2AY4A

Aromatic amino acid aminotransferase with 3-(p-tolyl)propionic acid
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
sequence length
394
structure length
394
Chain Sequence
MLGNLKPQAPDKILALMGEFRADPRQGKIDLGVGVYKDATGHTPIMRAVHAAEQRMLETETTKTYAGLSGEPEFQKAMGELILGDGLKSETTATLATVGGTGALRQALELARMANPDLRVFVSDPTWPNHVSIMNFMGLPVQTYRYFDAETRGVDFEGMKADLAAAKKGDMVLLHGCCHNPTGANLTLDQWAEIASILEKTGALPLIDLAYQGFGDGLEEDAAGTRLIASRIPEVLIAASCSKNFGIYRERTGCLLALCADAATRELAQGAMAFLNRQTYSFPPFHGAKIVSTVLTTPELRADWMAELEAVRSGMLRLREQLAGELRDLSGSDRFGFVAEHRGMFSRLGATPEQVKRIKEEFGIYMVGDSRINIAGLNDNTIPILARAIIEVGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The active site of Paracoccus denitrificans aromatic amino acid aminotransferase has contrary properties: flexibility and rigidity.
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Aminotransferase
molecule keywords AROMATIC AMINO ACID AMINOTRANSFERASE
total genus 146
structure length 394
sequence length 394
chains with identical sequence B
ec nomenclature ec 2.6.1.57: Aromatic-amino-acid transaminase.
pdb deposition date 1998-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 2ay4A02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 2ay4A01
4E3RA 4ZDOA 4LNMA 2ZY3A 3A8UX 1MLYA 2E7JA 1ASAA 2VGSA 4IY7A 3MADA 4ZM3A 3HDOA 2W7EA 4ADEA 4Q31A 1BQAA 3TFTA 3DC1A 4GEBA 1LS3A 3R4TA 1LC5A 1AJSA 1U08A 2WK8A 2BI5A 2D61A 1W23A 4B9BA 1WYUB 4EU1A 3KGXA 3RCHA 2JJEA 1KKPA 2EPJA 5FT4A 4XEWA 4ATPA 4F4EA 1SFFA 1O62A 3LVLB 2CH2A 3EI9A 1MDZA 3QBOA 3ZRPA 1PFFA 1SVVA 1D7RA 1TOJA 1ASGA 3E2YA 1BJOB 1C7GA 4F5IA 1AIAA 3EUCA 4EB5A 4XJPA 3A9YA 5C6UA 1AHXA 1IVRA 2VGUA 3HQTA 7AATA 4PFFA 4O6ZA 4UOYA 4RKCA 2OKJA 3N75A 1DFOA 2FNIA 2VMQA 2DOUA 5FT8A 4L0OA 3OP7A 3I4JA 4XJLA 4ZDLA 1I48A 1S06A 1YAAA 4Y0IA 3HLMA 1CQ8A 2D7YA 1ASNA 4IW7A 4RKDA 3FD0A 2DGMA 2ORDA 4WB0B 2DKJA 1IX6A 4ZLVA 3WY7A 2BIEA 2YHKA 2VMSA 5E4ZA 3VAXA 3EI8A 2HUFA 4WYCA 1SZUA 2JISA 3RBFA 1RV3A 1X29A 5EUDA 1N2TA 1G4XA 3FFRA 3VK3A 4WB0A 2BIGA 1AKAA 5FT5A 3NRAA 2PB0A 3FZ8A 4JEWA 4LC3A 4A6TA 3H7FA 2CINA 3NUBA 4P3MA 4J8LA 4A00A 2CTZA 1N31A 3CQ4A 3LVKA 4OBVA 4A0RA 4AO4A 1VEFA 4UQVA 4UHMA 1TOIA 4K2MA 5G4IA 1CL1A 1G7XA 2HUUA 3PDBB 4JEYA 5D95A 3ASBA 2W8WA 1IX8A 3G0TA 1SZSA 2CY8A 2CANA 3B46A 3HT4A 1X0MA 4KXKA 1DKAA 3A9XA 3FCRA 3AEMC 2CJDA 4EMYA 3A2BA 4WLHA 4U1TA 1TOKA 4N0BA 1LW4A 4Q76A 1KKJA 2V1PA 3NU7A 3JWAA 5M49A 1AY4A 1AICA 4WYGA 3R9AA 3CBFA 1IUGA 1D2FA 1M0PA 1DGDA 2R0TA 3BS8A 1O61A 3AOWA 3E2ZA 1SPAA 3WGBA 2AY3A 3PD6B 1P3WA 1TASA 3DXWA 1OATA 2AATA 5DJ9A 2C81A 3GSBA 3A9ZA 3AEJC 3N5MA 4CXRA 3FZ6A 3AENA 2BWNA 2O0RA 3FQ8A 1AHYA 4MQQA 3JW9A 3BN1A 3AEOA 2JJGA 1C0NA 1Z7DA 1CQ6A 2NMPA 3ASAA 4RLGA 2E54A 3MEBA 3OKSA 3PDBA 3FDDA 2X8UA 3EI6A 2ZC0A 3CAIA 1J32A 2GB3A 5K8BA 5JAYA 4R2NA 4RAEA 2VGZA 2DR1A 2ZY2A 4P7YA 3RBLA 3NYUA 1BJWA 1G7WA 4Q75A 1DGEA 2YKXA 2R5EA 4OYTA 1V2DA 1D7SA 2Z9WA 3ELPA 1QISA 1GEWA 2Z67A 1MLZA 3FQAA 1TATA 4ITGA 1JF9A 2YKUA 1GC0A 2VMPA 4TMRA 4MY5A 1IX7A 2AY8A 3T32A 1B5PA 4NOGA 4Q6RA 4AZJA 1QGNA 5EQCA 2BWPA 3CQ5A 1W7NA 1AX4A 2R2NA 4WYFA 1ECXA 2W8UA 3KKIA 2W7JA 2HOYA 2HOXA 1QIRA 2ZP7A 5HHYA 3DRDA 3F6TA 2VMYA 1S07A 1MDXA 3AEPA 3NTJA 1ARGA 2DGKA 1WYVA 3BCAA 2D7ZA 4WBTA 3ECDA 1AJRA 1ASEA 2FYFA 2VIAA 4AOAA 4CBSA 4J5UA 5LHAA 5AX8A 4IXOA 3WLXA 3B1CA 1N8PA 2OGEA 2VIBA 3COGA 2BYJA 1PMOA 3RCHB 4M2KA 1RV4A 1W3UA 1TARA 1DJEA 1M0NA 1ZODA 2JJHA 1O4SA 1RVUA 1OHVA 3WGCA 1XI9A 4EFFA 2ZY5A 2AY7A 2YKVA 2ZSLA 1ASMA 1EJIA 2D63A 1GDEA 2VLFA 3EZSA 2F8JA 1GD9A 1TOGA 4WD2A 2GQNA 1JS3A 2ZYJA 4TN4A 2XBNA 3VK4A 2YRRA 4XK1A 2HUIA 4OCAA 4ISYA 1BQDA 1B8GA 1UU1A 1ASBA 4ADDA 3DR4A 3NX3A 3M5UA 1CS1A 1G4VA 1WYTB 3FZ7A 1ZOBA 3GR9A 2X5DA 2X5FA 5BJ4A 1BJ4A 1DJ9A 3WZFA 1IAXA 3ACZA 3ISLA 3UAKA 2CJGA 1JG8A 4GE7A 1IJIA 5FT6A 3BB8A 1WKHA 1BKGA 1I43A 5BJ3A 1TPLA 2Z9VA 4LW4A 4W5KA 1MAPA 2AY9A 2BHXA 2JGTA 2QA3A 2VYCA 1YIZA 4MQRA 4ZASA 2VI8A 2CB1A 3FTBA 3FVUA 3GETA 1BS0A 4U2HA 4ZM4A 1ARHA 2YKYA 4XJOA 4WP0A 9AATA 4ZAHA 1C9CA 1WYVB 1BJOA 1YJYA 1LKCA 4Y0DA 4B98A 1DJUA 2YCNA 5M4DA 1PG8A 4M2MA 2WK9A 3EIBA 4RITA 4GRXA 1M7YA 2AEUA 1CL2A 2C0RA 3PAAA 1DTYA 2QMAA 2YRIA 2VI9A 4W1VA 1AMAA 4TV7A 1X2AA 3QPGA 1S08A 3N0LA 2W7HA 3W1IA 3B8XA 1OHWA 1M4NA 2W8JA 2BIAA 3G8MA 1C7NA 3FDBA 1VP4A 4GDYA 3DODA 3TATA 1MGVA 4DQ6A 5EIGA 4WYEA 3MBBA 5DX5A 4A0HA 2VLHA 3MC6C 3BCBA 4HVKA 2ZJGA 4KAMA 1V2FA 5HDMA 2ZY4A 1V2EA 1LC7A 4JF0A 2W7DA 1UU2A 1V72A 2BI9A 1AKBA 3MAUA 4RJ0A 1CQ7A 2OGAA 3AV7A 1LK9A 2AY2A 5EAAA 3EIAA 1YOOA 4A0FA 2D64A 2WKAA 3P6KA 4EB7A 4XJMA 4OC9A 3P1TA 2VGVA 4FL0A 2E7IA 2EZ1A 3AELA 4AZKA 4E1OA 3USFA 1ZC9A 1WSTA 3NUIA 2FQ6A 8AATA 1GBNA 1YIYA 2DKBA 4CBRA 4BA5A 3Q8NA 1ASCA 2FNUA 4ZDPA 4BA4A 1B9HA 2VMTA 3K40A 2W7IA 3KE3A 2O7CA 2W7FA 2W8TA 5EIGB 1H0CA 3K28A 3G7QA 4GE9A 5EFSA 4MKKA 2HOZA 2YCTA 1AMQA 2C44A 3QN6A 1B9IA 3JWBA 3ATHA 5G4JA 4ADCA 1MDOA 4ITXA 2Z9UA 4F5FA 3LVJA 3MKJA 1BJNA 3AEJA 4JE5D 1XEYA 1CJ0A 3PPLA 3E77A 1S09A 4Y0HA 4OTLA 2QB3A 1E5FA 3RI6A 4LNJA 1ARIA 2JJFA 3GZDC 2BI2A 2ZSMA 3WCNA 3WX9A 1AAWA 1C4KA 4DGTA 1M0QA 3MAFB 4W8IA 3L8AA 3AOVA 1ASLA 4BQ0A 3DU4A 3CQ6A 1FG7A 3E2FA 2OQXA 5HXXA 4RIZA 2YCPA 1YNUA 2AEVA 4W91A 1GCKA 2Z20A 3I16A 4DBCA 3VK2A 2W7LA 3W1JA 1B4XA 1O69A 4A72A 1ELUA 1ARSA 2VMZA 3LV2A 5EAVA 2QB2A 3NYSA 4CXQA 1YJSA 1OXPA 4IX8A 4MSOA 2CFBA 3BV0A 3QM2A 3LVMA 2PO3A 2GSAA 4A6UA 1KMKA 3HVYA 2OATA 1FC4A 5EUEA 4JF1A 3FSLA 5M46A 4W1WA 1BW0A 5M4BA 3GZCA 2D65A 4CVQA 1AMRA 1SF2A 1VJOA 2CSTA 4OT8A 4RJYA 3TFUA 4BMKA 3LG0A 1WYTA 3FVSA 3W1HA 3BWNA 4OBUA 1EG5A 2AY1A 1GC2A 1SZKA 3PD6A 3DXVA 4WYDA 2DGLA 4ZWVA 4W1XA 1QZ9A 4KYOA 1W7MA 1OXOA 3KGWA 2E7UA 1AHFA 5LH9A 2HORA 4MGRA 4E77A 3BCXA 3VP6A 4F5LA 2C7TA 2JG2A 5F8VA 2XH1A 2HZPA 3F9TA 1WKGA 3QI6A 4WXBA 4XQ2A 3IHJA 1I29A 4QGRA 3LWSA 1KL1A 3AATA 4LNLA 2VMVA 4IYOA 1CZEA 1GEYA 1IBJA 1H1CA 3II0A 4WLJA 3ELEA 3EI7A 4ADBA 2VGTA 3ZZKA 3RQ1A 3GJUA 2GMSA 2VMXA 2R5CA 1FG3A 1LW5A 3MC6A 4E3QA 4JEXA 1GC4A 3FQ7A 3JZLA 5I92A 2BWOA 2QBTA 5IWQA 1ORDA 1QJ3A 3HMUA 2W7GA 5DJ1A 4PIWA 4WYAA 4FFCA 1RVYA 1X28A 3B1DA 4IYOB 1Z3ZA 1OHYA 3EZ1A 2OKKA 1M0OA 3NDNA 4PFNA 1AHEA 2AY6A 2FN6A 4OMAA 1KL2A 1IAYA 1M32A 3TQXA 1UKJA 5G2QA 1J04A 3FVXA 2GMUA 4MKJA 3E2ZB 1AY8A 2ZUKA 3FKDA 1E5EA 2Z1ZA 2W7MA 3BWOA 4JEVA 4JEZA 2BYLA 1ASDA 2YOBA 2O1BA 1I41A 1QJ5A 3PA9A 2VMRA 1PMMA 4UHNA 5D5SA 3DYDA 3UE8A 1JS6A 3WCOA 4WXGA 1D7VA 4F5HA 1W7LA 4MQPA 1AY5A 3E6GA 4AO9A 2VMUA 3JTXA 2W7KA 5TF5A 2EH6A 1UU0A 3GWPA 4PVFA 2WK7A 2EGYA 4R5ZA 4UHOA 3TCMA 3WKSA 4A6RA 3HL2A 2W8VA 4M2JA 4IXZA 1WYUA 4JE5A 3K7YA 2BI1A 3RUYA 1ARTA 5G09A 4ZSYA 2BKWA 3FFHA 3WKRA 2CJHA 3I5TA 2HP2A 1S0AA 4BHDA 1LC8A 2D5YA 3AENB 4ZWMA 1AAMA 1AIBA 4N0WA 3BC8A 3QHXA 1YJZA 4F5JA 2VMWA 1AMSA 1D7UA 3JU7A 3FRKA 3MAFA 5E3KA 4IXSA 2EO5A 4GE4A 1KMJA 2D66A 3NNKA 2V0YA 2VMNA 3ZRRA 3NU8A 3ZRQA 1C7OA 3BWNC 4GSAA 2X3LA 1GC3A 3EI5A 1BT4A 1B5OA 2RFVA 4RM1A 4K2BA 1EQBA 5G0AA 5J8QA 1ASFA 2PB2A 2FM1A 4F5MA 4F5KA 4XAUA 1M6SA 2VGWA 2AY4A 2AY5A 2HP1A 1QITA 2Q7WA 3E9KA 4ATQA 2G6WA 2Z1YA 2TPLA 3HBXA 2BI3A 1MAQA 3IF2A 3VOMA 2CH1A 4K2IA 2R5CB 3GBXA 3L44A 1CZCA 3H14A 2EZ2A 1TOEA 2VMOA 3PDXA 3QGUA 4I8AA 4LW2A 5F9SA 3PGYA 4WXFA 3UWCA 2Z61A 4ZSWA 3ZZJA 1Y4IA 5E5IA 3PIUA 3PJ0A 3F0HA 5G2PA 4A0GA 3GZDA 3B1EA 3DZZA 1ELQA 3LY1A 4H51A 4AH3A 2QLRA 2Z9XA 1AHGA 4HF8A 1AKCA 3NYTA 4R8DA 3AEMA 5DB5A 1T3IA 3D6KA 4F5GA 5EUNA 4R5FA 3DR7A 1GEXA 1AJSB
chains in the Genus database with same CATH superfamily
4E3RA 4ZDOA 4LNMA 2ZY3A 3A8UX 1MLYA 2E7JA 1ASAA 2VGSA 3N4SA 4IY7A 3MADA 4ZM3A 3HDOA 2W7EA 4ADEA 4Q31A 1BQAA 3TFTA 3DC1A 4GEBA 1LS3A 3R4TA 1LC5A 1AJSA 1U08A 2WK8A 2BI5A 2D61A 1W23A 4B9BA 1WYUB 4EU1A 3KGXA 3RCHA 2JJEA 1KKPA 2EPJA 5FT4A 4XEWA 4ATPA 4F4EA 1SFFA 1O62A 3LVLB 2CH2A 3EI9A 1MDZA 3QBOA 3ZRPA 1PFFA 1SVVA 1D7RA 1TOJA 1ASGA 3E2YA 1BJOB 1C7GA 4F5IA 1AIAA 3EUCA 4EB5A 4XJPA 3A9YA 5C6UA 1AHXA 1IVRA 2VGUA 3HQTA 7AATA 4PFFA 4O6ZA 4UOYA 4RKCA 2OKJA 3N75A 1DFOA 2FNIA 2VMQA 2DOUA 5FT8A 4L0OA 3OP7A 3I4JA 4XJLA 4ZDLA 1I48A 1S06A 1YAAA 4Y0IA 3HLMA 1CQ8A 2D7YA 1ASNA 4IW7A 4RKDA 3FD0A 2DGMA 2ORDA 4WB0B 2DKJA 1IX6A 4ZLVA 3WY7A 2BIEA 2YHKA 2VMSA 5E4ZA 3VAXA 3EI8A 2HUFA 4WYCA 1SZUA 2JISA 3RBFA 1RV3A 1X29A 5EUDA 1N2TA 1G4XA 3FFRA 3VK3A 4WB0A 2BIGA 1AKAA 5FT5A 3NRAA 2PB0A 3FZ8A 4JEWA 4LC3A 4A6TA 3H7FA 2CINA 3NUBA 4P3MA 4J8LA 4A00A 2CTZA 1N31A 3CQ4A 3LVKA 4OBVA 4A0RA 4AO4A 1VEFA 4UQVA 4UHMA 1TOIA 4K2MA 5G4IA 1CL1A 1G7XA 2HUUA 3PDBB 4JEYA 5D95A 3ASBA 2W8WA 1IX8A 3G0TA 1SZSA 2CY8A 2CANA 3B46A 3HT4A 1X0MA 2G7JA 4KXKA 1DKAA 3A9XA 3FCRA 3AEMC 2CJDA 4EMYA 3A2BA 4WLHA 4U1TA 1TOKA 4N0BA 1LW4A 4Q76A 1KKJA 2V1PA 3NU7A 3JWAA 5M49A 1AY4A 1AICA 4WYGA 3R9AA 3CBFA 1IUGA 1D2FA 1M0PA 1DGDA 2R0TA 3BS8A 1O61A 3AOWA 3E2ZA 1SPAA 3WGBA 2AY3A 3PD6B 1P3WA 1TASA 3DXWA 1OATA 2AATA 5DJ9A 2C81A 3GSBA 3A9ZA 3AEJC 3N5MA 4CXRA 3FZ6A 3AENA 2BWNA 2O0RA 3FQ8A 1AHYA 4MQQA 3JW9A 3BN1A 3AEOA 2JJGA 1C0NA 1Z7DA 1CQ6A 2NMPA 3ASAA 4RLGA 2E54A 3MEBA 3OKSA 3PDBA 3FDDA 2X8UA 3EI6A 2ZC0A 3CAIA 1J32A 2GB3A 5K8BA 5JAYA 4R2NA 4RAEA 2VGZA 2DR1A 2ZY2A 4P7YA 3RBLA 3NYUA 1BJWA 1G7WA 4Q75A 1DGEA 2YKXA 2R5EA 4OYTA 1V2DA 1D7SA 2Z9WA 3ELPA 1QISA 1GEWA 2Z67A 1MLZA 3FQAA 1TATA 4ITGA 1JF9A 2YKUA 1GC0A 2VMPA 4TMRA 4MY5A 1IX7A 2AY8A 3T32A 1B5PA 4NOGA 4Q6RA 4AZJA 1QGNA 5EQCA 2BWPA 3CQ5A 1W7NA 1AX4A 2R2NA 4WYFA 1ECXA 2W8UA 3KKIA 2W7JA 2HOYA 2HOXA 1QIRA 2ZP7A 5HHYA 3DRDA 3F6TA 2VMYA 1S07A 1MDXA 3AEPA 3NTJA 1ARGA 2DGKA 1WYVA 3BCAA 2D7ZA 4WBTA 3ECDA 1AJRA 1ASEA 2FYFA 2VIAA 4AOAA 4CBSA 4J5UA 5LHAA 5AX8A 4IXOA 3WLXA 3B1CA 1N8PA 2OGEA 2VIBA 3COGA 2BYJA 1PMOA 3RCHB 4M2KA 1RV4A 1W3UA 1TARA 1DJEA 1M0NA 1ZODA 2JJHA 1O4SA 1RVUA 1OHVA 3WGCA 1XI9A 4EFFA 2ZY5A 2AY7A 2YKVA 2ZSLA 1ASMA 1EJIA 2D63A 1GDEA 2VLFA 3EZSA 2F8JA 1GD9A 1TOGA 4WD2A 4K05A 2GQNA 1JS3A 2ZYJA 4TN4A 2XBNA 3VK4A 2YRRA 4XK1A 2HUIA 4OCAA 4ISYA 1BQDA 1B8GA 1UU1A 1ASBA 4ADDA 2EYQA 3DR4A 3NX3A 3M5UA 1CS1A 1G4VA 1WYTB 3FZ7A 1ZOBA 3GR9A 2X5DA 2X5FA 5BJ4A 1BJ4A 1DJ9A 3WZFA 1IAXA 3ACZA 3ISLA 3UAKA 2CJGA 1JG8A 4GE7A 1IJIA 5FT6A 3BB8A 1WKHA 1BKGA 1I43A 5BJ3A 1TPLA 2Z9VA 4LW4A 4W5KA 1MAPA 2AY9A 2BHXA 2JGTA 2QA3A 2VYCA 1YIZA 4MQRA 4ZASA 2VI8A 2CB1A 3FTBA 3FVUA 3GETA 1BS0A 4U2HA 4ZM4A 1ARHA 2YKYA 4XJOA 4WP0A 9AATA 4ZAHA 1C9CA 1WYVB 1BJOA 1YJYA 1LKCA 4Y0DA 4B98A 1DJUA 2YCNA 5M4DA 1PG8A 4M2MA 2WK9A 3EIBA 4RITA 4GRXA 1M7YA 2AEUA 1CL2A 2C0RA 3PAAA 1DTYA 2QMAA 2YRIA 2VI9A 4W1VA 1AMAA 4TV7A 1X2AA 3QPGA 1S08A 3N0LA 2W7HA 3W1IA 3B8XA 1OHWA 1M4NA 2W8JA 2BIAA 3G8MA 1C7NA 3FDBA 1VP4A 4GDYA 3DODA 3TATA 1MGVA 4DQ6A 5EIGA 4WYEA 3MBBA 5DX5A 4A0HA 2VLHA 3MC6C 3BCBA 4HVKA 2ZJGA 4KAMA 1V2FA 5HDMA 2ZY4A 1V2EA 1LC7A 5KTBA 4JF0A 2W7DA 1UU2A 1V72A 2BI9A 1AKBA 3MAUA 4RJ0A 1CQ7A 2OGAA 3AV7A 1LK9A 2AY2A 5EAAA 3EIAA 1YOOA 4A0FA 2D64A 2WKAA 3P6KA 4EB7A 2FKIA 4XJMA 4OC9A 3P1TA 2VGVA 4FL0A 2E7IA 2EZ1A 3AELA 4AZKA 4E1OA 4H63Q 3USFA 1ZC9A 1WSTA 3NUIA 2FQ6A 8AATA 1GBNA 1YIYA 2DKBA 4CBRA 4BA5A 3Q8NA 1ASCA 2FNUA 4ZDPA 4BA4A 1B9HA 2VMTA 3K40A 2W7IA 3KE3A 2O7CA 2W7FA 2W8TA 5EIGB 1H0CA 3K28A 3G7QA 4GE9A 5EFSA 4MKKA 2HOZA 2YCTA 1AMQA 2C44A 3QN6A 1B9IA 3JWBA 3ATHA 5G4JA 4ADCA 1MDOA 4ITXA 2Z9UA 4F5FA 3LVJA 3MKJA 1BJNA 3AEJA 4JE5D 1XEYA 1CJ0A 3PPLA 3E77A 1S09A 3N4XA 4Y0HA 4OTLA 2QB3A 1E5FA 3RI6A 4LNJA 1ARIA 2JJFA 3GZDC 2BI2A 2ZSMA 3WCNA 3WX9A 1AAWA 1C4KA 4DGTA 1M0QA 3MAFB 4W8IA 3N4RA 3L8AA 3AOVA 1ASLA 4BQ0A 3DU4A 3CQ6A 1FG7A 3E2FA 2OQXA 5HXXA 4RIZA 2YCPA 1YNUA 2AEVA 4W91A 1GCKA 2Z20A 3I16A 4DBCA 1KAFA 3VK2A 2W7LA 3W1JA 1B4XA 1O69A 4A72A 1ELUA 1ARSA 2VMZA 3LV2A 5EAVA 2QB2A 3NYSA 4CXQA 1YJSA 1OXPA 4IX8A 4MSOA 2CFBA 3BV0A 3QM2A 3LVMA 2PO3A 2GSAA 4A6UA 1KMKA 3HVYA 2OATA 1FC4A 5EUEA 4JF1A 3FSLA 5M46A 4W1WA 1BW0A 5M4BA 3GZCA 2D65A 4CVQA 1AMRA 1SF2A 1VJOA 2CSTA 4OT8A 4RJYA 3TFUA 4BMKA 3LG0A 1WYTA 3FVSA 3W1HA 3BWNA 4OBUA 1EG5A 2AY1A 1GC2A 1SZKA 3PD6A 3DXVA 4WYDA 2DGLA 4ZWVA 4W1XA 1QZ9A 4KYOA 1W7MA 1OXOA 3KGWA 2E7UA 1AHFA 5LH9A 2HORA 4MGRA 4E77A 3BCXA 3VP6A 4F5LA 2C7TA 2JG2A 5F8VA 2XH1A 2HZPA 3F9TA 1WKGA 3QI6A 4WXBA 4XQ2A 3IHJA 1I29A 4QGRA 3LWSA 1KL1A 3AATA 4LNLA 2VMVA 4IYOA 1CZEA 2WB6A 1GEYA 1IBJA 1H1CA 3II0A 4WLJA 3ELEA 3EI7A 4ADBA 2VGTA 3H9XA 3ZZKA 3RQ1A 3GJUA 2GMSA 2VMXA 2R5CA 1FG3A 1LW5A 3MC6A 4E3QA 4JEXA 1GC4A 3FQ7A 3JZLA 5I92A 2BWOA 2QBTA 5IWQA 1ORDA 1QJ3A 3HMUA 2W7GA 5DJ1A 4PIWA 4WYAA 4FFCA 1RVYA 1X28A 3B1DA 4IYOB 1Z3ZA 1OHYA 3EZ1A 2OKKA 1M0OA 3NDNA 4PFNA 1AHEA 2AY6A 2FN6A 4OMAA 1KL2A 1IAYA 1M32A 3TQXA 1UKJA 5G2QA 1J04A 3FVXA 2GMUA 4MKJA 3E2ZB 1AY8A 2ZUKA 3FKDA 1E5EA 2Z1ZA 2W7MA 3BWOA 4JEVA 4JEZA 2BYLA 1ASDA 2YOBA 2O1BA 1I41A 1QJ5A 3PA9A 2VMRA 1PMMA 4UHNA 5D5SA 3DYDA 3UE8A 1JS6A 3WCOA 4WXGA 1D7VA 4F5HA 1W7LA 4MQPA 1AY5A 3E6GA 4AO9A 2VMUA 3JTXA 2W7KA 5TF5A 2EH6A 1UU0A 3GWPA 4PVFA 2KFPA 2WK7A 2EGYA 4R5ZA 4UHOA 3TCMA 3WKSA 4A6RA 3HL2A 2W8VA 4M2JA 4IXZA 1WYUA 4JE5A 3K7YA 2A1VA 2BI1A 3RUYA 1ARTA 5G09A 4ZSYA 2BKWA 3FFHA 3WKRA 2CJHA 3I5TA 2HP2A 1S0AA 4BHDA 1LC8A 2D5YA 3AENB 4ZWMA 1AAMA 1AIBA 4N0WA 2QSRA 3BC8A 3QHXA 1YJZA 4F5JA 2VMWA 1AMSA 1D7UA 3JU7A 3FRKA 3MAFA 5E3KA 4IXSA 2EO5A 4GE4A 1KMJA 2D66A 3NNKA 2V0YA 2VMNA 3ZRRA 3NU8A 3ZRQA 1C7OA 3BWNC 4GSAA 2X3LA 1GC3A 3EI5A 1BT4A 1B5OA 2RFVA 4RM1A 4K2BA 1EQBA 5G0AA 5J8QA 1ASFA 2PB2A 2FM1A 4F5MA 4F5KA 4XAUA 3N7NA 1M6SA 2VGWA 2AY4A 2AY5A 2HP1A 1QITA 2Q7WA 3E9KA 4ATQA 2G6WA 2Z1YA 2TPLA 3HBXA 2BI3A 1MAQA 3IF2A 3VOMA 2CH1A 4K2IA 2R5CB 3GBXA 3L44A 1CZCA 3H14A 2EZ2A 1TOEA 2VMOA 3PDXA 3QGUA 4I8AA 4LW2A 5F9SA 3PGYA 4WXFA 3UWCA 2Z61A 4ZSWA 3ZZJA 1Y4IA 5E5IA 3PIUA 3PJ0A 3F0HA 5G2PA 4A0GA 3GZDA 3B1EA 3DZZA 1ELQA 3LY1A 4H51A 4AH3A 2QLRA 2Z9XA 1AHGA 4HF8A 1AKCA 3NYTA 4R8DA 3AEMA 5DB5A 1T3IA 3D6KA 4F5GA 5EUNA 4R5FA 3DR7A 1GEXA 1AJSB
chains in the Genus database with same CATH topology
4E3RA 4ZDOA 4LNMA 2ZY3A 3A8UX 1MLYA 2E7JA 1ASAA 2VGSA 3N4SA 4IY7A 3MADA 4ZM3A 3HDOA 2W7EA 4ADEA 4Q31A 1BQAA 3TFTA 3DC1A 4GEBA 1LS3A 3R4TA 1LC5A 1AJSA 1U08A 2WK8A 2BI5A 2D61A 1W23A 4B9BA 1WYUB 4EU1A 3KGXA 3RCHA 2JJEA 1KKPA 2EPJA 5FT4A 4XEWA 4ATPA 4F4EA 1SFFA 1O62A 3LVLB 2CH2A 3EI9A 1MDZA 3QBOA 3ZRPA 1PFFA 1SVVA 1D7RA 1TOJA 1ASGA 3E2YA 1BJOB 1C7GA 4F5IA 1AIAA 3EUCA 4EB5A 4XJPA 3A9YA 5C6UA 1AHXA 1IVRA 2VGUA 3HQTA 7AATA 4PFFA 4O6ZA 4UOYA 4RKCA 2OKJA 3N75A 1DFOA 2FNIA 2VMQA 2DOUA 5FT8A 4L0OA 3OP7A 3I4JA 4XJLA 4ZDLA 1I48A 1S06A 1YAAA 4Y0IA 3HLMA 1CQ8A 2D7YA 1ASNA 4IW7A 4RKDA 3FD0A 2DGMA 2ORDA 4WB0B 2DKJA 1IX6A 4ZLVA 3WY7A 2BIEA 2YHKA 2VMSA 5E4ZA 3VAXA 3EI8A 2HUFA 4WYCA 1SZUA 2JISA 3RBFA 1RV3A 1X29A 5EUDA 1N2TA 1G4XA 3FFRA 3VK3A 4WB0A 2BIGA 1AKAA 5FT5A 3NRAA 2PB0A 3FZ8A 4JEWA 4LC3A 4A6TA 3H7FA 2CINA 3NUBA 4P3MA 4J8LA 4A00A 2CTZA 1N31A 3CQ4A 3LVKA 4OBVA 4A0RA 4AO4A 1VEFA 4UQVA 4UHMA 1TOIA 4K2MA 5G4IA 1CL1A 1G7XA 2HUUA 3PDBB 4JEYA 5D95A 3ASBA 2W8WA 1IX8A 3G0TA 1SZSA 2CY8A 2CANA 3B46A 3HT4A 1X0MA 2G7JA 4KXKA 1DKAA 3A9XA 3FCRA 3AEMC 2CJDA 4EMYA 3A2BA 4WLHA 4U1TA 1TOKA 4N0BA 1LW4A 4Q76A 1KKJA 2V1PA 3NU7A 3JWAA 5M49A 1AY4A 1AICA 4WYGA 3R9AA 3CBFA 1IUGA 1D2FA 1M0PA 1DGDA 2R0TA 3BS8A 1O61A 3AOWA 3E2ZA 1SPAA 3WGBA 2AY3A 3PD6B 1P3WA 1TASA 3DXWA 1OATA 2AATA 5DJ9A 2C81A 3GSBA 3A9ZA 3AEJC 3N5MA 4CXRA 3FZ6A 3AENA 2BWNA 2O0RA 3FQ8A 1AHYA 4MQQA 3JW9A 3BN1A 3AEOA 2JJGA 1C0NA 1Z7DA 1CQ6A 2NMPA 3ASAA 4RLGA 2E54A 3MEBA 3OKSA 3PDBA 3FDDA 2X8UA 3EI6A 2ZC0A 3CAIA 1J32A 2GB3A 5K8BA 5JAYA 4R2NA 4RAEA 2VGZA 2DR1A 2ZY2A 4P7YA 3RBLA 3NYUA 1BJWA 1G7WA 4Q75A 1DGEA 2YKXA 2R5EA 4OYTA 1V2DA 1D7SA 2Z9WA 3ELPA 1QISA 1GEWA 2Z67A 1MLZA 3FQAA 1TATA 4ITGA 1JF9A 2YKUA 1GC0A 2VMPA 4TMRA 4MY5A 1IX7A 2AY8A 3T32A 1B5PA 4NOGA 4Q6RA 4AZJA 1QGNA 5EQCA 2BWPA 3CQ5A 1W7NA 1AX4A 2R2NA 4WYFA 1ECXA 2W8UA 3KKIA 2W7JA 2HOYA 2HOXA 1QIRA 2ZP7A 5HHYA 3DRDA 3F6TA 2VMYA 1S07A 1MDXA 3AEPA 3NTJA 1ARGA 2DGKA 1WYVA 3BCAA 2D7ZA 4WBTA 3ECDA 1AJRA 1ASEA 2FYFA 2VIAA 4AOAA 4CBSA 4J5UA 5LHAA 5AX8A 4IXOA 3WLXA 3B1CA 1N8PA 2OGEA 2VIBA 3COGA 2BYJA 1PMOA 3RCHB 4M2KA 1RV4A 1W3UA 1TARA 1DJEA 1M0NA 1ZODA 2JJHA 1O4SA 1RVUA 1OHVA 3WGCA 1XI9A 4EFFA 2ZY5A 2AY7A 2YKVA 2ZSLA 1ASMA 1EJIA 2D63A 1GDEA 2VLFA 3EZSA 2F8JA 1GD9A 1TOGA 4WD2A 4K05A 2GQNA 1JS3A 2ZYJA 4TN4A 2XBNA 3VK4A 2YRRA 4XK1A 2HUIA 4OCAA 4ISYA 1BQDA 1B8GA 1UU1A 1ASBA 4ADDA 2EYQA 3DR4A 3NX3A 3M5UA 1CS1A 1G4VA 1WYTB 3FZ7A 1ZOBA 3GR9A 2X5DA 2X5FA 5BJ4A 1BJ4A 1DJ9A 3WZFA 1IAXA 3ACZA 3ISLA 3UAKA 2CJGA 1JG8A 4GE7A 1IJIA 5FT6A 3BB8A 1WKHA 1BKGA 1I43A 5BJ3A 1TPLA 2Z9VA 4LW4A 4W5KA 1MAPA 2AY9A 2BHXA 2JGTA 2QA3A 2VYCA 1YIZA 4MQRA 4ZASA 2VI8A 2CB1A 3FTBA 3FVUA 3GETA 1BS0A 4U2HA 4ZM4A 1ARHA 2YKYA 4XJOA 4WP0A 9AATA 4ZAHA 1C9CA 1WYVB 1BJOA 1YJYA 1LKCA 4Y0DA 4B98A 1DJUA 2YCNA 5M4DA 1PG8A 4M2MA 2WK9A 3EIBA 4RITA 4GRXA 1M7YA 2AEUA 1CL2A 2C0RA 3PAAA 1DTYA 2QMAA 2YRIA 2VI9A 4W1VA 1AMAA 4TV7A 1X2AA 3QPGA 1S08A 3N0LA 2W7HA 3W1IA 3B8XA 1OHWA 1M4NA 2W8JA 2BIAA 3G8MA 1C7NA 3FDBA 1VP4A 4GDYA 3DODA 3TATA 1MGVA 4DQ6A 5EIGA 4WYEA 3MBBA 5DX5A 4A0HA 2VLHA 3MC6C 3BCBA 4HVKA 2ZJGA 4KAMA 1V2FA 5HDMA 2ZY4A 1V2EA 1LC7A 5KTBA 4JF0A 2W7DA 1UU2A 1V72A 2BI9A 1AKBA 3MAUA 4RJ0A 1CQ7A 2OGAA 3AV7A 1LK9A 2AY2A 5EAAA 3EIAA 1YOOA 4A0FA 2D64A 2WKAA 3P6KA 4EB7A 2FKIA 4XJMA 4OC9A 3P1TA 2VGVA 4FL0A 2E7IA 2EZ1A 3AELA 4AZKA 4E1OA 4H63Q 3USFA 1ZC9A 1WSTA 3NUIA 2FQ6A 8AATA 1GBNA 1YIYA 2DKBA 4CBRA 4BA5A 3Q8NA 1ASCA 2FNUA 4ZDPA 4BA4A 1B9HA 2VMTA 3K40A 2W7IA 3KE3A 2O7CA 2W7FA 2W8TA 5EIGB 1H0CA 3K28A 3G7QA 4GE9A 5EFSA 4MKKA 2HOZA 2YCTA 1AMQA 2C44A 3QN6A 1B9IA 3JWBA 3ATHA 5G4JA 4ADCA 1MDOA 4ITXA 2Z9UA 4F5FA 3LVJA 3MKJA 1BJNA 3AEJA 4JE5D 1XEYA 1CJ0A 3PPLA 3E77A 1S09A 3N4XA 4Y0HA 4OTLA 2QB3A 1E5FA 3RI6A 4LNJA 1ARIA 2JJFA 3GZDC 2BI2A 2ZSMA 3WCNA 3WX9A 1AAWA 1C4KA 4DGTA 1M0QA 3MAFB 4W8IA 3N4RA 3L8AA 3AOVA 1ASLA 4BQ0A 3DU4A 3CQ6A 1FG7A 3E2FA 2OQXA 5HXXA 4RIZA 2YCPA 1YNUA 2AEVA 4W91A 1GCKA 2Z20A 3I16A 4DBCA 3VK2A 2W7LA 3W1JA 1B4XA 1O69A 4A72A 1ELUA 1ARSA 2VMZA 3LV2A 5EAVA 2QB2A 3NYSA 4CXQA 1YJSA 1OXPA 4IX8A 4MSOA 2CFBA 3BV0A 3QM2A 3LVMA 2PO3A 2GSAA 4A6UA 1KMKA 3HVYA 2OATA 1FC4A 5EUEA 4JF1A 3FSLA 5M46A 4W1WA 1BW0A 5M4BA 3GZCA 2D65A 4CVQA 1AMRA 1SF2A 1VJOA 2CSTA 4OT8A 4RJYA 3TFUA 4BMKA 3LG0A 1WYTA 3FVSA 3W1HA 3BWNA 4OBUA 1EG5A 2AY1A 1GC2A 1SZKA 3PD6A 3DXVA 4WYDA 2DGLA 4ZWVA 4W1XA 1QZ9A 4KYOA 1W7MA 1OXOA 3KGWA 2E7UA 1AHFA 5LH9A 2HORA 4MGRA 4E77A 3BCXA 3VP6A 4F5LA 2C7TA 2JG2A 5F8VA 2XH1A 2HZPA 3F9TA 1WKGA 3QI6A 4WXBA 4XQ2A 3IHJA 1I29A 4QGRA 3LWSA 1KL1A 3AATA 4LNLA 2VMVA 4IYOA 1CZEA 2WB6A 1GEYA 1IBJA 1H1CA 3II0A 4WLJA 3ELEA 3EI7A 4ADBA 2VGTA 3H9XA 3ZZKA 3RQ1A 3GJUA 2GMSA 2VMXA 2R5CA 1FG3A 1LW5A 3MC6A 4E3QA 4JEXA 1GC4A 3FQ7A 3JZLA 5I92A 2BWOA 2QBTA 5IWQA 1ORDA 1QJ3A 3HMUA 2W7GA 5DJ1A 4PIWA 4WYAA 4FFCA 1RVYA 1X28A 3B1DA 4IYOB 1Z3ZA 1OHYA 3EZ1A 2OKKA 1M0OA 3NDNA 4PFNA 1AHEA 2AY6A 2FN6A 4OMAA 1KL2A 1IAYA 1M32A 3TQXA 1UKJA 5G2QA 1J04A 3FVXA 2GMUA 4MKJA 3E2ZB 1AY8A 2ZUKA 3FKDA 1E5EA 2Z1ZA 2W7MA 3BWOA 4JEVA 4JEZA 2BYLA 1ASDA 2YOBA 2O1BA 1I41A 1QJ5A 3PA9A 2VMRA 1PMMA 4UHNA 5D5SA 3DYDA 3UE8A 1JS6A 3WCOA 4WXGA 1D7VA 4F5HA 1W7LA 4MQPA 1AY5A 3E6GA 4AO9A 2VMUA 3JTXA 2W7KA 5TF5A 2EH6A 1UU0A 3GWPA 4PVFA 2KFPA 2WK7A 2EGYA 4R5ZA 4UHOA 3TCMA 3WKSA 4A6RA 3HL2A 2W8VA 4M2JA 4IXZA 1WYUA 4JE5A 3K7YA 2A1VA 2BI1A 3RUYA 1ARTA 5G09A 4ZSYA 2BKWA 3FFHA 3WKRA 2CJHA 3I5TA 2HP2A 1S0AA 4BHDA 1LC8A 2D5YA 3AENB 4ZWMA 1AAMA 1AIBA 4N0WA 2QSRA 3BC8A 3QHXA 1YJZA 4F5JA 2VMWA 1AMSA 1D7UA 3JU7A 3FRKA 3MAFA 5E3KA 4IXSA 2EO5A 4GE4A 1KMJA 2D66A 3NNKA 2V0YA 2VMNA 3ZRRA 3NU8A 3ZRQA 1C7OA 3BWNC 4GSAA 2X3LA 1GC3A 3EI5A 1BT4A 1B5OA 2RFVA 4RM1A 4K2BA 1EQBA 5G0AA 5J8QA 1ASFA 2PB2A 2FM1A 4F5MA 4F5KA 4XAUA 3N7NA 1M6SA 2VGWA 2AY4A 2AY5A 2HP1A 1QITA 2Q7WA 3E9KA 4ATQA 2G6WA 2Z1YA 2TPLA 3HBXA 2BI3A 1MAQA 3IF2A 3VOMA 2CH1A 4K2IA 2R5CB 3GBXA 3L44A 1CZCA 3H14A 2EZ2A 1TOEA 2VMOA 3PDXA 3QGUA 4I8AA 4LW2A 5F9SA 3PGYA 4WXFA 3UWCA 2Z61A 4ZSWA 3ZZJA 1Y4IA 5E5IA 3PIUA 3PJ0A 3F0HA 5G2PA 4A0GA 3GZDA 3B1EA 3DZZA 1ELQA 3LY1A 4H51A 4AH3A 2QLRA 2Z9XA 1AHGA 4HF8A 1AKCA 3NYTA 4R8DA 3AEMA 5DB5A 1T3IA 3D6KA 4F5GA 5EUNA 4R5FA 3DR7A 1GEXA 1AJSB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4E3R A;  4ZDO A;  4LNM A;  2ZY3 A;  3A8U X;  1MLY A;  2E7J A;  1ASA A;  2VGS A;  4IY7 A;  3MAD A;  4ZM3 A;  3HDO A;  2W7E A;  4ADE A;  4Q31 A;  1BQA A;  3TFT A;  3DC1 A;  4GEB A;  1LS3 A;  3R4T A;  1LC5 A;  1AJS A;  1U08 A;  2WK8 A;  2BI5 A;  2D61 A;  1W23 A;  4B9B A;  1WYU B;  4EU1 A;  3KGX A;  3RCH A;  2JJE A;  1KKP A;  2EPJ A;  5FT4 A;  4XEW A;  4ATP A;  4F4E A;  1SFF A;  1O62 A;  3LVL B;  2CH2 A;  3EI9 A;  1MDZ A;  3QBO A;  3ZRP A;  1PFF A;  1SVV A;  1D7R A;  1TOJ A;  1ASG A;  3E2Y A;  1BJO B;  1C7G A;  4F5I A;  1AIA A;  3EUC A;  4EB5 A;  4XJP A;  3A9Y A;  5C6U A;  1AHX A;  1IVR A;  2VGU A;  3HQT A;  7AAT A;  4PFF A;  4O6Z A;  4UOY A;  4RKC A;  2OKJ A;  3N75 A;  1DFO A;  2FNI A;  2VMQ A;  2DOU A;  5FT8 A;  4L0O A;  3OP7 A;  3I4J A;  4XJL A;  4ZDL A;  1I48 A;  1S06 A;  1YAA A;  4Y0I A;  3HLM A;  1CQ8 A;  2D7Y A;  1ASN A;  4IW7 A;  4RKD A;  3FD0 A;  2DGM A;  2ORD A;  4WB0 B;  2DKJ A;  1IX6 A;  4ZLV A;  3WY7 A;  2BIE A;  2YHK A;  2VMS A;  5E4Z A;  3VAX A;  3EI8 A;  2HUF A;  4WYC A;  1SZU A;  2JIS A;  3RBF A;  1RV3 A;  1X29 A;  5EUD A;  1N2T A;  1G4X A;  3FFR A;  3VK3 A;  4WB0 A;  2BIG A;  1AKA A;  5FT5 A;  3NRA A;  2PB0 A;  3FZ8 A;  4JEW A;  4LC3 A;  4A6T A;  3H7F A;  2CIN A;  3NUB A;  4P3M A;  4J8L A;  4A00 A;  2CTZ A;  1N31 A;  3CQ4 A;  3LVK A;  4OBV A;  4A0R A;  4AO4 A;  1VEF A;  4UQV A;  4UHM A;  1TOI A;  4K2M A;  5G4I A;  1CL1 A;  1G7X A;  2HUU A;  3PDB B;  4JEY A;  5D95 A;  3ASB A;  2W8W A;  1IX8 A;  3G0T A;  1SZS A;  2CY8 A;  2CAN A;  3B46 A;  3HT4 A;  1X0M A;  4KXK A;  1DKA A;  3A9X A;  3FCR A;  3AEM C;  2CJD A;  4EMY A;  3A2B A;  4WLH A;  4U1T A;  1TOK A;  4N0B A;  1LW4 A;  4Q76 A;  1KKJ A;  2V1P A;  3NU7 A;  3JWA A;  5M49 A;  1AY4 A;  1AIC A;  4WYG A;  3R9A A;  3CBF A;  1IUG A;  1D2F A;  1M0P A;  1DGD A;  2R0T A;  3BS8 A;  1O61 A;  3AOW A;  3E2Z A;  1SPA A;  3WGB A;  2AY3 A;  3PD6 B;  1P3W A;  1TAS A;  3DXW A;  1OAT A;  2AAT A;  5DJ9 A;  2C81 A;  3GSB A;  3A9Z A;  3AEJ C;  3N5M A;  4CXR A;  3FZ6 A;  3AEN A;  2BWN A;  2O0R A;  3FQ8 A;  1AHY A;  4MQQ A;  3JW9 A;  3BN1 A;  3AEO A;  2JJG A;  1C0N A;  1Z7D A;  1CQ6 A;  2NMP A;  3ASA A;  4RLG A;  2E54 A;  3MEB A;  3OKS A;  3PDB A;  3FDD A;  2X8U A;  3EI6 A;  2ZC0 A;  3CAI A;  1J32 A;  2GB3 A;  5K8B A;  5JAY A;  4R2N A;  4RAE A;  2VGZ A;  2DR1 A;  2ZY2 A;  4P7Y A;  3RBL A;  3NYU A;  1BJW A;  1G7W A;  4Q75 A;  1DGE A;  2YKX A;  2R5E A;  4OYT A;  1V2D A;  1D7S A;  2Z9W A;  3ELP A;  1QIS A;  1GEW A;  2Z67 A;  1MLZ A;  3FQA A;  1TAT A;  4ITG A;  1JF9 A;  2YKU A;  1GC0 A;  2VMP A;  4TMR A;  4MY5 A;  1IX7 A;  2AY8 A;  3T32 A;  1B5P A;  4NOG A;  4Q6R A;  4AZJ A;  1QGN A;  5EQC A;  2BWP A;  3CQ5 A;  1W7N A;  1AX4 A;  2R2N A;  4WYF A;  1ECX A;  2W8U A;  3KKI A;  2W7J A;  2HOY A;  2HOX A;  1QIR A;  2ZP7 A;  5HHY A;  3DRD A;  3F6T A;  2VMY A;  1S07 A;  1MDX A;  3AEP A;  3NTJ A;  1ARG A;  2DGK A;  1WYV A;  3BCA A;  2D7Z A;  4WBT A;  3ECD A;  1AJR A;  1ASE A;  2FYF A;  2VIA A;  4AOA A;  4CBS A;  4J5U A;  5LHA A;  5AX8 A;  4IXO A;  3WLX A;  3B1C A;  1N8P A;  2OGE A;  2VIB A;  3COG A;  2BYJ A;  1PMO A;  3RCH B;  4M2K A;  1RV4 A;  1W3U A;  1TAR A;  1DJE A;  1M0N A;  1ZOD A;  2JJH A;  1O4S A;  1RVU A;  1OHV A;  3WGC A;  1XI9 A;  4EFF A;  2ZY5 A;  2AY7 A;  2YKV A;  2ZSL A;  1ASM A;  1EJI A;  2D63 A;  1GDE A;  2VLF A;  3EZS A;  2F8J A;  1GD9 A;  1TOG A;  4WD2 A;  2GQN A;  1JS3 A;  2ZYJ A;  4TN4 A;  2XBN A;  3VK4 A;  2YRR A;  4XK1 A;  2HUI A;  4OCA A;  4ISY A;  1BQD A;  1B8G A;  1UU1 A;  1ASB A;  4ADD A;  3DR4 A;  3NX3 A;  3M5U A;  1CS1 A;  1G4V A;  1WYT B;  3FZ7 A;  1ZOB A;  3GR9 A;  2X5D A;  2X5F A;  5BJ4 A;  1BJ4 A;  1DJ9 A;  3WZF A;  1IAX A;  3ACZ A;  3ISL A;  3UAK A;  2CJG A;  1JG8 A;  4GE7 A;  1IJI A;  5FT6 A;  3BB8 A;  1WKH A;  1BKG A;  1I43 A;  5BJ3 A;  1TPL A;  2Z9V A;  4LW4 A;  4W5K A;  1MAP A;  2AY9 A;  2BHX A;  2JGT A;  2QA3 A;  2VYC A;  1YIZ A;  4MQR A;  4ZAS A;  2VI8 A;  2CB1 A;  3FTB A;  3FVU A;  3GET A;  1BS0 A;  4U2H A;  4ZM4 A;  1ARH A;  2YKY A;  4XJO A;  4WP0 A;  9AAT A;  4ZAH A;  1C9C A;  1WYV B;  1BJO A;  1YJY A;  1LKC A;  4Y0D A;  4B98 A;  1DJU A;  2YCN A;  5M4D A;  1PG8 A;  4M2M A;  2WK9 A;  3EIB A;  4RIT A;  4GRX A;  1M7Y A;  2AEU A;  1CL2 A;  2C0R A;  3PAA A;  1DTY A;  2QMA A;  2YRI A;  2VI9 A;  4W1V A;  1AMA A;  4TV7 A;  1X2A A;  3QPG A;  1S08 A;  3N0L A;  2W7H A;  3W1I A;  3B8X A;  1OHW A;  1M4N A;  2W8J A;  2BIA A;  3G8M A;  1C7N A;  3FDB A;  1VP4 A;  4GDY A;  3DOD A;  3TAT A;  1MGV A;  4DQ6 A;  5EIG A;  4WYE A;  3MBB A;  5DX5 A;  4A0H A;  2VLH A;  3MC6 C;  3BCB A;  4HVK A;  2ZJG A;  4KAM A;  1V2F A;  5HDM A;  2ZY4 A;  1V2E A;  1LC7 A;  4JF0 A;  2W7D A;  1UU2 A;  1V72 A;  2BI9 A;  1AKB A;  3MAU A;  4RJ0 A;  1CQ7 A;  2OGA A;  3AV7 A;  1LK9 A;  2AY2 A;  5EAA A;  3EIA A;  1YOO A;  4A0F A;  2D64 A;  2WKA A;  3P6K A;  4EB7 A;  4XJM A;  4OC9 A;  3P1T A;  2VGV A;  4FL0 A;  2E7I A;  2EZ1 A;  3AEL A;  4AZK A;  4E1O A;  3USF A;  1ZC9 A;  1WST A;  3NUI A;  2FQ6 A;  8AAT A;  1GBN A;  1YIY A;  2DKB A;  4CBR A;  4BA5 A;  3Q8N A;  1ASC A;  2FNU A;  4ZDP A;  4BA4 A;  1B9H A;  2VMT A;  3K40 A;  2W7I A;  3KE3 A;  2O7C A;  2W7F A;  2W8T A;  5EIG B;  1H0C A;  3K28 A;  3G7Q A;  4GE9 A;  5EFS A;  4MKK A;  2HOZ A;  2YCT A;  1AMQ A;  2C44 A;  3QN6 A;  1B9I A;  3JWB A;  3ATH A;  5G4J A;  4ADC A;  1MDO A;  4ITX A;  2Z9U A;  4F5F A;  3LVJ A;  3MKJ A;  1BJN A;  3AEJ A;  4JE5 D;  1XEY A;  1CJ0 A;  3PPL A;  3E77 A;  1S09 A;  4Y0H A;  4OTL A;  2QB3 A;  1E5F A;  3RI6 A;  4LNJ A;  1ARI A;  2JJF A;  3GZD C;  2BI2 A;  2ZSM A;  3WCN A;  3WX9 A;  1AAW A;  1C4K A;  4DGT A;  1M0Q A;  3MAF B;  4W8I A;  3L8A A;  3AOV A;  1ASL A;  4BQ0 A;  3DU4 A;  3CQ6 A;  1FG7 A;  3E2F A;  2OQX A;  5HXX A;  4RIZ A;  2YCP A;  1YNU A;  2AEV A;  4W91 A;  1GCK A;  2Z20 A;  3I16 A;  4DBC A;  3VK2 A;  2W7L A;  3W1J A;  1B4X A;  1O69 A;  4A72 A;  1ELU A;  1ARS A;  2VMZ A;  3LV2 A;  5EAV A;  2QB2 A;  3NYS A;  4CXQ A;  1YJS A;  1OXP A;  4IX8 A;  4MSO A;  2CFB A;  3BV0 A;  3QM2 A;  3LVM A;  2PO3 A;  2GSA A;  4A6U A;  1KMK A;  3HVY A;  2OAT A;  1FC4 A;  5EUE A;  4JF1 A;  3FSL A;  5M46 A;  4W1W A;  1BW0 A;  5M4B A;  3GZC A;  2D65 A;  4CVQ A;  1AMR A;  1SF2 A;  1VJO A;  2CST A;  4OT8 A;  4RJY A;  3TFU A;  4BMK A;  3LG0 A;  1WYT A;  3FVS A;  3W1H A;  3BWN A;  4OBU A;  1EG5 A;  2AY1 A;  1GC2 A;  1SZK A;  3PD6 A;  3DXV A;  4WYD A;  2DGL A;  4ZWV A;  4W1X A;  1QZ9 A;  4KYO A;  1W7M A;  1OXO A;  3KGW A;  2E7U A;  1AHF A;  5LH9 A;  2HOR A;  4MGR A;  4E77 A;  3BCX A;  3VP6 A;  4F5L A;  2C7T A;  2JG2 A;  5F8V A;  2XH1 A;  2HZP A;  3F9T A;  1WKG A;  3QI6 A;  4WXB A;  4XQ2 A;  3IHJ A;  1I29 A;  4QGR A;  3LWS A;  1KL1 A;  3AAT A;  4LNL A;  2VMV A;  4IYO A;  1CZE A;  1GEY A;  1IBJ A;  1H1C A;  3II0 A;  4WLJ A;  3ELE A;  3EI7 A;  4ADB A;  2VGT A;  3ZZK A;  3RQ1 A;  3GJU A;  2GMS A;  2VMX A;  2R5C A;  1FG3 A;  1LW5 A;  3MC6 A;  4E3Q A;  4JEX A;  1GC4 A;  3FQ7 A;  3JZL A;  5I92 A;  2BWO A;  2QBT A;  5IWQ A;  1ORD A;  1QJ3 A;  3HMU A;  2W7G A;  5DJ1 A;  4PIW A;  4WYA A;  4FFC A;  1RVY A;  1X28 A;  3B1D A;  4IYO B;  1Z3Z A;  1OHY A;  3EZ1 A;  2OKK A;  1M0O A;  3NDN A;  4PFN A;  1AHE A;  2AY6 A;  2FN6 A;  4OMA A;  1KL2 A;  1IAY A;  1M32 A;  3TQX A;  1UKJ A;  5G2Q A;  1J04 A;  3FVX A;  2GMU A;  4MKJ A;  3E2Z B;  1AY8 A;  2ZUK A;  3FKD A;  1E5E A;  2Z1Z A;  2W7M A;  3BWO A;  4JEV A;  4JEZ A;  2BYL A;  1ASD A;  2YOB A;  2O1B A;  1I41 A;  1QJ5 A;  3PA9 A;  2VMR A;  1PMM A;  4UHN A;  5D5S A;  3DYD A;  3UE8 A;  1JS6 A;  3WCO A;  4WXG A;  1D7V A;  4F5H A;  1W7L A;  4MQP A;  1AY5 A;  3E6G A;  4AO9 A;  2VMU A;  3JTX A;  2W7K A;  5TF5 A;  2EH6 A;  1UU0 A;  3GWP A;  4PVF A;  2WK7 A;  2EGY A;  4R5Z A;  4UHO A;  3TCM A;  3WKS A;  4A6R A;  3HL2 A;  2W8V A;  4M2J A;  4IXZ A;  1WYU A;  4JE5 A;  3K7Y A;  2BI1 A;  3RUY A;  1ART A;  5G09 A;  4ZSY A;  2BKW A;  3FFH A;  3WKR A;  2CJH A;  3I5T A;  2HP2 A;  1S0A A;  4BHD A;  1LC8 A;  2D5Y A;  3AEN B;  4ZWM A;  1AAM A;  1AIB A;  4N0W A;  3BC8 A;  3QHX A;  1YJZ A;  4F5J A;  2VMW A;  1AMS A;  1D7U A;  3JU7 A;  3FRK A;  3MAF A;  5E3K A;  4IXS A;  2EO5 A;  4GE4 A;  1KMJ A;  2D66 A;  3NNK A;  2V0Y A;  2VMN A;  3ZRR A;  3NU8 A;  3ZRQ A;  1C7O A;  3BWN C;  4GSA A;  2X3L A;  1GC3 A;  3EI5 A;  1BT4 A;  1B5O A;  2RFV A;  4RM1 A;  4K2B A;  1EQB A;  5G0A A;  5J8Q A;  1ASF A;  2PB2 A;  2FM1 A;  4F5M A;  4F5K A;  4XAU A;  1M6S A;  2VGW A;  2AY4 A;  2AY5 A;  2HP1 A;  1QIT A;  2Q7W A;  3E9K A;  4ATQ A;  2G6W A;  2Z1Y A;  2TPL A;  3HBX A;  2BI3 A;  1MAQ A;  3IF2 A;  3VOM A;  2CH1 A;  4K2I A;  2R5C B;  3GBX A;  3L44 A;  1CZC A;  3H14 A;  2EZ2 A;  1TOE A;  2VMO A;  3PDX A;  3QGU A;  4I8A A;  4LW2 A;  5F9S A;  3PGY A;  4WXF A;  3UWC A;  2Z61 A;  4ZSW A;  3ZZJ A;  1Y4I A;  5E5I A;  3PIU A;  3PJ0 A;  3F0H A;  5G2P A;  4A0G A;  3GZD A;  3B1E A;  3DZZ A;  1ELQ A;  3LY1 A;  4H51 A;  4AH3 A;  2QLR A;  2Z9X A;  1AHG A;  4HF8 A;  1AKC A;  3NYT A;  4R8D A;  3AEM A;  5DB5 A;  1T3I A;  3D6K A;  4F5G A;  5EUN A;  4R5F A;  3DR7 A;  1GEX A;  1AJS B; 
#chains in the Genus database with same CATH topology
 4E3R A;  4ZDO A;  4LNM A;  2ZY3 A;  3A8U X;  1MLY A;  2E7J A;  1ASA A;  2VGS A;  3N4S A;  4IY7 A;  3MAD A;  4ZM3 A;  3HDO A;  2W7E A;  4ADE A;  4Q31 A;  1BQA A;  3TFT A;  3DC1 A;  4GEB A;  1LS3 A;  3R4T A;  1LC5 A;  1AJS A;  1U08 A;  2WK8 A;  2BI5 A;  2D61 A;  1W23 A;  4B9B A;  1WYU B;  4EU1 A;  3KGX A;  3RCH A;  2JJE A;  1KKP A;  2EPJ A;  5FT4 A;  4XEW A;  4ATP A;  4F4E A;  1SFF A;  1O62 A;  3LVL B;  2CH2 A;  3EI9 A;  1MDZ A;  3QBO A;  3ZRP A;  1PFF A;  1SVV A;  1D7R A;  1TOJ A;  1ASG A;  3E2Y A;  1BJO B;  1C7G A;  4F5I A;  1AIA A;  3EUC A;  4EB5 A;  4XJP A;  3A9Y A;  5C6U A;  1AHX A;  1IVR A;  2VGU A;  3HQT A;  7AAT A;  4PFF A;  4O6Z A;  4UOY A;  4RKC A;  2OKJ A;  3N75 A;  1DFO A;  2FNI A;  2VMQ A;  2DOU A;  5FT8 A;  4L0O A;  3OP7 A;  3I4J A;  4XJL A;  4ZDL A;  1I48 A;  1S06 A;  1YAA A;  4Y0I A;  3HLM A;  1CQ8 A;  2D7Y A;  1ASN A;  4IW7 A;  4RKD A;  3FD0 A;  2DGM A;  2ORD A;  4WB0 B;  2DKJ A;  1IX6 A;  4ZLV A;  3WY7 A;  2BIE A;  2YHK A;  2VMS A;  5E4Z A;  3VAX A;  3EI8 A;  2HUF A;  4WYC A;  1SZU A;  2JIS A;  3RBF A;  1RV3 A;  1X29 A;  5EUD A;  1N2T A;  1G4X A;  3FFR A;  3VK3 A;  4WB0 A;  2BIG A;  1AKA A;  5FT5 A;  3NRA A;  2PB0 A;  3FZ8 A;  4JEW A;  4LC3 A;  4A6T A;  3H7F A;  2CIN A;  3NUB A;  4P3M A;  4J8L A;  4A00 A;  2CTZ A;  1N31 A;  3CQ4 A;  3LVK A;  4OBV A;  4A0R A;  4AO4 A;  1VEF A;  4UQV A;  4UHM A;  1TOI A;  4K2M A;  5G4I A;  1CL1 A;  1G7X A;  2HUU A;  3PDB B;  4JEY A;  5D95 A;  3ASB A;  2W8W A;  1IX8 A;  3G0T A;  1SZS A;  2CY8 A;  2CAN A;  3B46 A;  3HT4 A;  1X0M A;  2G7J A;  4KXK A;  1DKA A;  3A9X A;  3FCR A;  3AEM C;  2CJD A;  4EMY A;  3A2B A;  4WLH A;  4U1T A;  1TOK A;  4N0B A;  1LW4 A;  4Q76 A;  1KKJ A;  2V1P A;  3NU7 A;  3JWA A;  5M49 A;  1AY4 A;  1AIC A;  4WYG A;  3R9A A;  3CBF A;  1IUG A;  1D2F A;  1M0P A;  1DGD A;  2R0T A;  3BS8 A;  1O61 A;  3AOW A;  3E2Z A;  1SPA A;  3WGB A;  2AY3 A;  3PD6 B;  1P3W A;  1TAS A;  3DXW A;  1OAT A;  2AAT A;  5DJ9 A;  2C81 A;  3GSB A;  3A9Z A;  3AEJ C;  3N5M A;  4CXR A;  3FZ6 A;  3AEN A;  2BWN A;  2O0R A;  3FQ8 A;  1AHY A;  4MQQ A;  3JW9 A;  3BN1 A;  3AEO A;  2JJG A;  1C0N A;  1Z7D A;  1CQ6 A;  2NMP A;  3ASA A;  4RLG A;  2E54 A;  3MEB A;  3OKS A;  3PDB A;  3FDD A;  2X8U A;  3EI6 A;  2ZC0 A;  3CAI A;  1J32 A;  2GB3 A;  5K8B A;  5JAY A;  4R2N A;  4RAE A;  2VGZ A;  2DR1 A;  2ZY2 A;  4P7Y A;  3RBL A;  3NYU A;  1BJW A;  1G7W A;  4Q75 A;  1DGE A;  2YKX A;  2R5E A;  4OYT A;  1V2D A;  1D7S A;  2Z9W A;  3ELP A;  1QIS A;  1GEW A;  2Z67 A;  1MLZ A;  3FQA A;  1TAT A;  4ITG A;  1JF9 A;  2YKU A;  1GC0 A;  2VMP A;  4TMR A;  4MY5 A;  1IX7 A;  2AY8 A;  3T32 A;  1B5P A;  4NOG A;  4Q6R A;  4AZJ A;  1QGN A;  5EQC A;  2BWP A;  3CQ5 A;  1W7N A;  1AX4 A;  2R2N A;  4WYF A;  1ECX A;  2W8U A;  3KKI A;  2W7J A;  2HOY A;  2HOX A;  1QIR A;  2ZP7 A;  5HHY A;  3DRD A;  3F6T A;  2VMY A;  1S07 A;  1MDX A;  3AEP A;  3NTJ A;  1ARG A;  2DGK A;  1WYV A;  3BCA A;  2D7Z A;  4WBT A;  3ECD A;  1AJR A;  1ASE A;  2FYF A;  2VIA A;  4AOA A;  4CBS A;  4J5U A;  5LHA A;  5AX8 A;  4IXO A;  3WLX A;  3B1C A;  1N8P A;  2OGE A;  2VIB A;  3COG A;  2BYJ A;  1PMO A;  3RCH B;  4M2K A;  1RV4 A;  1W3U A;  1TAR A;  1DJE A;  1M0N A;  1ZOD A;  2JJH A;  1O4S A;  1RVU A;  1OHV A;  3WGC A;  1XI9 A;  4EFF A;  2ZY5 A;  2AY7 A;  2YKV A;  2ZSL A;  1ASM A;  1EJI A;  2D63 A;  1GDE A;  2VLF A;  3EZS A;  2F8J A;  1GD9 A;  1TOG A;  4WD2 A;  4K05 A;  2GQN A;  1JS3 A;  2ZYJ A;  4TN4 A;  2XBN A;  3VK4 A;  2YRR A;  4XK1 A;  2HUI A;  4OCA A;  4ISY A;  1BQD A;  1B8G A;  1UU1 A;  1ASB A;  4ADD A;  2EYQ A;  3DR4 A;  3NX3 A;  3M5U A;  1CS1 A;  1G4V A;  1WYT B;  3FZ7 A;  1ZOB A;  3GR9 A;  2X5D A;  2X5F A;  5BJ4 A;  1BJ4 A;  1DJ9 A;  3WZF A;  1IAX A;  3ACZ A;  3ISL A;  3UAK A;  2CJG A;  1JG8 A;  4GE7 A;  1IJI A;  5FT6 A;  3BB8 A;  1WKH A;  1BKG A;  1I43 A;  5BJ3 A;  1TPL A;  2Z9V A;  4LW4 A;  4W5K A;  1MAP A;  2AY9 A;  2BHX A;  2JGT A;  2QA3 A;  2VYC A;  1YIZ A;  4MQR A;  4ZAS A;  2VI8 A;  2CB1 A;  3FTB A;  3FVU A;  3GET A;  1BS0 A;  4U2H A;  4ZM4 A;  1ARH A;  2YKY A;  4XJO A;  4WP0 A;  9AAT A;  4ZAH A;  1C9C A;  1WYV B;  1BJO A;  1YJY A;  1LKC A;  4Y0D A;  4B98 A;  1DJU A;  2YCN A;  5M4D A;  1PG8 A;  4M2M A;  2WK9 A;  3EIB A;  4RIT A;  4GRX A;  1M7Y A;  2AEU A;  1CL2 A;  2C0R A;  3PAA A;  1DTY A;  2QMA A;  2YRI A;  2VI9 A;  4W1V A;  1AMA A;  4TV7 A;  1X2A A;  3QPG A;  1S08 A;  3N0L A;  2W7H A;  3W1I A;  3B8X A;  1OHW A;  1M4N A;  2W8J A;  2BIA A;  3G8M A;  1C7N A;  3FDB A;  1VP4 A;  4GDY A;  3DOD A;  3TAT A;  1MGV A;  4DQ6 A;  5EIG A;  4WYE A;  3MBB A;  5DX5 A;  4A0H A;  2VLH A;  3MC6 C;  3BCB A;  4HVK A;  2ZJG A;  4KAM A;  1V2F A;  5HDM A;  2ZY4 A;  1V2E A;  1LC7 A;  5KTB A;  4JF0 A;  2W7D A;  1UU2 A;  1V72 A;  2BI9 A;  1AKB A;  3MAU A;  4RJ0 A;  1CQ7 A;  2OGA A;  3AV7 A;  1LK9 A;  2AY2 A;  5EAA A;  3EIA A;  1YOO A;  4A0F A;  2D64 A;  2WKA A;  3P6K A;  4EB7 A;  2FKI A;  4XJM A;  4OC9 A;  3P1T A;  2VGV A;  4FL0 A;  2E7I A;  2EZ1 A;  3AEL A;  4AZK A;  4E1O A;  4H63 Q;  3USF A;  1ZC9 A;  1WST A;  3NUI A;  2FQ6 A;  8AAT A;  1GBN A;  1YIY A;  2DKB A;  4CBR A;  4BA5 A;  3Q8N A;  1ASC A;  2FNU A;  4ZDP A;  4BA4 A;  1B9H A;  2VMT A;  3K40 A;  2W7I A;  3KE3 A;  2O7C A;  2W7F A;  2W8T A;  5EIG B;  1H0C A;  3K28 A;  3G7Q A;  4GE9 A;  5EFS A;  4MKK A;  2HOZ A;  2YCT A;  1AMQ A;  2C44 A;  3QN6 A;  1B9I A;  3JWB A;  3ATH A;  5G4J A;  4ADC A;  1MDO A;  4ITX A;  2Z9U A;  4F5F A;  3LVJ A;  3MKJ A;  1BJN A;  3AEJ A;  4JE5 D;  1XEY A;  1CJ0 A;  3PPL A;  3E77 A;  1S09 A;  3N4X A;  4Y0H A;  4OTL A;  2QB3 A;  1E5F A;  3RI6 A;  4LNJ A;  1ARI A;  2JJF A;  3GZD C;  2BI2 A;  2ZSM A;  3WCN A;  3WX9 A;  1AAW A;  1C4K A;  4DGT A;  1M0Q A;  3MAF B;  4W8I A;  3N4R A;  3L8A A;  3AOV A;  1ASL A;  4BQ0 A;  3DU4 A;  3CQ6 A;  1FG7 A;  3E2F A;  2OQX A;  5HXX A;  4RIZ A;  2YCP A;  1YNU A;  2AEV A;  4W91 A;  1GCK A;  2Z20 A;  3I16 A;  4DBC A;  1KAF A;  3VK2 A;  2W7L A;  3W1J A;  1B4X A;  1O69 A;  4A72 A;  1ELU A;  1ARS A;  2VMZ A;  3LV2 A;  5EAV A;  2QB2 A;  3NYS A;  4CXQ A;  1YJS A;  1OXP A;  4IX8 A;  4MSO A;  2CFB A;  3BV0 A;  3QM2 A;  3LVM A;  2PO3 A;  2GSA A;  4A6U A;  1KMK A;  3HVY A;  2OAT A;  1FC4 A;  5EUE A;  4JF1 A;  3FSL A;  5M46 A;  4W1W A;  1BW0 A;  5M4B A;  3GZC A;  2D65 A;  4CVQ A;  1AMR A;  1SF2 A;  1VJO A;  2CST A;  4OT8 A;  4RJY A;  3TFU A;  4BMK A;  3LG0 A;  1WYT A;  3FVS A;  3W1H A;  3BWN A;  4OBU A;  1EG5 A;  2AY1 A;  1GC2 A;  1SZK A;  3PD6 A;  3DXV A;  4WYD A;  2DGL A;  4ZWV A;  4W1X A;  1QZ9 A;  4KYO A;  1W7M A;  1OXO A;  3KGW A;  2E7U A;  1AHF A;  5LH9 A;  2HOR A;  4MGR A;  4E77 A;  3BCX A;  3VP6 A;  4F5L A;  2C7T A;  2JG2 A;  5F8V A;  2XH1 A;  2HZP A;  3F9T A;  1WKG A;  3QI6 A;  4WXB A;  4XQ2 A;  3IHJ A;  1I29 A;  4QGR A;  3LWS A;  1KL1 A;  3AAT A;  4LNL A;  2VMV A;  4IYO A;  1CZE A;  2WB6 A;  1GEY A;  1IBJ A;  1H1C A;  3II0 A;  4WLJ A;  3ELE A;  3EI7 A;  4ADB A;  2VGT A;  3H9X A;  3ZZK A;  3RQ1 A;  3GJU A;  2GMS A;  2VMX A;  2R5C A;  1FG3 A;  1LW5 A;  3MC6 A;  4E3Q A;  4JEX A;  1GC4 A;  3FQ7 A;  3JZL A;  5I92 A;  2BWO A;  2QBT A;  5IWQ A;  1ORD A;  1QJ3 A;  3HMU A;  2W7G A;  5DJ1 A;  4PIW A;  4WYA A;  4FFC A;  1RVY A;  1X28 A;  3B1D A;  4IYO B;  1Z3Z A;  1OHY A;  3EZ1 A;  2OKK A;  1M0O A;  3NDN A;  4PFN A;  1AHE A;  2AY6 A;  2FN6 A;  4OMA A;  1KL2 A;  1IAY A;  1M32 A;  3TQX A;  1UKJ A;  5G2Q A;  1J04 A;  3FVX A;  2GMU A;  4MKJ A;  3E2Z B;  1AY8 A;  2ZUK A;  3FKD A;  1E5E A;  2Z1Z A;  2W7M A;  3BWO A;  4JEV A;  4JEZ A;  2BYL A;  1ASD A;  2YOB A;  2O1B A;  1I41 A;  1QJ5 A;  3PA9 A;  2VMR A;  1PMM A;  4UHN A;  5D5S A;  3DYD A;  3UE8 A;  1JS6 A;  3WCO A;  4WXG A;  1D7V A;  4F5H A;  1W7L A;  4MQP A;  1AY5 A;  3E6G A;  4AO9 A;  2VMU A;  3JTX A;  2W7K A;  5TF5 A;  2EH6 A;  1UU0 A;  3GWP A;  4PVF A;  2KFP A;  2WK7 A;  2EGY A;  4R5Z A;  4UHO A;  3TCM A;  3WKS A;  4A6R A;  3HL2 A;  2W8V A;  4M2J A;  4IXZ A;  1WYU A;  4JE5 A;  3K7Y A;  2A1V A;  2BI1 A;  3RUY A;  1ART A;  5G09 A;  4ZSY A;  2BKW A;  3FFH A;  3WKR A;  2CJH A;  3I5T A;  2HP2 A;  1S0A A;  4BHD A;  1LC8 A;  2D5Y A;  3AEN B;  4ZWM A;  1AAM A;  1AIB A;  4N0W A;  2QSR A;  3BC8 A;  3QHX A;  1YJZ A;  4F5J A;  2VMW A;  1AMS A;  1D7U A;  3JU7 A;  3FRK A;  3MAF A;  5E3K A;  4IXS A;  2EO5 A;  4GE4 A;  1KMJ A;  2D66 A;  3NNK A;  2V0Y A;  2VMN A;  3ZRR A;  3NU8 A;  3ZRQ A;  1C7O A;  3BWN C;  4GSA A;  2X3L A;  1GC3 A;  3EI5 A;  1BT4 A;  1B5O A;  2RFV A;  4RM1 A;  4K2B A;  1EQB A;  5G0A A;  5J8Q A;  1ASF A;  2PB2 A;  2FM1 A;  4F5M A;  4F5K A;  4XAU A;  3N7N A;  1M6S A;  2VGW A;  2AY4 A;  2AY5 A;  2HP1 A;  1QIT A;  2Q7W A;  3E9K A;  4ATQ A;  2G6W A;  2Z1Y A;  2TPL A;  3HBX A;  2BI3 A;  1MAQ A;  3IF2 A;  3VOM A;  2CH1 A;  4K2I A;  2R5C B;  3GBX A;  3L44 A;  1CZC A;  3H14 A;  2EZ2 A;  1TOE A;  2VMO A;  3PDX A;  3QGU A;  4I8A A;  4LW2 A;  5F9S A;  3PGY A;  4WXF A;  3UWC A;  2Z61 A;  4ZSW A;  3ZZJ A;  1Y4I A;  5E5I A;  3PIU A;  3PJ0 A;  3F0H A;  5G2P A;  4A0G A;  3GZD A;  3B1E A;  3DZZ A;  1ELQ A;  3LY1 A;  4H51 A;  4AH3 A;  2QLR A;  2Z9X A;  1AHG A;  4HF8 A;  1AKC A;  3NYT A;  4R8D A;  3AEM A;  5DB5 A;  1T3I A;  3D6K A;  4F5G A;  5EUN A;  4R5F A;  3DR7 A;  1GEX A;  1AJS B; 
#chains in the Genus database with same CATH homology
 4E3R A;  4ZDO A;  4LNM A;  2ZY3 A;  3A8U X;  1MLY A;  2E7J A;  1ASA A;  2VGS A;  3N4S A;  4IY7 A;  3MAD A;  4ZM3 A;  3HDO A;  2W7E A;  4ADE A;  4Q31 A;  1BQA A;  3TFT A;  3DC1 A;  4GEB A;  1LS3 A;  3R4T A;  1LC5 A;  1AJS A;  1U08 A;  2WK8 A;  2BI5 A;  2D61 A;  1W23 A;  4B9B A;  1WYU B;  4EU1 A;  3KGX A;  3RCH A;  2JJE A;  1KKP A;  2EPJ A;  5FT4 A;  4XEW A;  4ATP A;  4F4E A;  1SFF A;  1O62 A;  3LVL B;  2CH2 A;  3EI9 A;  1MDZ A;  3QBO A;  3ZRP A;  1PFF A;  1SVV A;  1D7R A;  1TOJ A;  1ASG A;  3E2Y A;  1BJO B;  1C7G A;  4F5I A;  1AIA A;  3EUC A;  4EB5 A;  4XJP A;  3A9Y A;  5C6U A;  1AHX A;  1IVR A;  2VGU A;  3HQT A;  7AAT A;  4PFF A;  4O6Z A;  4UOY A;  4RKC A;  2OKJ A;  3N75 A;  1DFO A;  2FNI A;  2VMQ A;  2DOU A;  5FT8 A;  4L0O A;  3OP7 A;  3I4J A;  4XJL A;  4ZDL A;  1I48 A;  1S06 A;  1YAA A;  4Y0I A;  3HLM A;  1CQ8 A;  2D7Y A;  1ASN A;  4IW7 A;  4RKD A;  3FD0 A;  2DGM A;  2ORD A;  4WB0 B;  2DKJ A;  1IX6 A;  4ZLV A;  3WY7 A;  2BIE A;  2YHK A;  2VMS A;  5E4Z A;  3VAX A;  3EI8 A;  2HUF A;  4WYC A;  1SZU A;  2JIS A;  3RBF A;  1RV3 A;  1X29 A;  5EUD A;  1N2T A;  1G4X A;  3FFR A;  3VK3 A;  4WB0 A;  2BIG A;  1AKA A;  5FT5 A;  3NRA A;  2PB0 A;  3FZ8 A;  4JEW A;  4LC3 A;  4A6T A;  3H7F A;  2CIN A;  3NUB A;  4P3M A;  4J8L A;  4A00 A;  2CTZ A;  1N31 A;  3CQ4 A;  3LVK A;  4OBV A;  4A0R A;  4AO4 A;  1VEF A;  4UQV A;  4UHM A;  1TOI A;  4K2M A;  5G4I A;  1CL1 A;  1G7X A;  2HUU A;  3PDB B;  4JEY A;  5D95 A;  3ASB A;  2W8W A;  1IX8 A;  3G0T A;  1SZS A;  2CY8 A;  2CAN A;  3B46 A;  3HT4 A;  1X0M A;  2G7J A;  4KXK A;  1DKA A;  3A9X A;  3FCR A;  3AEM C;  2CJD A;  4EMY A;  3A2B A;  4WLH A;  4U1T A;  1TOK A;  4N0B A;  1LW4 A;  4Q76 A;  1KKJ A;  2V1P A;  3NU7 A;  3JWA A;  5M49 A;  1AY4 A;  1AIC A;  4WYG A;  3R9A A;  3CBF A;  1IUG A;  1D2F A;  1M0P A;  1DGD A;  2R0T A;  3BS8 A;  1O61 A;  3AOW A;  3E2Z A;  1SPA A;  3WGB A;  2AY3 A;  3PD6 B;  1P3W A;  1TAS A;  3DXW A;  1OAT A;  2AAT A;  5DJ9 A;  2C81 A;  3GSB A;  3A9Z A;  3AEJ C;  3N5M A;  4CXR A;  3FZ6 A;  3AEN A;  2BWN A;  2O0R A;  3FQ8 A;  1AHY A;  4MQQ A;  3JW9 A;  3BN1 A;  3AEO A;  2JJG A;  1C0N A;  1Z7D A;  1CQ6 A;  2NMP A;  3ASA A;  4RLG A;  2E54 A;  3MEB A;  3OKS A;  3PDB A;  3FDD A;  2X8U A;  3EI6 A;  2ZC0 A;  3CAI A;  1J32 A;  2GB3 A;  5K8B A;  5JAY A;  4R2N A;  4RAE A;  2VGZ A;  2DR1 A;  2ZY2 A;  4P7Y A;  3RBL A;  3NYU A;  1BJW A;  1G7W A;  4Q75 A;  1DGE A;  2YKX A;  2R5E A;  4OYT A;  1V2D A;  1D7S A;  2Z9W A;  3ELP A;  1QIS A;  1GEW A;  2Z67 A;  1MLZ A;  3FQA A;  1TAT A;  4ITG A;  1JF9 A;  2YKU A;  1GC0 A;  2VMP A;  4TMR A;  4MY5 A;  1IX7 A;  2AY8 A;  3T32 A;  1B5P A;  4NOG A;  4Q6R A;  4AZJ A;  1QGN A;  5EQC A;  2BWP A;  3CQ5 A;  1W7N A;  1AX4 A;  2R2N A;  4WYF A;  1ECX A;  2W8U A;  3KKI A;  2W7J A;  2HOY A;  2HOX A;  1QIR A;  2ZP7 A;  5HHY A;  3DRD A;  3F6T A;  2VMY A;  1S07 A;  1MDX A;  3AEP A;  3NTJ A;  1ARG A;  2DGK A;  1WYV A;  3BCA A;  2D7Z A;  4WBT A;  3ECD A;  1AJR A;  1ASE A;  2FYF A;  2VIA A;  4AOA A;  4CBS A;  4J5U A;  5LHA A;  5AX8 A;  4IXO A;  3WLX A;  3B1C A;  1N8P A;  2OGE A;  2VIB A;  3COG A;  2BYJ A;  1PMO A;  3RCH B;  4M2K A;  1RV4 A;  1W3U A;  1TAR A;  1DJE A;  1M0N A;  1ZOD A;  2JJH A;  1O4S A;  1RVU A;  1OHV A;  3WGC A;  1XI9 A;  4EFF A;  2ZY5 A;  2AY7 A;  2YKV A;  2ZSL A;  1ASM A;  1EJI A;  2D63 A;  1GDE A;  2VLF A;  3EZS A;  2F8J A;  1GD9 A;  1TOG A;  4WD2 A;  4K05 A;  2GQN A;  1JS3 A;  2ZYJ A;  4TN4 A;  2XBN A;  3VK4 A;  2YRR A;  4XK1 A;  2HUI A;  4OCA A;  4ISY A;  1BQD A;  1B8G A;  1UU1 A;  1ASB A;  4ADD A;  2EYQ A;  3DR4 A;  3NX3 A;  3M5U A;  1CS1 A;  1G4V A;  1WYT B;  3FZ7 A;  1ZOB A;  3GR9 A;  2X5D A;  2X5F A;  5BJ4 A;  1BJ4 A;  1DJ9 A;  3WZF A;  1IAX A;  3ACZ A;  3ISL A;  3UAK A;  2CJG A;  1JG8 A;  4GE7 A;  1IJI A;  5FT6 A;  3BB8 A;  1WKH A;  1BKG A;  1I43 A;  5BJ3 A;  1TPL A;  2Z9V A;  4LW4 A;  4W5K A;  1MAP A;  2AY9 A;  2BHX A;  2JGT A;  2QA3 A;  2VYC A;  1YIZ A;  4MQR A;  4ZAS A;  2VI8 A;  2CB1 A;  3FTB A;  3FVU A;  3GET A;  1BS0 A;  4U2H A;  4ZM4 A;  1ARH A;  2YKY A;  4XJO A;  4WP0 A;  9AAT A;  4ZAH A;  1C9C A;  1WYV B;  1BJO A;  1YJY A;  1LKC A;  4Y0D A;  4B98 A;  1DJU A;  2YCN A;  5M4D A;  1PG8 A;  4M2M A;  2WK9 A;  3EIB A;  4RIT A;  4GRX A;  1M7Y A;  2AEU A;  1CL2 A;  2C0R A;  3PAA A;  1DTY A;  2QMA A;  2YRI A;  2VI9 A;  4W1V A;  1AMA A;  4TV7 A;  1X2A A;  3QPG A;  1S08 A;  3N0L A;  2W7H A;  3W1I A;  3B8X A;  1OHW A;  1M4N A;  2W8J A;  2BIA A;  3G8M A;  1C7N A;  3FDB A;  1VP4 A;  4GDY A;  3DOD A;  3TAT A;  1MGV A;  4DQ6 A;  5EIG A;  4WYE A;  3MBB A;  5DX5 A;  4A0H A;  2VLH A;  3MC6 C;  3BCB A;  4HVK A;  2ZJG A;  4KAM A;  1V2F A;  5HDM A;  2ZY4 A;  1V2E A;  1LC7 A;  5KTB A;  4JF0 A;  2W7D A;  1UU2 A;  1V72 A;  2BI9 A;  1AKB A;  3MAU A;  4RJ0 A;  1CQ7 A;  2OGA A;  3AV7 A;  1LK9 A;  2AY2 A;  5EAA A;  3EIA A;  1YOO A;  4A0F A;  2D64 A;  2WKA A;  3P6K A;  4EB7 A;  2FKI A;  4XJM A;  4OC9 A;  3P1T A;  2VGV A;  4FL0 A;  2E7I A;  2EZ1 A;  3AEL A;  4AZK A;  4E1O A;  4H63 Q;  3USF A;  1ZC9 A;  1WST A;  3NUI A;  2FQ6 A;  8AAT A;  1GBN A;  1YIY A;  2DKB A;  4CBR A;  4BA5 A;  3Q8N A;  1ASC A;  2FNU A;  4ZDP A;  4BA4 A;  1B9H A;  2VMT A;  3K40 A;  2W7I A;  3KE3 A;  2O7C A;  2W7F A;  2W8T A;  5EIG B;  1H0C A;  3K28 A;  3G7Q A;  4GE9 A;  5EFS A;  4MKK A;  2HOZ A;  2YCT A;  1AMQ A;  2C44 A;  3QN6 A;  1B9I A;  3JWB A;  3ATH A;  5G4J A;  4ADC A;  1MDO A;  4ITX A;  2Z9U A;  4F5F A;  3LVJ A;  3MKJ A;  1BJN A;  3AEJ A;  4JE5 D;  1XEY A;  1CJ0 A;  3PPL A;  3E77 A;  1S09 A;  3N4X A;  4Y0H A;  4OTL A;  2QB3 A;  1E5F A;  3RI6 A;  4LNJ A;  1ARI A;  2JJF A;  3GZD C;  2BI2 A;  2ZSM A;  3WCN A;  3WX9 A;  1AAW A;  1C4K A;  4DGT A;  1M0Q A;  3MAF B;  4W8I A;  3N4R A;  3L8A A;  3AOV A;  1ASL A;  4BQ0 A;  3DU4 A;  3CQ6 A;  1FG7 A;  3E2F A;  2OQX A;  5HXX A;  4RIZ A;  2YCP A;  1YNU A;  2AEV A;  4W91 A;  1GCK A;  2Z20 A;  3I16 A;  4DBC A;  3VK2 A;  2W7L A;  3W1J A;  1B4X A;  1O69 A;  4A72 A;  1ELU A;  1ARS A;  2VMZ A;  3LV2 A;  5EAV A;  2QB2 A;  3NYS A;  4CXQ A;  1YJS A;  1OXP A;  4IX8 A;  4MSO A;  2CFB A;  3BV0 A;  3QM2 A;  3LVM A;  2PO3 A;  2GSA A;  4A6U A;  1KMK A;  3HVY A;  2OAT A;  1FC4 A;  5EUE A;  4JF1 A;  3FSL A;  5M46 A;  4W1W A;  1BW0 A;  5M4B A;  3GZC A;  2D65 A;  4CVQ A;  1AMR A;  1SF2 A;  1VJO A;  2CST A;  4OT8 A;  4RJY A;  3TFU A;  4BMK A;  3LG0 A;  1WYT A;  3FVS A;  3W1H A;  3BWN A;  4OBU A;  1EG5 A;  2AY1 A;  1GC2 A;  1SZK A;  3PD6 A;  3DXV A;  4WYD A;  2DGL A;  4ZWV A;  4W1X A;  1QZ9 A;  4KYO A;  1W7M A;  1OXO A;  3KGW A;  2E7U A;  1AHF A;  5LH9 A;  2HOR A;  4MGR A;  4E77 A;  3BCX A;  3VP6 A;  4F5L A;  2C7T A;  2JG2 A;  5F8V A;  2XH1 A;  2HZP A;  3F9T A;  1WKG A;  3QI6 A;  4WXB A;  4XQ2 A;  3IHJ A;  1I29 A;  4QGR A;  3LWS A;  1KL1 A;  3AAT A;  4LNL A;  2VMV A;  4IYO A;  1CZE A;  2WB6 A;  1GEY A;  1IBJ A;  1H1C A;  3II0 A;  4WLJ A;  3ELE A;  3EI7 A;  4ADB A;  2VGT A;  3H9X A;  3ZZK A;  3RQ1 A;  3GJU A;  2GMS A;  2VMX A;  2R5C A;  1FG3 A;  1LW5 A;  3MC6 A;  4E3Q A;  4JEX A;  1GC4 A;  3FQ7 A;  3JZL A;  5I92 A;  2BWO A;  2QBT A;  5IWQ A;  1ORD A;  1QJ3 A;  3HMU A;  2W7G A;  5DJ1 A;  4PIW A;  4WYA A;  4FFC A;  1RVY A;  1X28 A;  3B1D A;  4IYO B;  1Z3Z A;  1OHY A;  3EZ1 A;  2OKK A;  1M0O A;  3NDN A;  4PFN A;  1AHE A;  2AY6 A;  2FN6 A;  4OMA A;  1KL2 A;  1IAY A;  1M32 A;  3TQX A;  1UKJ A;  5G2Q A;  1J04 A;  3FVX A;  2GMU A;  4MKJ A;  3E2Z B;  1AY8 A;  2ZUK A;  3FKD A;  1E5E A;  2Z1Z A;  2W7M A;  3BWO A;  4JEV A;  4JEZ A;  2BYL A;  1ASD A;  2YOB A;  2O1B A;  1I41 A;  1QJ5 A;  3PA9 A;  2VMR A;  1PMM A;  4UHN A;  5D5S A;  3DYD A;  3UE8 A;  1JS6 A;  3WCO A;  4WXG A;  1D7V A;  4F5H A;  1W7L A;  4MQP A;  1AY5 A;  3E6G A;  4AO9 A;  2VMU A;  3JTX A;  2W7K A;  5TF5 A;  2EH6 A;  1UU0 A;  3GWP A;  4PVF A;  2KFP A;  2WK7 A;  2EGY A;  4R5Z A;  4UHO A;  3TCM A;  3WKS A;  4A6R A;  3HL2 A;  2W8V A;  4M2J A;  4IXZ A;  1WYU A;  4JE5 A;  3K7Y A;  2A1V A;  2BI1 A;  3RUY A;  1ART A;  5G09 A;  4ZSY A;  2BKW A;  3FFH A;  3WKR A;  2CJH A;  3I5T A;  2HP2 A;  1S0A A;  4BHD A;  1LC8 A;  2D5Y A;  3AEN B;  4ZWM A;  1AAM A;  1AIB A;  4N0W A;  2QSR A;  3BC8 A;  3QHX A;  1YJZ A;  4F5J A;  2VMW A;  1AMS A;  1D7U A;  3JU7 A;  3FRK A;  3MAF A;  5E3K A;  4IXS A;  2EO5 A;  4GE4 A;  1KMJ A;  2D66 A;  3NNK A;  2V0Y A;  2VMN A;  3ZRR A;  3NU8 A;  3ZRQ A;  1C7O A;  3BWN C;  4GSA A;  2X3L A;  1GC3 A;  3EI5 A;  1BT4 A;  1B5O A;  2RFV A;  4RM1 A;  4K2B A;  1EQB A;  5G0A A;  5J8Q A;  1ASF A;  2PB2 A;  2FM1 A;  4F5M A;  4F5K A;  4XAU A;  3N7N A;  1M6S A;  2VGW A;  2AY4 A;  2AY5 A;  2HP1 A;  1QIT A;  2Q7W A;  3E9K A;  4ATQ A;  2G6W A;  2Z1Y A;  2TPL A;  3HBX A;  2BI3 A;  1MAQ A;  3IF2 A;  3VOM A;  2CH1 A;  4K2I A;  2R5C B;  3GBX A;  3L44 A;  1CZC A;  3H14 A;  2EZ2 A;  1TOE A;  2VMO A;  3PDX A;  3QGU A;  4I8A A;  4LW2 A;  5F9S A;  3PGY A;  4WXF A;  3UWC A;  2Z61 A;  4ZSW A;  3ZZJ A;  1Y4I A;  5E5I A;  3PIU A;  3PJ0 A;  3F0H A;  5G2P A;  4A0G A;  3GZD A;  3B1E A;  3DZZ A;  1ELQ A;  3LY1 A;  4H51 A;  4AH3 A;  2QLR A;  2Z9X A;  1AHG A;  4HF8 A;  1AKC A;  3NYT A;  4R8D A;  3AEM A;  5DB5 A;  1T3I A;  3D6K A;  4F5G A;  5EUN A;  4R5F A;  3DR7 A;  1GEX A;  1AJS B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...