 3W1HA 1KKPA 2WKAA 4MQRA 4MKJA 1GDEA 1AHFA 1X0MA 3LG0A 4M2JA 2Q7WA 1TOIA 1AJSA 1OHVA 2FYFA 2JG2A 2E7UA 3DR4A 1LC8A 4XJPA 4B9BA 2BYJA 1WYTA 2E54A 3FZ8A 1OHYA 1IAYA 1YIYA 1T3IA 1W3UA 2NMPA 1QISA 5M4DA 2X3LA 1WSTA 1SPAA 4RLGA 3QM2A 4P3MA 3B46A 2YCNA 1C7GA 1IBJA 3Q8NA 2BI3A 2DGLA 3HT4A 1B4XA 2ZYJA 1YOOA 3II0A 5TF5A 3HVYA 4RJYA 3PIUA 2W8JA 3EZSA 3TFUA 1J32A 1MDZA 2BIAA 2W7FA 3G8MA 4ZM3A 4IW7A 2V0YA 3L8AA 3DC1A 3H9XA 2JJHA 2BIEA 2ZP7A 4NOGA 1AKCA 2YCTA 2YCPA 1IVRA 3LVMA 3VK4A 2AY2A 4ITGA 4ZLVA 1BJWA 1MDXA 4ITXA 1QJ5A 2E7JA 3UE8A 2DGKA 1PFFA 2BWNA 1BQDA 1V2FA 3B8XA 1AMSA 3DRDA 4RIZA 3RI6A 1D7RA 1I48A 4LW2A 2YRIA 3PD6B 4N0BA 3ZRQA 3WY7A 1QJ3A 3MC6A 2PO3A 5G0AA 5J8QA 4O6ZA 1DJ9A 1V72A 3ELPA 3GZCA 4Y0HA 2BKWA 2C44A 3E2YA 1GC2A 3PA9A 2D64A 1M7YA 4JF0A 2CH1A 1WYVB 3FZ6A 3RUYA 4BA5A 5BJ4A 2ZSMA 3JTXA 1TPLA 4J5UA 1DTYA 4IXZA 5JAYA 2OKJA 1Y4IA 1ASEA 1TOGA 2O1BA 5K8BA 2HOYA 3F9TA 2EGYA 3BWOA 3COGA 1ARSA 4A00A 4ZAHA 1X2AA 5D95A 1C0NA 3ZZJA 3WGBA 1AHEA 3NYUA 2Z67A 1OXOA 1B8GA 4IYOB 3R4TA 2Z1YA 2VMZA 1UU1A 1AIBA 5HDMA 4WYFA 1WYTB 4UHNA 1O4SA 1C4KA 5F9SA 2VI8A 2XH1A 3HL2A 3EZ1A 1AIAA 1M6SA 5E5IA 5EUNA 1AICA 4AZKA 5AX8A 2D61A 2X5DA 2BI9A 1VP4A 1S07A 1SVVA 4GDYA 4W91A 2VLHA 3EIBA 3ELEA 1M0NA 4J8LA 1I41A 3GWPA 3EIAA 1N8PA 3KKIA 9AATA 1SZKA 2WK8A 4ZDOA 1DJUA 1MLZA 3QBOA 3OKSA 1DGEA 1YIZA 2QMAA 3HBXA 2Z9XA 1ASBA 2VIAA 4EB7A 4EU1A 3DXVA 3P1TA 3EI5A 3DR7A 3QI6A 4AZJA 4GRXA 7AATA 1RV4A 1ARIA 4PVFA 4RITA 1ORDA 2VYCA 3E9KA 3VP6A 4M2KA 1TOEA 1DJEA 3AOVA 3F6TA 4Y0DA 1TARA 4Q31A 2RFVA 4OCAA 4F5KA 4UOYA 1ASDA 2BHXA 4HF8A 5E3KA 4A0GA 3PD6A 4RKDA 2ZY3A 4XQ2A 3FQAA 3G0TA 3USFA 4PIWA 3A9ZA 3MEBA 4QGRA 3WGCA 2VI9A 2DR1A 5EFSA 2D65A 1UU0A 3LWSA 2ZUKA 4W1XA 5LH9A 3NNKA 1X28A 1ASNA 2JGTA 1AY8A 1QIRA 4LW4A 4R5FA 4DBCA 1AX4A 1M4NA 3FSLA 2FNUA 2R0TA 5C6UA 5IWQA 4JEVA 4ZDLA 4WB0B 1ELUA 1O69A 3W1IA 3H14A 4XAUA 4R2NA 4WYCA 2HUFA 3WZFA 4B98A 2JJFA 1AHXA 1AMRA 1V2EA 4MY5A 4F5IA 4FFCA 1ASAA 2X5FA 2ZSLA 1ASMA 3CQ4A 3IF2A 3K7YA 3NRAA 1W7MA 4IYOA 3UAKA 3DXWA 1KMKA 1PMMA 3AELA 4ADEA 4A0HA 1UU2A 4IXOA 1M0PA 3BB8A 2BI5A 3MAFB 4RKCA 3IHJA 1TOJA 2AATA 2KFPA 1C7NA 1XEYA 3M5UA 2AY9A 1OHWA 1VEFA 3MADA 1IJIA 2PB0A 4EMYA 2VMOA 1BKGA 1GBNA 2D7ZA 2O7CA 2A1VA 2AEVA 4A6RA 3JZLA 1CQ8A 1GC4A 4F5HA 1V2DA 2Z20A 3FVSA 3CQ5A 1GEYA 3TCMA 3MKJA 4JF1A 2QBTA 1FC4A 4CXQA 1DGDA 5DJ1A 5FT4A 1BQAA 2CJDA 4TV7A 3WCOA 1AAWA 3JU7A 4E3QA 1U08A 4R8DA 1KL2A 1MAQA 2AY5A 1E5EA 3FRKA 2HP1A 3PDBB 1B5PA 4XJLA 3HLMA 3AOWA 2D63A 4RAEA 2AY7A 4A0FA 1LW4A 3MC6C 1AY4A 1AJRA 1G7WA 1M0QA 3N4XA 5G2QA 5HXXA 3OP7A 5D5SA 2D5YA 1ECXA 3NUBA 4KYOA 4OC9A 3ZZKA 5BJ3A 3QN6A 1BS0A 3PJ0A 2R2NA 4WB0A 4XK1A 4BHDA 1TOKA 4OMAA 2E7IA 4F5GA 3DYDA 1O61A 4ZM4A 1YAAA 1ZOBA 4U2HA 1RV3A 1RVYA 4IX8A 2QB2A 2O0RA 4XEWA 4U1TA 1GD9A 2W8WA 4ZWVA 2C0RA 2R5CB 3RCHB 3QHXA 1WKGA 1CL1A 2VMWA 3LV2A 4A72A 3WCNA 3QGUA 5G2PA 4LNLA 2Z61A 4BQ0A 2OGAA 2OATA 2YKVA 4IXSA 4KAMA 1LW5A 3AENA 3MAFA 1CQ6A 1N2TA 2VGWA 5F8VA 4ATPA 5G09A 2WB6A 1W7NA 2VMNA 1WYUB 1LS3A 2AY3A 2AY6A 2FM1A 2W7GA 2YHKA 3P6KA 3E2FA 3KGXA 4Q76A 1D7UA 3A8UX 4OBVA 3ASBA 4WYDA 2R5EA 5FT6A 1AMAA 1FG7A 2EZ1A 4A6TA 1TASA 3PDXA 1GC0A 3ECDA 1LC7A 4GE4A 5I92A 4H63Q 3BC8A 3FKDA 1AKBA 1G4XA 3K28A 4TMRA 5FT8A 3E77A 4WYAA 4P7YA 2EZ2A 3UWCA 4AH3A 2W7DA 3D6KA 1MGVA 2W7HA 3AV7A 2HUIA 1H1CA 2BI1A 4E3RA 1IX6A 2YKYA 4L0OA 3I4JA 5EUDA 1ARGA 2YRRA 3BV0A 2EYQA 3A2BA 4AOAA 1DKAA 4WXFA 1X29A 1MDOA 4JE5A 4ISYA 4ADBA 4CVQA 3R9AA 3BN1A 3JW9A 1KL1A 3EUCA 2FN6A 1I29A 1BJ4A 2W8TA 3LY1A 3PDBA 2QA3A 4I8AA 1W23A 3NYSA 1KMJA 5EAAA 3GR9A 2EPJA 3AEMC 3AEMA 3WKRA 3ZRRA 2WK9A 3VK3A 2VMQA 4UQVA 1ASLA 2ORDA 3BCBA 4E1OA 1JS3A 3E2ZB 3W1JA 1S0AA 4W1VA 1KKJA 1D7SA 3FQ8A 1M32A 3FCRA 3BCXA 3HDOA 3LVLB 1QGNA 2QB3A 3GSBA 1AKAA 4TN4A 4F5JA 4JE5D 1GCKA 1BJNA 3MAUA 4WXBA 3JWBA 2OGEA 2DOUA 2Z9VA 3A9XA 1BJOB 2R5CA 3RCHA 3ACZA 1H0CA 3BWNA 1YJSA 3CAIA 2JJEA 3WLXA 2YKXA 1QITA 1OXPA 3I16A 2HUUA 3ZRPA 2W8UA 4CXRA 1OATA 1PMOA 1S09A 3VOMA 1PG8A 2DGMA 2YKUA 1BW0A 5LHAA 3F0HA 4Q6RA 3E6GA 4KXKA 5EQCA 4R5ZA 1VJOA 2VMXA 2YOBA 1AMQA 1ZC9A 2VMRA 1N31A 3AENB 4XJMA 4MQQA 4DQ6A 1WYUA 2D7YA 2DKBA 4N0WA 3FVUA 3DODA 4HVKA 2Z1ZA 2VMVA 1YJZA 1CZCA 1AAMA 4ZSWA 2HP2A 2VIBA 2W8VA 3NU8A 2CJHA 1QZ9A 1SZSA 1WKHA 4WBTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XJO A;  1LK9 A;  2ZJG A;  3WX9 A;  4RJ0 A;  4LNM A;  1EQB A;  2CJG A;  4JEX A;  1AHG A;  3I5T A;  3GET A;  2CIN A;  1ASC A;  4RM1 A;  3TFT A;  3DU4 A;  2HOR A;  4ATQ A;  3EI7 A;  2V1P A;  2BWP A;  4LC3 A;  4MQP A;  1JS6 A;  1MLY A;  4JEW A;  1Z3Z A;  2EO5 A;  2BYL A;  4UHM A;  1M0O A;  3AEP A;  3TAT A;  4ADC A;  1P3W A;  4AO4 A;  1EG5 A;  1CZE A;  1BT4 A;  2CST A;  1E5F A;  1LKC A;  1IX8 A;  1S06 A;  4F4E A;  3FTB A;  3GJU A;  4LNJ A;  3E2Z A;  2AY4 A;  1S08 A;  3ASA A;  3FFH A;  5EAV A;  2VMP A;  2JIS A;  3AEJ C;  3EI6 A;  1IUG A;  2HZP A;  3AEJ A;  4UHO A;  4W1W A;  4WLJ A;  3B1E A;  1ARH A;  3PAA A;  1B9I A;  3HQT A;  4K2M A;  1YNU A;  1G4V A;  1ASG A;  1JF9 A;  2VMY A;  1GC3 A;  1BJO A;  1D7V A;  2VGV A;  4WYE A;  5DB5 A;  5HHY A;  3RQ1 A;  1LC5 A;  4WYG A;  4EB5 A;  5EUE A;  4JEY A;  3BS8 A;  4WXG A;  4EFF A;  5DJ9 A;  2CY8 A;  4CBS A;  3A9Y A;  4M2M A;  4PFF A;  1SF2 A;  2VLF A;  3G7Q A;  3LVJ A;  4A6U A;  5M49 A;  3K40 A;  4F5L A;  1GEX A;  2GSA A;  2Z9U A;  4K2I A;  2HOZ A;  3NDN A;  3CBF A;  4ZDP A;  1O62 A;  3NYT A;  3RBF A;  2ZY4 A;  2VGU A;  3MBB A;  2F8J A;  1CL2 A;  1B5O A;  1XI9 A;  3PPL A;  1AY5 A;  1C7O A;  4DGT A;  5M4B A;  4IY7 A;  2ZY2 A;  5EIG A;  2JJG A;  3NTJ A;  1EJI A;  5E4Z A;  3QPG A;  3NUI A;  3ISL A;  1MAP A;  4GE9 A;  5DX5 A;  4Q75 A;  2ZY5 A;  3NX3 A;  4ADD A;  4BMK A;  8AAT A;  2CB1 A;  1SFF A;  1CS1 A;  2W7J A;  3JWA A;  3BCA A;  1ELQ A;  2BWO A;  3GZD C;  1YJY A;  2CTZ A;  3GZD A;  4GEB A;  3VK2 A;  4Y0I A;  1AJS B;  2VMT A;  3PGY A;  5G4J A;  3N5M A;  1ART A;  2PB2 A;  2VGS A;  3L44 A;  2W7I A;  2C7T A;  3FD0 A;  2ZC0 A;  4W8I A;  3T32 A;  2X8U A;  3AEO A;  3ATH A;  3GBX A;  3LVK A;  3N75 A;  4FL0 A;  2W7M A;  4MSO A;  4W5K A;  3VAX A;  4F5M A;  2D66 A;  3B1D A;  4GE7 A;  1GEW A;  2Z9W A;  4MGR A;  3FDD A;  1RVU A;  2W7E A;  1J04 A;  2DKJ A;  1W7L A;  2XBN A;  3AAT A;  3B1C A;  3HMU A;  2W7L A;  2C81 A;  3EI9 A;  3N0L A;  4K2B A;  3KGW A;  2VGZ A;  3NU7 A;  4PFN A;  3FFR A;  2EH6 A;  4ZAS A;  4A0R A;  2VMU A;  1I43 A;  1CJ0 A;  2CH2 A;  3FDB A;  2G6W A;  3CQ6 A;  1Z7D A;  1FG3 A;  4H51 A;  4ZSY A;  2GMU A;  2AY1 A;  3FVX A;  4WLH A;  4ZWM A;  1TAT A;  2VMS A;  2AY8 A;  4WD2 A;  4OYT A;  3EI8 A;  3BWN C;  2BI2 A;  3TQX A;  5FT5 A;  2CAN A;  4JEZ A;  3WKS A;  4E77 A;  1DFO A;  4AO9 A;  2QLR A;  1G7X A;  2AEU A;  2HOX A;  3KE3 A;  4OBU A;  2WK7 A;  1AHY A;  1ASF A;  1IAX A;  2TPL A;  3FQ7 A;  4CBR A;  3FZ7 A;  1WYV A;  4WP0 A;  2VGT A;  3RBL A;  4OT8 A;  1ZOD A;  1C9C A;  2BIG A;  2OKK A;  4GSA A;  1D2F A;  1UKJ A;  1CQ7 A;  4MKK A;  2FNI A;  5M46 A;  4F5F A;  5EIG B;  1IX7 A;  4OTL A;  3DZZ A;  5G4I A;  2FQ6 A;  4BA4 A;  2GB3 A;  2CFB A;  1JG8 A;  3H7F A;  2GMS A;  2OQX A;  1SZU A;  1B9H A;  2GQN A;  2W7K A;  3W1H A;  1KKP A;  2WKA A;  4MQR A;  4MKJ A;  1GDE A;  1AHF A;  1X0M A;  3LG0 A;  4M2J A;  2Q7W A;  1TOI A;  1AJS A;  1OHV A;  2FYF A;  2JG2 A;  2E7U A;  3DR4 A;  1LC8 A;  4XJP A;  4B9B A;  2BYJ A;  1WYT A;  2E54 A;  3FZ8 A;  1OHY A;  1IAY A;  1YIY A;  1T3I A;  1W3U A;  2NMP A;  1QIS A;  5M4D A;  2X3L A;  1WST A;  1SPA A;  4RLG A;  3QM2 A;  4P3M A;  3B46 A;  2YCN A;  1C7G A;  1IBJ A;  3Q8N A;  2BI3 A;  2DGL A;  3HT4 A;  1B4X A;  2ZYJ A;  1YOO A;  3II0 A;  5TF5 A;  3HVY A;  4RJY A;  3PIU A;  2W8J A;  3EZS A;  3TFU A;  1J32 A;  1MDZ A;  2BIA A;  2W7F A;  3G8M A;  4ZM3 A;  4IW7 A;  2V0Y A;  3L8A A;  3DC1 A;  2JJH A;  2BIE A;  2ZP7 A;  4NOG A;  1AKC A;  2YCT A;  2YCP A;  1IVR A;  3LVM A;  3VK4 A;  2AY2 A;  4ITG A;  4ZLV A;  1BJW A;  1MDX A;  4ITX A;  1QJ5 A;  2E7J A;  3UE8 A;  2DGK A;  1PFF A;  2BWN A;  1BQD A;  1V2F A;  3B8X A;  1AMS A;  3DRD A;  4RIZ A;  3RI6 A;  1D7R A;  1I48 A;  4LW2 A;  2YRI A;  3PD6 B;  4N0B A;  3ZRQ A;  3WY7 A;  1QJ3 A;  3MC6 A;  2PO3 A;  5G0A A;  5J8Q A;  4O6Z A;  1DJ9 A;  1V72 A;  3ELP A;  3GZC A;  4Y0H A;  2BKW A;  2C44 A;  3E2Y A;  1GC2 A;  3PA9 A;  2D64 A;  1M7Y A;  4JF0 A;  2CH1 A;  1WYV B;  3FZ6 A;  3RUY A;  4BA5 A;  5BJ4 A;  2ZSM A;  3JTX A;  1TPL A;  4J5U A;  1DTY A;  4IXZ A;  5JAY A;  2OKJ A;  1Y4I A;  1ASE A;  1TOG A;  2O1B A;  5K8B A;  2HOY A;  3F9T A;  2EGY A;  3BWO A;  3COG A;  1ARS A;  4A00 A;  4ZAH A;  1X2A A;  5D95 A;  1C0N A;  3ZZJ A;  3WGB A;  1AHE A;  3NYU A;  2Z67 A;  1OXO A;  1B8G A;  4IYO B;  3R4T A;  2Z1Y A;  2VMZ A;  1UU1 A;  1AIB A;  5HDM A;  4WYF A;  1WYT B;  4UHN A;  1O4S A;  1C4K A;  5F9S A;  2VI8 A;  2XH1 A;  3HL2 A;  3EZ1 A;  1AIA A;  1M6S A;  5E5I A;  5EUN A;  1AIC A;  4AZK A;  5AX8 A;  2D61 A;  2X5D A;  2BI9 A;  1VP4 A;  1S07 A;  1SVV A;  4GDY A;  4W91 A;  2VLH A;  3EIB A;  3ELE A;  1M0N A;  4J8L A;  1I41 A;  3GWP A;  3EIA A;  1N8P A;  3KKI A;  9AAT A;  1SZK A;  2WK8 A;  4ZDO A;  1DJU A;  1MLZ A;  3QBO A;  3OKS A;  1DGE A;  1YIZ A;  2QMA A;  3HBX A;  2Z9X A;  1ASB A;  2VIA A;  4EB7 A;  4EU1 A;  3DXV A;  3P1T A;  3EI5 A;  3DR7 A;  3QI6 A;  4AZJ A;  4GRX A;  7AAT A;  1RV4 A;  1ARI A;  4PVF A;  4RIT A;  1ORD A;  2VYC A;  3E9K A;  3VP6 A;  4M2K A;  1TOE A;  1DJE A;  3AOV A;  3F6T A;  4Y0D A;  1TAR A;  4Q31 A;  2RFV A;  4OCA A;  4F5K A;  4UOY A;  1ASD A;  2BHX A;  4HF8 A;  5E3K A;  4A0G A;  3PD6 A;  4RKD A;  2ZY3 A;  4XQ2 A;  3FQA A;  3G0T A;  3USF A;  4PIW A;  3A9Z A;  3MEB A;  4QGR A;  3WGC A;  2VI9 A;  2DR1 A;  5EFS A;  2D65 A;  1UU0 A;  3LWS A;  2ZUK A;  4W1X A;  5LH9 A;  3NNK A;  1X28 A;  1ASN A;  2JGT A;  1AY8 A;  1QIR A;  4LW4 A;  4R5F A;  4DBC A;  1AX4 A;  1M4N A;  3FSL A;  2FNU A;  2R0T A;  5C6U A;  5IWQ A;  4JEV A;  4ZDL A;  4WB0 B;  1ELU A;  1O69 A;  3W1I A;  3H14 A;  4XAU A;  4R2N A;  4WYC A;  2HUF A;  3WZF A;  4B98 A;  2JJF A;  1AHX A;  1AMR A;  1V2E A;  4MY5 A;  4F5I A;  4FFC A;  1ASA A;  2X5F A;  2ZSL A;  1ASM A;  3CQ4 A;  3IF2 A;  3K7Y A;  3NRA A;  1W7M A;  4IYO A;  3UAK A;  3DXW A;  1KMK A;  1PMM A;  3AEL A;  4ADE A;  4A0H A;  1UU2 A;  4IXO A;  1M0P A;  3BB8 A;  2BI5 A;  3MAF B;  4RKC A;  3IHJ A;  1TOJ A;  2AAT A;  1C7N A;  1XEY A;  3M5U A;  2AY9 A;  1OHW A;  1VEF A;  3MAD A;  1IJI A;  2PB0 A;  4EMY A;  2VMO A;  1BKG A;  1GBN A;  2D7Z A;  2O7C A;  2AEV A;  4A6R A;  3JZL A;  1CQ8 A;  1GC4 A;  4F5H A;  1V2D A;  2Z20 A;  3FVS A;  3CQ5 A;  1GEY A;  3TCM A;  3MKJ A;  4JF1 A;  2QBT A;  1FC4 A;  4CXQ A;  1DGD A;  5DJ1 A;  5FT4 A;  1BQA A;  2CJD A;  4TV7 A;  3WCO A;  1AAW A;  3JU7 A;  4E3Q A;  1U08 A;  4R8D A;  1KL2 A;  1MAQ A;  2AY5 A;  1E5E A;  3FRK A;  2HP1 A;  3PDB B;  1B5P A;  4XJL A;  3HLM A;  3AOW A;  2D63 A;  4RAE A;  2AY7 A;  4A0F A;  1LW4 A;  3MC6 C;  1AY4 A;  1AJR A;  1G7W A;  1M0Q A;  5G2Q A;  5HXX A;  3OP7 A;  5D5S A;  2D5Y A;  1ECX A;  3NUB A;  4KYO A;  4OC9 A;  3ZZK A;  5BJ3 A;  3QN6 A;  1BS0 A;  3PJ0 A;  2R2N A;  4WB0 A;  4XK1 A;  4BHD A;  1TOK A;  4OMA A;  2E7I A;  4F5G A;  3DYD A;  1O61 A;  4ZM4 A;  1YAA A;  1ZOB A;  4U2H A;  1RV3 A;  1RVY A;  4IX8 A;  2QB2 A;  2O0R A;  4XEW A;  4U1T A;  1GD9 A;  2W8W A;  4ZWV A;  2C0R A;  2R5C B;  3RCH B;  3QHX A;  1WKG A;  1CL1 A;  2VMW A;  3LV2 A;  4A72 A;  3WCN A;  3QGU A;  5G2P A;  4LNL A;  2Z61 A;  4BQ0 A;  2OGA A;  2OAT A;  2YKV A;  4IXS A;  4KAM A;  1LW5 A;  3AEN A;  3MAF A;  1CQ6 A;  1N2T A;  2VGW A;  5F8V A;  4ATP A;  5G09 A;  1W7N A;  2VMN A;  1WYU B;  1LS3 A;  2AY3 A;  2AY6 A;  2FM1 A;  2W7G A;  2YHK A;  3P6K A;  3E2F A;  3KGX A;  4Q76 A;  1D7U A;  3A8U X;  4OBV A;  3ASB A;  4WYD A;  2R5E A;  5FT6 A;  1AMA A;  1FG7 A;  2EZ1 A;  4A6T A;  1TAS A;  3PDX A;  1GC0 A;  3ECD A;  1LC7 A;  4GE4 A;  5I92 A;  3BC8 A;  3FKD A;  1AKB A;  1G4X A;  3K28 A;  4TMR A;  5FT8 A;  3E77 A;  4WYA A;  4P7Y A;  2EZ2 A;  3UWC A;  4AH3 A;  2W7D A;  3D6K A;  1MGV A;  2W7H A;  3AV7 A;  2HUI A;  1H1C A;  2BI1 A;  4E3R A;  1IX6 A;  2YKY A;  4L0O A;  3I4J A;  5EUD A;  1ARG A;  2YRR A;  3BV0 A;  3A2B A;  4AOA A;  1DKA A;  4WXF A;  1X29 A;  1MDO A;  4JE5 A;  4ISY A;  4ADB A;  4CVQ A;  3R9A A;  3BN1 A;  3JW9 A;  1KL1 A;  3EUC A;  2FN6 A;  1I29 A;  1BJ4 A;  2W8T A;  3LY1 A;  3PDB A;  2QA3 A;  4I8A A;  1W23 A;  3NYS A;  1KMJ A;  5EAA A;  3GR9 A;  2EPJ A;  3AEM C;  3AEM A;  3WKR A;  3ZRR A;  2WK9 A;  3VK3 A;  2VMQ A;  4UQV A;  1ASL A;  2ORD A;  3BCB A;  4E1O A;  1JS3 A;  3E2Z B;  3W1J A;  1S0A A;  4W1V A;  1KKJ A;  1D7S A;  3FQ8 A;  1M32 A;  3FCR A;  3BCX A;  3HDO A;  3LVL B;  1QGN A;  2QB3 A;  3GSB A;  1AKA A;  4TN4 A;  4F5J A;  4JE5 D;  1GCK A;  1BJN A;  3MAU A;  4WXB A;  3JWB A;  2OGE A;  2DOU A;  2Z9V A;  3A9X A;  1BJO B;  2R5C A;  3RCH A;  3ACZ A;  1H0C A;  3BWN A;  1YJS A;  3CAI A;  2JJE A;  3WLX A;  2YKX A;  1QIT A;  1OXP A;  3I16 A;  2HUU A;  3ZRP A;  2W8U A;  4CXR A;  1OAT A;  1PMO A;  1S09 A;  3VOM A;  1PG8 A;  2DGM A;  2YKU A;  1BW0 A;  5LHA A;  3F0H A;  4Q6R A;  3E6G A;  4KXK A;  5EQC A;  4R5Z A;  1VJO A;  2VMX A;  2YOB A;  1AMQ A;  1ZC9 A;  2VMR A;  1N31 A;  3AEN B;  4XJM A;  4MQQ A;  4DQ6 A;  1WYU A;  2D7Y A;  2DKB A;  4N0W A;  3FVU A;  3DOD A;  4HVK A;  2Z1Z A;  2VMV A;  1YJZ A;  1CZC A;  1AAM A;  4ZSW A;  2HP2 A;  2VIB A;  2W8V A;  3NU8 A;  2CJH A;  1QZ9 A;  1SZS A;  1WKH A;  4WBT A; 
#chains in the Genus database with same CATH topology
 4XJO A;  1LK9 A;  2ZJG A;  3WX9 A;  4RJ0 A;  4LNM A;  1EQB A;  2CJG A;  4JEX A;  1AHG A;  3I5T A;  3GET A;  2CIN A;  1ASC A;  4RM1 A;  3TFT A;  3DU4 A;  2HOR A;  4ATQ A;  3EI7 A;  2V1P A;  2BWP A;  4LC3 A;  4MQP A;  1JS6 A;  1MLY A;  4JEW A;  1Z3Z A;  2EO5 A;  2BYL A;  4UHM A;  1M0O A;  3AEP A;  3TAT A;  4ADC A;  1P3W A;  4AO4 A;  1EG5 A;  1CZE A;  1BT4 A;  2CST A;  1E5F A;  3N4R A;  1LKC A;  1IX8 A;  1S06 A;  4F4E A;  3FTB A;  3GJU A;  4LNJ A;  3E2Z A;  2AY4 A;  1S08 A;  3ASA A;  3FFH A;  5EAV A;  2VMP A;  2JIS A;  3AEJ C;  3EI6 A;  1IUG A;  2HZP A;  3AEJ A;  4UHO A;  4W1W A;  4WLJ A;  3B1E A;  1ARH A;  3PAA A;  1B9I A;  3HQT A;  4K2M A;  1YNU A;  1G4V A;  1ASG A;  1JF9 A;  2VMY A;  1GC3 A;  1BJO A;  1D7V A;  2VGV A;  4WYE A;  5DB5 A;  5HHY A;  3RQ1 A;  1LC5 A;  4WYG A;  4EB5 A;  5EUE A;  4JEY A;  3BS8 A;  4WXG A;  4EFF A;  5DJ9 A;  2CY8 A;  4CBS A;  3A9Y A;  4M2M A;  4PFF A;  1SF2 A;  2VLF A;  3G7Q A;  3LVJ A;  4A6U A;  5M49 A;  3K40 A;  4F5L A;  1GEX A;  2GSA A;  2Z9U A;  4K2I A;  2HOZ A;  3NDN A;  3CBF A;  4ZDP A;  1O62 A;  3NYT A;  3RBF A;  2ZY4 A;  2VGU A;  3MBB A;  2F8J A;  1CL2 A;  1B5O A;  1XI9 A;  3PPL A;  2QSR A;  1AY5 A;  1C7O A;  4DGT A;  5M4B A;  4IY7 A;  2ZY2 A;  5EIG A;  2JJG A;  3NTJ A;  1EJI A;  5E4Z A;  3QPG A;  3NUI A;  3ISL A;  1MAP A;  4GE9 A;  5DX5 A;  3N7N A;  4Q75 A;  2ZY5 A;  3NX3 A;  4ADD A;  4BMK A;  8AAT A;  2CB1 A;  1SFF A;  1CS1 A;  2W7J A;  3JWA A;  3BCA A;  1ELQ A;  2BWO A;  3GZD C;  1YJY A;  2CTZ A;  3GZD A;  4GEB A;  3VK2 A;  4Y0I A;  1AJS B;  2VMT A;  3PGY A;  5G4J A;  3N5M A;  1ART A;  2PB2 A;  2VGS A;  3L44 A;  2W7I A;  3N4S A;  2C7T A;  3FD0 A;  2ZC0 A;  4W8I A;  3T32 A;  2X8U A;  3AEO A;  3ATH A;  3GBX A;  3LVK A;  3N75 A;  4FL0 A;  2W7M A;  4MSO A;  4W5K A;  3VAX A;  4F5M A;  2D66 A;  3B1D A;  4GE7 A;  1GEW A;  2Z9W A;  4MGR A;  3FDD A;  1RVU A;  2W7E A;  1J04 A;  2DKJ A;  1W7L A;  2XBN A;  3AAT A;  3B1C A;  3HMU A;  2W7L A;  2C81 A;  3EI9 A;  3N0L A;  4K2B A;  2FKI A;  3KGW A;  2VGZ A;  3NU7 A;  4PFN A;  3FFR A;  2EH6 A;  4ZAS A;  4A0R A;  2VMU A;  1I43 A;  1CJ0 A;  2CH2 A;  3FDB A;  2G6W A;  3CQ6 A;  1Z7D A;  1FG3 A;  4H51 A;  4ZSY A;  2GMU A;  2AY1 A;  3FVX A;  4WLH A;  4ZWM A;  2G7J A;  1TAT A;  2VMS A;  2AY8 A;  4WD2 A;  4OYT A;  3EI8 A;  3BWN C;  2BI2 A;  3TQX A;  5FT5 A;  2CAN A;  4JEZ A;  3WKS A;  4E77 A;  1DFO A;  4AO9 A;  2QLR A;  1G7X A;  4K05 A;  2AEU A;  2HOX A;  3KE3 A;  4OBU A;  2WK7 A;  1AHY A;  1ASF A;  1IAX A;  2TPL A;  5KTB A;  3FQ7 A;  4CBR A;  3FZ7 A;  1WYV A;  4WP0 A;  2VGT A;  3RBL A;  4OT8 A;  1ZOD A;  1C9C A;  2BIG A;  2OKK A;  4GSA A;  1D2F A;  1UKJ A;  1CQ7 A;  4MKK A;  2FNI A;  5M46 A;  4F5F A;  5EIG B;  1IX7 A;  4OTL A;  3DZZ A;  5G4I A;  2FQ6 A;  4BA4 A;  2GB3 A;  2CFB A;  1JG8 A;  3H7F A;  2GMS A;  2OQX A;  1SZU A;  1B9H A;  2GQN A;  2W7K A;  3W1H A;  1KKP A;  2WKA A;  4MQR A;  4MKJ A;  1GDE A;  1AHF A;  1X0M A;  3LG0 A;  4M2J A;  2Q7W A;  1TOI A;  1AJS A;  1OHV A;  2FYF A;  2JG2 A;  2E7U A;  3DR4 A;  1LC8 A;  4XJP A;  4B9B A;  2BYJ A;  1WYT A;  2E54 A;  3FZ8 A;  1OHY A;  1IAY A;  1YIY A;  1T3I A;  1W3U A;  2NMP A;  1QIS A;  5M4D A;  2X3L A;  1WST A;  1SPA A;  4RLG A;  3QM2 A;  4P3M A;  3B46 A;  2YCN A;  1C7G A;  1IBJ A;  3Q8N A;  2BI3 A;  2DGL A;  3HT4 A;  1B4X A;  2ZYJ A;  1YOO A;  3II0 A;  5TF5 A;  3HVY A;  4RJY A;  3PIU A;  2W8J A;  3EZS A;  3TFU A;  1J32 A;  1MDZ A;  2BIA A;  2W7F A;  3G8M A;  4ZM3 A;  4IW7 A;  2V0Y A;  3L8A A;  3DC1 A;  3H9X A;  2JJH A;  2BIE A;  2ZP7 A;  4NOG A;  1AKC A;  2YCT A;  2YCP A;  1IVR A;  3LVM A;  3VK4 A;  2AY2 A;  4ITG A;  4ZLV A;  1BJW A;  1MDX A;  4ITX A;  1QJ5 A;  2E7J A;  3UE8 A;  2DGK A;  1PFF A;  2BWN A;  1BQD A;  1V2F A;  3B8X A;  1AMS A;  3DRD A;  4RIZ A;  3RI6 A;  1D7R A;  1I48 A;  4LW2 A;  2YRI A;  3PD6 B;  4N0B A;  3ZRQ A;  3WY7 A;  1QJ3 A;  3MC6 A;  2PO3 A;  5G0A A;  5J8Q A;  4O6Z A;  1DJ9 A;  1V72 A;  3ELP A;  3GZC A;  4Y0H A;  2BKW A;  2C44 A;  3E2Y A;  1GC2 A;  3PA9 A;  2D64 A;  1M7Y A;  4JF0 A;  2CH1 A;  1WYV B;  3FZ6 A;  3RUY A;  4BA5 A;  5BJ4 A;  2ZSM A;  3JTX A;  1TPL A;  4J5U A;  1DTY A;  4IXZ A;  5JAY A;  2OKJ A;  1Y4I A;  1ASE A;  1TOG A;  2O1B A;  5K8B A;  2HOY A;  3F9T A;  2EGY A;  3BWO A;  3COG A;  1ARS A;  4A00 A;  4ZAH A;  1X2A A;  5D95 A;  1C0N A;  3ZZJ A;  3WGB A;  1AHE A;  3NYU A;  2Z67 A;  1OXO A;  1B8G A;  4IYO B;  3R4T A;  2Z1Y A;  2VMZ A;  1UU1 A;  1AIB A;  5HDM A;  4WYF A;  1WYT B;  4UHN A;  1O4S A;  1C4K A;  5F9S A;  2VI8 A;  2XH1 A;  3HL2 A;  3EZ1 A;  1AIA A;  1M6S A;  5E5I A;  5EUN A;  1AIC A;  4AZK A;  5AX8 A;  2D61 A;  2X5D A;  2BI9 A;  1VP4 A;  1S07 A;  1SVV A;  4GDY A;  4W91 A;  2VLH A;  3EIB A;  3ELE A;  1M0N A;  4J8L A;  1I41 A;  3GWP A;  3EIA A;  1N8P A;  3KKI A;  9AAT A;  1SZK A;  2WK8 A;  4ZDO A;  1DJU A;  1MLZ A;  3QBO A;  3OKS A;  1DGE A;  1YIZ A;  2QMA A;  3HBX A;  2Z9X A;  1ASB A;  2VIA A;  4EB7 A;  4EU1 A;  3DXV A;  3P1T A;  3EI5 A;  3DR7 A;  3QI6 A;  4AZJ A;  4GRX A;  7AAT A;  1RV4 A;  1ARI A;  4PVF A;  4RIT A;  1ORD A;  2VYC A;  3E9K A;  3VP6 A;  4M2K A;  1TOE A;  1DJE A;  3AOV A;  3F6T A;  4Y0D A;  1TAR A;  4Q31 A;  2RFV A;  4OCA A;  4F5K A;  4UOY A;  1ASD A;  2BHX A;  4HF8 A;  5E3K A;  4A0G A;  3PD6 A;  4RKD A;  2ZY3 A;  4XQ2 A;  3FQA A;  3G0T A;  3USF A;  4PIW A;  3A9Z A;  3MEB A;  4QGR A;  3WGC A;  2VI9 A;  2DR1 A;  5EFS A;  2D65 A;  1UU0 A;  3LWS A;  2ZUK A;  4W1X A;  5LH9 A;  3NNK A;  1X28 A;  1ASN A;  2JGT A;  1AY8 A;  1QIR A;  4LW4 A;  4R5F A;  4DBC A;  1AX4 A;  1M4N A;  3FSL A;  2FNU A;  2R0T A;  5C6U A;  5IWQ A;  4JEV A;  4ZDL A;  4WB0 B;  1ELU A;  1O69 A;  3W1I A;  3H14 A;  4XAU A;  4R2N A;  4WYC A;  2HUF A;  3WZF A;  4B98 A;  2JJF A;  1AHX A;  1AMR A;  1V2E A;  4MY5 A;  4F5I A;  4FFC A;  1ASA A;  2X5F A;  2ZSL A;  1ASM A;  3CQ4 A;  3IF2 A;  3K7Y A;  3NRA A;  1W7M A;  4IYO A;  3UAK A;  3DXW A;  1KMK A;  1PMM A;  3AEL A;  4ADE A;  4A0H A;  1UU2 A;  4IXO A;  1M0P A;  3BB8 A;  2BI5 A;  3MAF B;  4RKC A;  3IHJ A;  1TOJ A;  2AAT A;  2KFP A;  1C7N A;  1XEY A;  3M5U A;  2AY9 A;  1OHW A;  1VEF A;  3MAD A;  1IJI A;  2PB0 A;  4EMY A;  2VMO A;  1BKG A;  1GBN A;  2D7Z A;  2O7C A;  2A1V A;  2AEV A;  4A6R A;  3JZL A;  1CQ8 A;  1GC4 A;  4F5H A;  1V2D A;  2Z20 A;  3FVS A;  3CQ5 A;  1GEY A;  3TCM A;  3MKJ A;  4JF1 A;  2QBT A;  1FC4 A;  4CXQ A;  1DGD A;  5DJ1 A;  5FT4 A;  1BQA A;  2CJD A;  4TV7 A;  3WCO A;  1AAW A;  3JU7 A;  4E3Q A;  1U08 A;  4R8D A;  1KL2 A;  1MAQ A;  2AY5 A;  1E5E A;  3FRK A;  2HP1 A;  3PDB B;  1B5P A;  4XJL A;  3HLM A;  3AOW A;  2D63 A;  4RAE A;  2AY7 A;  4A0F A;  1LW4 A;  3MC6 C;  1AY4 A;  1AJR A;  1G7W A;  1M0Q A;  3N4X A;  5G2Q A;  5HXX A;  3OP7 A;  5D5S A;  2D5Y A;  1ECX A;  3NUB A;  4KYO A;  4OC9 A;  3ZZK A;  5BJ3 A;  3QN6 A;  1BS0 A;  3PJ0 A;  2R2N A;  4WB0 A;  4XK1 A;  4BHD A;  1TOK A;  4OMA A;  2E7I A;  4F5G A;  3DYD A;  1O61 A;  4ZM4 A;  1YAA A;  1ZOB A;  4U2H A;  1RV3 A;  1RVY A;  4IX8 A;  2QB2 A;  2O0R A;  4XEW A;  4U1T A;  1GD9 A;  2W8W A;  4ZWV A;  2C0R A;  2R5C B;  3RCH B;  3QHX A;  1WKG A;  1CL1 A;  2VMW A;  3LV2 A;  4A72 A;  3WCN A;  3QGU A;  5G2P A;  4LNL A;  2Z61 A;  4BQ0 A;  2OGA A;  2OAT A;  2YKV A;  4IXS A;  4KAM A;  1LW5 A;  3AEN A;  3MAF A;  1CQ6 A;  1N2T A;  2VGW A;  5F8V A;  4ATP A;  5G09 A;  2WB6 A;  1W7N A;  2VMN A;  1WYU B;  1LS3 A;  2AY3 A;  2AY6 A;  2FM1 A;  2W7G A;  2YHK A;  3P6K A;  3E2F A;  3KGX A;  4Q76 A;  1D7U A;  3A8U X;  4OBV A;  3ASB A;  4WYD A;  2R5E A;  5FT6 A;  1AMA A;  1FG7 A;  2EZ1 A;  4A6T A;  1TAS A;  3PDX A;  1GC0 A;  3ECD A;  1LC7 A;  4GE4 A;  5I92 A;  4H63 Q;  3BC8 A;  3FKD A;  1AKB A;  1G4X A;  3K28 A;  4TMR A;  5FT8 A;  3E77 A;  4WYA A;  4P7Y A;  2EZ2 A;  3UWC A;  4AH3 A;  2W7D A;  3D6K A;  1MGV A;  2W7H A;  3AV7 A;  2HUI A;  1H1C A;  2BI1 A;  4E3R A;  1IX6 A;  2YKY A;  4L0O A;  3I4J A;  5EUD A;  1ARG A;  2YRR A;  3BV0 A;  2EYQ A;  3A2B A;  4AOA A;  1DKA A;  4WXF A;  1X29 A;  1MDO A;  4JE5 A;  4ISY A;  4ADB A;  4CVQ A;  3R9A A;  3BN1 A;  3JW9 A;  1KL1 A;  3EUC A;  2FN6 A;  1I29 A;  1BJ4 A;  2W8T A;  3LY1 A;  3PDB A;  2QA3 A;  4I8A A;  1W23 A;  3NYS A;  1KMJ A;  5EAA A;  3GR9 A;  2EPJ A;  3AEM C;  3AEM A;  3WKR A;  3ZRR A;  2WK9 A;  3VK3 A;  2VMQ A;  4UQV A;  1ASL A;  2ORD A;  3BCB A;  4E1O A;  1JS3 A;  3E2Z B;  3W1J A;  1S0A A;  4W1V A;  1KKJ A;  1D7S A;  3FQ8 A;  1M32 A;  3FCR A;  3BCX A;  3HDO A;  3LVL B;  1QGN A;  2QB3 A;  3GSB A;  1AKA A;  4TN4 A;  4F5J A;  4JE5 D;  1GCK A;  1BJN A;  3MAU A;  4WXB A;  3JWB A;  2OGE A;  2DOU A;  2Z9V A;  3A9X A;  1BJO B;  2R5C A;  3RCH A;  3ACZ A;  1H0C A;  3BWN A;  1YJS A;  3CAI A;  2JJE A;  3WLX A;  2YKX A;  1QIT A;  1OXP A;  3I16 A;  2HUU A;  3ZRP A;  2W8U A;  4CXR A;  1OAT A;  1PMO A;  1S09 A;  3VOM A;  1PG8 A;  2DGM A;  2YKU A;  1BW0 A;  5LHA A;  3F0H A;  4Q6R A;  3E6G A;  4KXK A;  5EQC A;  4R5Z A;  1VJO A;  2VMX A;  2YOB A;  1AMQ A;  1ZC9 A;  2VMR A;  1N31 A;  3AEN B;  4XJM A;  4MQQ A;  4DQ6 A;  1WYU A;  2D7Y A;  2DKB A;  4N0W A;  3FVU A;  3DOD A;  4HVK A;  2Z1Z A;  2VMV A;  1YJZ A;  1CZC A;  1AAM A;  4ZSW A;  2HP2 A;  2VIB A;  2W8V A;  3NU8 A;  1KAF A;  2CJH A;  1QZ9 A;  1SZS A;  1WKH A;  4WBT A; 
#chains in the Genus database with same CATH homology
 4XJO A;  1LK9 A;  2ZJG A;  3WX9 A;  4RJ0 A;  4LNM A;  1EQB A;  2CJG A;  4JEX A;  1AHG A;  3I5T A;  3GET A;  2CIN A;  1ASC A;  4RM1 A;  3TFT A;  3DU4 A;  2HOR A;  4ATQ A;  3EI7 A;  2V1P A;  2BWP A;  4LC3 A;  4MQP A;  1JS6 A;  1MLY A;  4JEW A;  1Z3Z A;  2EO5 A;  2BYL A;  4UHM A;  1M0O A;  3AEP A;  3TAT A;  4ADC A;  1P3W A;  4AO4 A;  1EG5 A;  1CZE A;  1BT4 A;  2CST A;  1E5F A;  3N4R A;  1LKC A;  1IX8 A;  1S06 A;  4F4E A;  3FTB A;  3GJU A;  4LNJ A;  3E2Z A;  2AY4 A;  1S08 A;  3ASA A;  3FFH A;  5EAV A;  2VMP A;  2JIS A;  3AEJ C;  3EI6 A;  1IUG A;  2HZP A;  3AEJ A;  4UHO A;  4W1W A;  4WLJ A;  3B1E A;  1ARH A;  3PAA A;  1B9I A;  3HQT A;  4K2M A;  1YNU A;  1G4V A;  1ASG A;  1JF9 A;  2VMY A;  1GC3 A;  1BJO A;  1D7V A;  2VGV A;  4WYE A;  5DB5 A;  5HHY A;  3RQ1 A;  1LC5 A;  4WYG A;  4EB5 A;  5EUE A;  4JEY A;  3BS8 A;  4WXG A;  4EFF A;  5DJ9 A;  2CY8 A;  4CBS A;  3A9Y A;  4M2M A;  4PFF A;  1SF2 A;  2VLF A;  3G7Q A;  3LVJ A;  4A6U A;  5M49 A;  3K40 A;  4F5L A;  1GEX A;  2GSA A;  2Z9U A;  4K2I A;  2HOZ A;  3NDN A;  3CBF A;  4ZDP A;  1O62 A;  3NYT A;  3RBF A;  2ZY4 A;  2VGU A;  3MBB A;  2F8J A;  1CL2 A;  1B5O A;  1XI9 A;  3PPL A;  2QSR A;  1AY5 A;  1C7O A;  4DGT A;  5M4B A;  4IY7 A;  2ZY2 A;  5EIG A;  2JJG A;  3NTJ A;  1EJI A;  5E4Z A;  3QPG A;  3NUI A;  3ISL A;  1MAP A;  4GE9 A;  5DX5 A;  3N7N A;  4Q75 A;  2ZY5 A;  3NX3 A;  4ADD A;  4BMK A;  8AAT A;  2CB1 A;  1SFF A;  1CS1 A;  2W7J A;  3JWA A;  3BCA A;  1ELQ A;  2BWO A;  3GZD C;  1YJY A;  2CTZ A;  3GZD A;  4GEB A;  3VK2 A;  4Y0I A;  1AJS B;  2VMT A;  3PGY A;  5G4J A;  3N5M A;  1ART A;  2PB2 A;  2VGS A;  3L44 A;  2W7I A;  3N4S A;  2C7T A;  3FD0 A;  2ZC0 A;  4W8I A;  3T32 A;  2X8U A;  3AEO A;  3ATH A;  3GBX A;  3LVK A;  3N75 A;  4FL0 A;  2W7M A;  4MSO A;  4W5K A;  3VAX A;  4F5M A;  2D66 A;  3B1D A;  4GE7 A;  1GEW A;  2Z9W A;  4MGR A;  3FDD A;  1RVU A;  2W7E A;  1J04 A;  2DKJ A;  1W7L A;  2XBN A;  3AAT A;  3B1C A;  3HMU A;  2W7L A;  2C81 A;  3EI9 A;  3N0L A;  4K2B A;  2FKI A;  3KGW A;  2VGZ A;  3NU7 A;  4PFN A;  3FFR A;  2EH6 A;  4ZAS A;  4A0R A;  2VMU A;  1I43 A;  1CJ0 A;  2CH2 A;  3FDB A;  2G6W A;  3CQ6 A;  1Z7D A;  1FG3 A;  4H51 A;  4ZSY A;  2GMU A;  2AY1 A;  3FVX A;  4WLH A;  4ZWM A;  2G7J A;  1TAT A;  2VMS A;  2AY8 A;  4WD2 A;  4OYT A;  3EI8 A;  3BWN C;  2BI2 A;  3TQX A;  5FT5 A;  2CAN A;  4JEZ A;  3WKS A;  4E77 A;  1DFO A;  4AO9 A;  2QLR A;  1G7X A;  4K05 A;  2AEU A;  2HOX A;  3KE3 A;  4OBU A;  2WK7 A;  1AHY A;  1ASF A;  1IAX A;  2TPL A;  5KTB A;  3FQ7 A;  4CBR A;  3FZ7 A;  1WYV A;  4WP0 A;  2VGT A;  3RBL A;  4OT8 A;  1ZOD A;  1C9C A;  2BIG A;  2OKK A;  4GSA A;  1D2F A;  1UKJ A;  1CQ7 A;  4MKK A;  2FNI A;  5M46 A;  4F5F A;  5EIG B;  1IX7 A;  4OTL A;  3DZZ A;  5G4I A;  2FQ6 A;  4BA4 A;  2GB3 A;  2CFB A;  1JG8 A;  3H7F A;  2GMS A;  2OQX A;  1SZU A;  1B9H A;  2GQN A;  2W7K A;  3W1H A;  1KKP A;  2WKA A;  4MQR A;  4MKJ A;  1GDE A;  1AHF A;  1X0M A;  3LG0 A;  4M2J A;  2Q7W A;  1TOI A;  1AJS A;  1OHV A;  2FYF A;  2JG2 A;  2E7U A;  3DR4 A;  1LC8 A;  4XJP A;  4B9B A;  2BYJ A;  1WYT A;  2E54 A;  3FZ8 A;  1OHY A;  1IAY A;  1YIY A;  1T3I A;  1W3U A;  2NMP A;  1QIS A;  5M4D A;  2X3L A;  1WST A;  1SPA A;  4RLG A;  3QM2 A;  4P3M A;  3B46 A;  2YCN A;  1C7G A;  1IBJ A;  3Q8N A;  2BI3 A;  2DGL A;  3HT4 A;  1B4X A;  2ZYJ A;  1YOO A;  3II0 A;  5TF5 A;  3HVY A;  4RJY A;  3PIU A;  2W8J A;  3EZS A;  3TFU A;  1J32 A;  1MDZ A;  2BIA A;  2W7F A;  3G8M A;  4ZM3 A;  4IW7 A;  2V0Y A;  3L8A A;  3DC1 A;  3H9X A;  2JJH A;  2BIE A;  2ZP7 A;  4NOG A;  1AKC A;  2YCT A;  2YCP A;  1IVR A;  3LVM A;  3VK4 A;  2AY2 A;  4ITG A;  4ZLV A;  1BJW A;  1MDX A;  4ITX A;  1QJ5 A;  2E7J A;  3UE8 A;  2DGK A;  1PFF A;  2BWN A;  1BQD A;  1V2F A;  3B8X A;  1AMS A;  3DRD A;  4RIZ A;  3RI6 A;  1D7R A;  1I48 A;  4LW2 A;  2YRI A;  3PD6 B;  4N0B A;  3ZRQ A;  3WY7 A;  1QJ3 A;  3MC6 A;  2PO3 A;  5G0A A;  5J8Q A;  4O6Z A;  1DJ9 A;  1V72 A;  3ELP A;  3GZC A;  4Y0H A;  2BKW A;  2C44 A;  3E2Y A;  1GC2 A;  3PA9 A;  2D64 A;  1M7Y A;  4JF0 A;  2CH1 A;  1WYV B;  3FZ6 A;  3RUY A;  4BA5 A;  5BJ4 A;  2ZSM A;  3JTX A;  1TPL A;  4J5U A;  1DTY A;  4IXZ A;  5JAY A;  2OKJ A;  1Y4I A;  1ASE A;  1TOG A;  2O1B A;  5K8B A;  2HOY A;  3F9T A;  2EGY A;  3BWO A;  3COG A;  1ARS A;  4A00 A;  4ZAH A;  1X2A A;  5D95 A;  1C0N A;  3ZZJ A;  3WGB A;  1AHE A;  3NYU A;  2Z67 A;  1OXO A;  1B8G A;  4IYO B;  3R4T A;  2Z1Y A;  2VMZ A;  1UU1 A;  1AIB A;  5HDM A;  4WYF A;  1WYT B;  4UHN A;  1O4S A;  1C4K A;  5F9S A;  2VI8 A;  2XH1 A;  3HL2 A;  3EZ1 A;  1AIA A;  1M6S A;  5E5I A;  5EUN A;  1AIC A;  4AZK A;  5AX8 A;  2D61 A;  2X5D A;  2BI9 A;  1VP4 A;  1S07 A;  1SVV A;  4GDY A;  4W91 A;  2VLH A;  3EIB A;  3ELE A;  1M0N A;  4J8L A;  1I41 A;  3GWP A;  3EIA A;  1N8P A;  3KKI A;  9AAT A;  1SZK A;  2WK8 A;  4ZDO A;  1DJU A;  1MLZ A;  3QBO A;  3OKS A;  1DGE A;  1YIZ A;  2QMA A;  3HBX A;  2Z9X A;  1ASB A;  2VIA A;  4EB7 A;  4EU1 A;  3DXV A;  3P1T A;  3EI5 A;  3DR7 A;  3QI6 A;  4AZJ A;  4GRX A;  7AAT A;  1RV4 A;  1ARI A;  4PVF A;  4RIT A;  1ORD A;  2VYC A;  3E9K A;  3VP6 A;  4M2K A;  1TOE A;  1DJE A;  3AOV A;  3F6T A;  4Y0D A;  1TAR A;  4Q31 A;  2RFV A;  4OCA A;  4F5K A;  4UOY A;  1ASD A;  2BHX A;  4HF8 A;  5E3K A;  4A0G A;  3PD6 A;  4RKD A;  2ZY3 A;  4XQ2 A;  3FQA A;  3G0T A;  3USF A;  4PIW A;  3A9Z A;  3MEB A;  4QGR A;  3WGC A;  2VI9 A;  2DR1 A;  5EFS A;  2D65 A;  1UU0 A;  3LWS A;  2ZUK A;  4W1X A;  5LH9 A;  3NNK A;  1X28 A;  1ASN A;  2JGT A;  1AY8 A;  1QIR A;  4LW4 A;  4R5F A;  4DBC A;  1AX4 A;  1M4N A;  3FSL A;  2FNU A;  2R0T A;  5C6U A;  5IWQ A;  4JEV A;  4ZDL A;  4WB0 B;  1ELU A;  1O69 A;  3W1I A;  3H14 A;  4XAU A;  4R2N A;  4WYC A;  2HUF A;  3WZF A;  4B98 A;  2JJF A;  1AHX A;  1AMR A;  1V2E A;  4MY5 A;  4F5I A;  4FFC A;  1ASA A;  2X5F A;  2ZSL A;  1ASM A;  3CQ4 A;  3IF2 A;  3K7Y A;  3NRA A;  1W7M A;  4IYO A;  3UAK A;  3DXW A;  1KMK A;  1PMM A;  3AEL A;  4ADE A;  4A0H A;  1UU2 A;  4IXO A;  1M0P A;  3BB8 A;  2BI5 A;  3MAF B;  4RKC A;  3IHJ A;  1TOJ A;  2AAT A;  2KFP A;  1C7N A;  1XEY A;  3M5U A;  2AY9 A;  1OHW A;  1VEF A;  3MAD A;  1IJI A;  2PB0 A;  4EMY A;  2VMO A;  1BKG A;  1GBN A;  2D7Z A;  2O7C A;  2A1V A;  2AEV A;  4A6R A;  3JZL A;  1CQ8 A;  1GC4 A;  4F5H A;  1V2D A;  2Z20 A;  3FVS A;  3CQ5 A;  1GEY A;  3TCM A;  3MKJ A;  4JF1 A;  2QBT A;  1FC4 A;  4CXQ A;  1DGD A;  5DJ1 A;  5FT4 A;  1BQA A;  2CJD A;  4TV7 A;  3WCO A;  1AAW A;  3JU7 A;  4E3Q A;  1U08 A;  4R8D A;  1KL2 A;  1MAQ A;  2AY5 A;  1E5E A;  3FRK A;  2HP1 A;  3PDB B;  1B5P A;  4XJL A;  3HLM A;  3AOW A;  2D63 A;  4RAE A;  2AY7 A;  4A0F A;  1LW4 A;  3MC6 C;  1AY4 A;  1AJR A;  1G7W A;  1M0Q A;  3N4X A;  5G2Q A;  5HXX A;  3OP7 A;  5D5S A;  2D5Y A;  1ECX A;  3NUB A;  4KYO A;  4OC9 A;  3ZZK A;  5BJ3 A;  3QN6 A;  1BS0 A;  3PJ0 A;  2R2N A;  4WB0 A;  4XK1 A;  4BHD A;  1TOK A;  4OMA A;  2E7I A;  4F5G A;  3DYD A;  1O61 A;  4ZM4 A;  1YAA A;  1ZOB A;  4U2H A;  1RV3 A;  1RVY A;  4IX8 A;  2QB2 A;  2O0R A;  4XEW A;  4U1T A;  1GD9 A;  2W8W A;  4ZWV A;  2C0R A;  2R5C B;  3RCH B;  3QHX A;  1WKG A;  1CL1 A;  2VMW A;  3LV2 A;  4A72 A;  3WCN A;  3QGU A;  5G2P A;  4LNL A;  2Z61 A;  4BQ0 A;  2OGA A;  2OAT A;  2YKV A;  4IXS A;  4KAM A;  1LW5 A;  3AEN A;  3MAF A;  1CQ6 A;  1N2T A;  2VGW A;  5F8V A;  4ATP A;  5G09 A;  2WB6 A;  1W7N A;  2VMN A;  1WYU B;  1LS3 A;  2AY3 A;  2AY6 A;  2FM1 A;  2W7G A;  2YHK A;  3P6K A;  3E2F A;  3KGX A;  4Q76 A;  1D7U A;  3A8U X;  4OBV A;  3ASB A;  4WYD A;  2R5E A;  5FT6 A;  1AMA A;  1FG7 A;  2EZ1 A;  4A6T A;  1TAS A;  3PDX A;  1GC0 A;  3ECD A;  1LC7 A;  4GE4 A;  5I92 A;  4H63 Q;  3BC8 A;  3FKD A;  1AKB A;  1G4X A;  3K28 A;  4TMR A;  5FT8 A;  3E77 A;  4WYA A;  4P7Y A;  2EZ2 A;  3UWC A;  4AH3 A;  2W7D A;  3D6K A;  1MGV A;  2W7H A;  3AV7 A;  2HUI A;  1H1C A;  2BI1 A;  4E3R A;  1IX6 A;  2YKY A;  4L0O A;  3I4J A;  5EUD A;  1ARG A;  2YRR A;  3BV0 A;  2EYQ A;  3A2B A;  4AOA A;  1DKA A;  4WXF A;  1X29 A;  1MDO A;  4JE5 A;  4ISY A;  4ADB A;  4CVQ A;  3R9A A;  3BN1 A;  3JW9 A;  1KL1 A;  3EUC A;  2FN6 A;  1I29 A;  1BJ4 A;  2W8T A;  3LY1 A;  3PDB A;  2QA3 A;  4I8A A;  1W23 A;  3NYS A;  1KMJ A;  5EAA A;  3GR9 A;  2EPJ A;  3AEM C;  3AEM A;  3WKR A;  3ZRR A;  2WK9 A;  3VK3 A;  2VMQ A;  4UQV A;  1ASL A;  2ORD A;  3BCB A;  4E1O A;  1JS3 A;  3E2Z B;  3W1J A;  1S0A A;  4W1V A;  1KKJ A;  1D7S A;  3FQ8 A;  1M32 A;  3FCR A;  3BCX A;  3HDO A;  3LVL B;  1QGN A;  2QB3 A;  3GSB A;  1AKA A;  4TN4 A;  4F5J A;  4JE5 D;  1GCK A;  1BJN A;  3MAU A;  4WXB A;  3JWB A;  2OGE A;  2DOU A;  2Z9V A;  3A9X A;  1BJO B;  2R5C A;  3RCH A;  3ACZ A;  1H0C A;  3BWN A;  1YJS A;  3CAI A;  2JJE A;  3WLX A;  2YKX A;  1QIT A;  1OXP A;  3I16 A;  2HUU A;  3ZRP A;  2W8U A;  4CXR A;  1OAT A;  1PMO A;  1S09 A;  3VOM A;  1PG8 A;  2DGM A;  2YKU A;  1BW0 A;  5LHA A;  3F0H A;  4Q6R A;  3E6G A;  4KXK A;  5EQC A;  4R5Z A;  1VJO A;  2VMX A;  2YOB A;  1AMQ A;  1ZC9 A;  2VMR A;  1N31 A;  3AEN B;  4XJM A;  4MQQ A;  4DQ6 A;  1WYU A;  2D7Y A;  2DKB A;  4N0W A;  3FVU A;  3DOD A;  4HVK A;  2Z1Z A;  2VMV A;  1YJZ A;  1CZC A;  1AAM A;  4ZSW A;  2HP2 A;  2VIB A;  2W8V A;  3NU8 A;  2CJH A;  1QZ9 A;  1SZS A;  1WKH A;  4WBT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...