2AY5A

Aromatic amino acid aminotransferase with 3-indolepropionic acid
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
394
structure length
394
Chain Sequence
b'MLGNLKPQAPDKILALMGEFRADPRQGKIDLGVGVYKDATGHTPIMRAVHAAEQRMLETETTKTYAGLSGEPEFQKAMGELILGDGLKSETTATLATVGGTGALRQALELARMANPDLRVFVSDPTWPNHVSIMNFMGLPVQTYRYFDAETRGVDFEGMKADLAAAKKGDMVLLHGCCHNPTGANLTLDQWAEIASILEKTGALPLIDLAYQGFGDGLEEDAAGTRLIASRIPEVLIAASCSKNFGIYRERTGCLLALCADAATRELAQGAMAFLNRQTYSFPPFHGAKIVSTVLTTPELRADWMAELEAVRSGMLRLREQLAGELRDLSGSDRFGFVAEHRGMFSRLGATPEQVKRIKEEFGIYMVGDSRINIAGLNDNTIPILARAIIEVGV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AROMATIC AMINO ACID AMINOTRANSFERASE
publication title The active site of Paracoccus denitrificans aromatic amino acid aminotransferase has contrary properties: flexibility and rigidity.
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Aminotransferase
total genus 144
structure length 394
sequence length 394
chains with identical sequence B
ec nomenclature ec 2.6.1.57: Aromatic-amino-acid transaminase.
pdb deposition date 1998-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 2ay5A02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 2ay5A01
3RI6A 4N0WA 2BWPA 1QISA 1UKJA 2DKJA 2EPJA 3A2BA 4WYGA 2X8UA 1E5EA 5F9SA 3TCMA 2R2NA 4LNJA 4EMYA 1AMSA 1C7GA 4W1WA 2VGSA 1M4NA 1IUGA 1GBNA 1QGNA 3MAFB 5E4ZA 2YKYA 2VGTA 3CQ6A 1YIYA 2AATA 3ATHA 1VP4A 2VIBA 1PFFA 1EG5A 5HXXA 2Z9WA 4A0RA 1OHWA 1BJWA 1PMOA 3E6GA 1N31A 4R2NA 4WYFA 2W8JA 4QGRA 2W7MA 2WK7A 1D2FA 3AEMA 4EU1A 1SZSA 2C0RA 4DBCA 2C44A 8AATA 3HDOA 3P6KA 2PO3A 3L8AA 2XH1A 3EIAA 1KMKA 4WYDA 4TV7A 1AHYA 5FT4A 4LC3A 3T32A 1CJ0A 3CQ5A 4XQ2A 3NNKA 4OBVA 3KKIA 4ZM3A 1SFFA 1OATA 2DKBA 5G09A 4MSOA 3AATA 2D63A 2YCTA 2W7HA 4DQ6A 3PDBA 1YJZA 1WYUB 1OHVA 2BHXA 5E5IA 1ASNA 1B4XA 1IX7A 2AY5A 3WZFA 2VMZA 1UU2A 3PD6B 2YKUA 2ZY4A 1BJ4A 4U2HA 4Y0DA 1VJOA 2EGYA 1AAWA 3DRDA 3AOVA 2ZYJA 1S0AA 1MLZA 1O69A 4Q76A 2QA3A 1MAPA 1FG3A 1XI9A 1YAAA 3BWNA 2C7TA 3FQ7A 3ACZA 2ZY5A 4GE4A 1EJIA 1TPLA 3COGA 4WD2A 3EIBA 2ORDA 3NYTA 2ZY3A 3N0LA 5G4JA 1DJ9A 2QMAA 3QN6A 4UOYA 1WYVA 4OCAA 3AENB 4A0GA 1Z3ZA 5EFSA 4ITXA 4IXZA 2YCNA 4CXQA 2ZSLA 3GWPA 3FDBA 4F5KA 4BA4A 4OMAA 3H14A 3E2ZB 3NTJA 3TFTA 2PB0A 1S09A 1W7LA 2NMPA 3EZSA 2R5EA 3FZ6A 3KE3A 4FL0A 1DJEA 4ZSWA 3ELEA 2AY7A 3JWBA 4ISYA 5F8VA 4O6ZA 1D7RA 2GSAA 3WY7A 1B9HA 2QB2A 1AJSB 2JJEA 3BCBA 4JF0A 3UAKA 1ECXA 2Z1YA 1IJIA 4GE9A 3I16A 1MLYA 2ZP7A 5DB5A 1BJOB 1I48A 2HP1A 3MAUA 2OATA 2HP2A 3CQ4A 1SVVA 3BV0A 1EQBA 4B98A 4F5GA 1MGVA 1QITA 1N2TA 1G4XA 5K8BA 1CQ8A 2AY3A 1TOKA 1GEXA 4RJ0A 4F5HA 4HVKA 2E7JA 4MQQA 1ASEA 1JS3A 1V2DA 1MAQA 1CQ7A 1WSTA 1C7NA 4TMRA 1CQ6A 4WBTA 1ASCA 1O62A 1ARHA 3LVLB 4XJMA 4JF1A 3VP6A 4A0HA 2BI5A 2YCPA 3PIUA 3KGWA 3QBOA 4N0BA 1H1CA 4UHMA 1GC3A 1LS3A 1AX4A 4ZDLA 4CBSA 2YRRA 3B8XA 2AY2A 3DR4A 4RAEA 3AOWA 2JJFA 1TASA 3IF2A 4WB0B 1C7OA 3MEBA 3OKSA 3VOMA 4AZKA 4WYEA 2OKKA 3RCHB 1TOJA 5FT5A 2R0TA 4BHDA 3DU4A 1E5FA 2XBNA 3AV7A 1GEYA 2CSTA 2W8WA 1RVUA 1AHXA 3HL2A 4LNLA 2W7EA 2HUFA 4M2KA 2EH6A 3LG0A 1OHYA 3MKJA 4AOAA 2BIEA 4OC9A 4ZDOA 1ASLA 4WLJA 5HHYA 3JW9A 3QHXA 1I29A 4F5FA 4AZJA 1GC0A 2AY4A 3GETA 4WLHA 1V2FA 1M0QA 3PJ0A 1M0PA 1LC7A 4OTLA 4ZWMA 3FZ7A 3OP7A 3AELA 4GSAA 3DXVA 4JEVA 5EAAA 2GMSA 4UHOA 5I92A 3BWOA 1ARIA 3GSBA 2D7YA 2ZC0A 3FFHA 2YKXA 2HOXA 3BCXA 2ZJGA 1AKAA 3MADA 3BN1A 1WYTA 1OXPA 2Z67A 2BWOA 4B9BA 2PB2A 2VI8A 1DJUA 5EUEA 2Z9UA 1O4SA 4FFCA 2Z20A 3ELPA 1GC2A 3ASAA 1T3IA 2BKWA 3B1DA 3QPGA 4R8DA 1SPAA 4GEBA 2FM1A 1M6SA 2O0RA 2VMXA 2QBTA 4R5ZA 1B5OA 1V72A 2V1PA 4RM1A 3NU8A 2AY6A 1AMQA 2ZSMA 3ISLA 4H51A 2WK9A 2X3LA 4HF8A 5IWQA 1GD9A 2VMNA 3FKDA 1W23A 2W7FA 2VIAA 4Q6RA 2BI2A 4IYOB 1RVYA 3FQ8A 3FSLA 4WYAA 2W7IA 4WXGA 4PIWA 1TOGA 3TATA 2F8JA 2GQNA 3WGBA 2O7CA 2O1BA 4W1XA 1IX6A 1X0MA 4BMKA 4RJYA 2D66A 4I8AA 2CJHA 4IY7A 4OYTA 1ASFA 1DGDA 2WK8A 2VI9A 5FT6A 1YOOA 3E2FA 3VAXA 1Y4IA 5M4DA 1S07A 2W8TA 1YJYA 3VK3A 4RLGA 5EIGA 3PPLA 2BYLA 1ASAA 2CTZA 2VMQA 3HVYA 3AEJA 3LVJA 2W7KA 4ZDPA 1I41A 2DGLA 1P3WA 3E2YA 1IVRA 1MDXA 3D6KA 2VGWA 3GZCA 4A6TA 2R5CB 4WYCA 2VGZA 1AHFA 3A9XA 1RV4A 3BB8A 2VMYA 5M4BA 1SZKA 4K2BA 2AEUA 1TARA 2D64A 2JJGA 3MAFA 1AY8A 4WXFA 3IHJA 3P1TA 1V2EA 1XEYA 4W5KA 5AX8A 3F0HA 3ECDA 5LHAA 1M32A 1M7YA 1RV3A 4K2MA 1KMJA 4JE5A 5DX5A 2FYFA 5BJ4A 3B1CA 4IW7A 1CL1A 4JEYA 1DFOA 4PFFA 3E77A 1AJRA 1UU1A 4ZLVA 4E3QA 4J8LA 2X5DA 2OKJA 3FVXA 3TQXA 1B9IA 1PG8A 2VGVA 1BQAA 1QJ5A 3FVSA 4MGRA 1B5PA 2VMOA 2X5FA 1KL2A 3F9TA 1M0NA 2G6WA 4JEXA 1C9CA 3MC6A 1ASMA 1KL1A 3NX3A 1WYUA 1ELQA 2CH1A 4AO4A 3JU7A 2DR1A 2ZY2A 4U1TA 5DJ9A 3PD6A 1ARGA 3L44A 4MQRA 4RKDA 2BWNA 5J8QA 2DOUA 4RKCA 1JF9A 3FZ8A 2Z61A 3LWSA 1C4KA 1AMAA 3F6TA 2VMPA 4Q31A 4Y0IA 3R4TA 1AIAA 4L0OA 3HQTA 4F5MA 1S08A 3WKSA 1AMRA 1ZODA 3NUIA 3NYUA 4P3MA 3HBXA 4J5UA 2CINA 4W1VA 5EAVA 4A6UA 3WGCA 1ASBA 2D61A 4F5IA 3AENA 3AEJC 3R9AA 3FRKA 3VK2A 3WCOA 4WP0A 5M46A 1CL2A 3EI7A 3FQAA 1FG7A 5BJ3A 2EZ2A 1GDEA 3E2ZA 4W91A 2E7UA 1ZC9A 1S06A 1TOIA 4F5JA 2JISA 1AKCA 2E7IA 3QM2A 4OBUA 5G2QA 2V0YA 2YHKA 2VMWA 3LVMA 4RIZA 3PAAA 2HZPA 4KXKA 3JWAA 3WX9A 4PVFA 1AJSA 1AHEA 4CBRA 2AY8A 2BIAA 3PGYA 1LC5A 2AEVA 2VLFA 4A00A 3EI9A 3KGXA 4LW2A 3W1IA 5JAYA 1BJOA 1UU0A 4GRXA 2FQ6A 4K2IA 4MY5A 3RBLA 1W7MA 1ELUA 1LKCA 3AEPA 2JGTA 1ORDA 4ZAHA 3GJUA 4DGTA 2DGMA 4EB7A 1W3UA 4XK1A 1IAYA 1AAMA 4MQPA 4TN4A 4ATQA 4E3RA 1CS1A 1LW5A 4WXBA 4ADEA 1D7VA 3ASBA 3MC6C 2VLHA 3HLMA 3NRAA 2BI3A 3DZZA 3GZDC 1DGEA 4IXOA 1G4VA 1AIBA 1O61A 3EUCA 1AICA 1AY4A 4W8IA 4UHNA 1DKAA 1MDZA 2D7ZA 4ZWVA 3CBFA 2CFBA 3DODA 5C6UA 1TATA 3PDBB 2VMRA 2OGAA 3GR9A 1DTYA 1KKJA 2VGUA 2Z9XA 2W7LA 4ZASA 4JEWA 3H7FA 1B8GA 1G7WA 4WB0A 3UE8A 3DYDA 1MDOA 3RCHA 3RQ1A 1YJSA 3NU7A 4RITA 1SZUA 5EUDA 1ZOBA 1FC4A 1D7SA 1AY5A 4EFFA 2CANA 1X29A 4UQVA 1GEWA 2AY9A 3QGUA 4IXSA 5G0AA 4A0FA 3ZZJA 1WYVB 2YOBA 2VYCA 1YIZA 2ZUKA 4Q75A 4ADDA 1GCKA 3A9YA 4F5LA 2Q7WA 3PDXA 4XJOA 4M2MA 3FVUA 3N5MA 5DJ1A 2BI1A 3A9ZA 7AATA 3ZRQA 1C0NA 3VK4A 3WLXA 3EI5A 1J04A 4ADBA 2D65A 1BQDA 4M2JA 2BYJA 2VMVA 2Z1ZA 1H0CA 3FCRA 4E77A 9AATA 2CB1A 3FTBA 1YNUA 4F4EA 2W7JA 4AH3A 2W7GA 3LY1A 1U08A 3EZ1A 2FNIA 4KAMA 1LW4A 2W8VA 4IYOA 1X2AA 5LH9A 5M49A 1LC8A 4R5FA 3W1JA 3JZLA 3UWCA 3FD0A 4JEZA 2CY8A 2CJGA 4CVQA 1KKPA 1WKGA 4E1OA 2DGKA 2OGEA 3HMUA 1M0OA 2HORA 3K7YA 5EUNA 3GZDA 1AKBA 3FFRA 1D7UA 3EI8A 2GMUA 5G2PA 4XJLA 3HT4A 3W1HA 2VMUA 4GDYA 3ZRRA 1ASDA 3RBFA 2R5CA 1X28A 2FNUA 2YRIA 2C81A 2YKVA 4ZM4A 2CJDA 2W8UA 2HOZA 2RFVA 4Y0HA 1BJNA 2EO5A 1BKGA 3PA9A 4NOGA 3TFUA 4ATPA 1J32A 3JTXA 3BS8A 4XAUA 5D5SA 3A8UX 1Z7DA 5FT8A 1VEFA 3NYSA 3E9KA 4GE7A 2VMSA 2FN6A 2HUUA 2VMTA 1BS0A 1IBJA 4LW4A 1TOEA 2QB3A 1CZEA 3B46A 3USFA 3AEMC 5HDMA 2E54A 2OQXA 4JE5D 3CAIA 3G7QA 1IX8A 1QIRA 3Q8NA 3II0A 3MBBA 3DXWA 1OXOA 1CZCA 1ARSA 1JG8A 3N75A 3I4JA 2TPLA 5G4IA 3QI6A 3RUYA 1WYTB 1LK9A 3G8MA 3K28A 4MKJA 3GBXA 3LV2A 4EB5A 2WKAA 1WKHA 4ADCA 1W7NA 3BC8A 2CH2A 2EZ1A 4A72A 4BA5A 4PFNA 3ZRPA 2JG2A 3FDDA 1GC4A 3DR7A 1IAXA 2BIGA 4KYOA 4ZSYA 2HOYA 2D5YA 3B1EA 1QJ3A 1AHGA 2GB3A 4XEWA 1I43A 1JS6A 2HUIA 3M5UA 5D95A 4BQ0A 2Z9VA 3AEOA 3DC1A 5TF5A 3WCNA 1BT4A 1ASGA 1SF2A 3NDNA 3BWNC 4A6RA 3G0TA 4AO9A 3I5TA 4P7YA 1QZ9A 1N8PA 4LNMA 4CXRA 1BW0A 2AY1A 3NUBA 3WKRA 4MKKA 1G7XA 3BCAA 3LVKA 4IX8A 1ARTA 2QLRA 4ITGA 4XJPA 3EI6A 2W7DA 5EIGB 5EQCA 1PMMA 4OT8A 3K40A 5E3KA 2JJHA 3ZZKA 2BI9A
chains in the Genus database with same CATH superfamily
3RI6A 4N0WA 2BWPA 1QISA 1UKJA 2DKJA 2EPJA 3A2BA 4WYGA 2X8UA 1E5EA 5F9SA 3TCMA 2R2NA 4LNJA 4EMYA 1AMSA 1C7GA 4W1WA 2VGSA 1M4NA 1IUGA 1GBNA 1QGNA 3MAFB 5E4ZA 2YKYA 2VGTA 3CQ6A 1YIYA 2AATA 3ATHA 1VP4A 2VIBA 1PFFA 1EG5A 5HXXA 2Z9WA 4A0RA 1OHWA 1BJWA 1PMOA 3E6GA 1N31A 3N4SA 4R2NA 4WYFA 2W8JA 4QGRA 2W7MA 2WK7A 1D2FA 3AEMA 4EU1A 1SZSA 2C0RA 4DBCA 2C44A 8AATA 3HDOA 3P6KA 2PO3A 3L8AA 2XH1A 3EIAA 1KMKA 2EYQA 4WYDA 4TV7A 1AHYA 5FT4A 4LC3A 3T32A 1CJ0A 3CQ5A 4XQ2A 3NNKA 4OBVA 3KKIA 4ZM3A 1SFFA 1OATA 2DKBA 5G09A 4MSOA 2FKIA 2KFPA 3AATA 2D63A 2YCTA 2W7HA 4DQ6A 3PDBA 1YJZA 1WYUB 1OHVA 2BHXA 5E5IA 1ASNA 1B4XA 1IX7A 2AY5A 3WZFA 2VMZA 1UU2A 3PD6B 2YKUA 2ZY4A 1BJ4A 4U2HA 4Y0DA 1KAFA 1VJOA 2EGYA 1AAWA 3DRDA 3AOVA 2ZYJA 1S0AA 1MLZA 1O69A 4Q76A 2QA3A 1MAPA 1FG3A 1XI9A 1YAAA 3BWNA 2C7TA 3FQ7A 3ACZA 2ZY5A 4GE4A 1EJIA 1TPLA 3COGA 4WD2A 3EIBA 2ORDA 3NYTA 2ZY3A 3N0LA 5G4JA 1DJ9A 2QMAA 3QN6A 4UOYA 1WYVA 4OCAA 3AENB 4A0GA 1Z3ZA 5EFSA 4ITXA 4IXZA 2YCNA 4CXQA 2ZSLA 3GWPA 3FDBA 4F5KA 4BA4A 4OMAA 3H14A 3E2ZB 3NTJA 3TFTA 2PB0A 1S09A 1W7LA 2NMPA 3EZSA 2R5EA 3FZ6A 3KE3A 4FL0A 4K05A 1DJEA 4ZSWA 3ELEA 2AY7A 3JWBA 4ISYA 5F8VA 4O6ZA 1D7RA 2GSAA 3WY7A 1B9HA 2QB2A 1AJSB 2JJEA 3BCBA 4JF0A 3UAKA 1ECXA 2Z1YA 1IJIA 4GE9A 3I16A 1MLYA 2ZP7A 5DB5A 1BJOB 1I48A 2HP1A 3MAUA 2OATA 2HP2A 3CQ4A 1SVVA 3BV0A 1EQBA 4B98A 4F5GA 1MGVA 1QITA 2A1VA 1N2TA 1G4XA 5K8BA 1CQ8A 2AY3A 1TOKA 1GEXA 4RJ0A 4F5HA 4HVKA 2E7JA 4MQQA 1ASEA 2G7JA 1JS3A 1V2DA 1MAQA 1CQ7A 1WSTA 1C7NA 4TMRA 1CQ6A 4WBTA 1ASCA 1O62A 1ARHA 3LVLB 4XJMA 4JF1A 3VP6A 4A0HA 2BI5A 2YCPA 3PIUA 3KGWA 3QBOA 4N0BA 1H1CA 4UHMA 1GC3A 1LS3A 1AX4A 4ZDLA 4CBSA 2YRRA 3B8XA 2AY2A 3DR4A 4RAEA 3AOWA 2JJFA 1TASA 3IF2A 4WB0B 1C7OA 3MEBA 3OKSA 3VOMA 4AZKA 4WYEA 2OKKA 3RCHB 1TOJA 5FT5A 2R0TA 4BHDA 3DU4A 1E5FA 2XBNA 3AV7A 1GEYA 2CSTA 2W8WA 3N4RA 1RVUA 1AHXA 3HL2A 4LNLA 2W7EA 2HUFA 4M2KA 2EH6A 3LG0A 1OHYA 3MKJA 4AOAA 2BIEA 4OC9A 4ZDOA 1ASLA 4WLJA 5HHYA 3JW9A 3QHXA 1I29A 4F5FA 4AZJA 1GC0A 2AY4A 3GETA 4WLHA 1V2FA 1M0QA 3PJ0A 1M0PA 1LC7A 4OTLA 4ZWMA 3FZ7A 3OP7A 3AELA 4GSAA 3DXVA 4JEVA 5EAAA 2GMSA 4UHOA 5I92A 3BWOA 1ARIA 3GSBA 2D7YA 2ZC0A 3FFHA 2YKXA 2HOXA 3BCXA 2ZJGA 1AKAA 3MADA 3BN1A 2QSRA 1WYTA 1OXPA 2Z67A 2BWOA 4B9BA 2PB2A 2VI8A 1DJUA 5EUEA 2Z9UA 1O4SA 4FFCA 2Z20A 3ELPA 1GC2A 3ASAA 1T3IA 2BKWA 3B1DA 3QPGA 4R8DA 1SPAA 4GEBA 2FM1A 1M6SA 2O0RA 2VMXA 2QBTA 4R5ZA 1B5OA 1V72A 2V1PA 4RM1A 3NU8A 2AY6A 1AMQA 2ZSMA 3ISLA 4H51A 2WK9A 2X3LA 4HF8A 5IWQA 1GD9A 2VMNA 3FKDA 1W23A 2W7FA 2VIAA 4Q6RA 2BI2A 4IYOB 1RVYA 3FQ8A 3FSLA 4WYAA 2W7IA 4WXGA 4PIWA 1TOGA 3TATA 2F8JA 2GQNA 3WGBA 2O7CA 2O1BA 4W1XA 1IX6A 1X0MA 4BMKA 4RJYA 2D66A 4I8AA 2CJHA 4IY7A 4OYTA 1ASFA 1DGDA 2WK8A 2VI9A 5FT6A 1YOOA 3E2FA 3VAXA 1Y4IA 5M4DA 1S07A 2W8TA 1YJYA 3VK3A 4RLGA 5EIGA 3PPLA 2BYLA 1ASAA 2CTZA 2VMQA 3HVYA 3AEJA 3LVJA 2W7KA 4ZDPA 1I41A 2DGLA 1P3WA 3E2YA 1IVRA 1MDXA 3D6KA 2VGWA 3GZCA 4A6TA 2R5CB 4WYCA 2VGZA 1AHFA 3A9XA 1RV4A 3BB8A 2VMYA 5M4BA 1SZKA 4K2BA 2AEUA 1TARA 2D64A 2JJGA 3MAFA 1AY8A 4WXFA 3IHJA 3P1TA 1V2EA 1XEYA 4W5KA 5AX8A 3F0HA 3ECDA 5LHAA 1M32A 1M7YA 1RV3A 4K2MA 1KMJA 4JE5A 5DX5A 2FYFA 5BJ4A 3B1CA 4IW7A 1CL1A 4JEYA 3N4XA 1DFOA 4PFFA 3E77A 1AJRA 1UU1A 4ZLVA 4E3QA 3H9XA 4J8LA 2X5DA 2OKJA 3FVXA 3TQXA 1B9IA 1PG8A 2VGVA 1BQAA 1QJ5A 3FVSA 4MGRA 1B5PA 2VMOA 2X5FA 2WB6A 1KL2A 3F9TA 1M0NA 2G6WA 4JEXA 1C9CA 3MC6A 1ASMA 1KL1A 3NX3A 1WYUA 1ELQA 2CH1A 4AO4A 3JU7A 2DR1A 2ZY2A 4U1TA 5DJ9A 3PD6A 1ARGA 3L44A 4MQRA 4RKDA 2BWNA 5J8QA 2DOUA 4RKCA 1JF9A 3FZ8A 2Z61A 3LWSA 1C4KA 1AMAA 3F6TA 2VMPA 4Q31A 4Y0IA 3R4TA 1AIAA 4L0OA 3HQTA 4F5MA 1S08A 3WKSA 1AMRA 1ZODA 3NUIA 3NYUA 4P3MA 3HBXA 4J5UA 2CINA 4W1VA 5EAVA 4A6UA 3WGCA 1ASBA 2D61A 4F5IA 3AENA 3AEJC 3R9AA 3FRKA 3VK2A 3WCOA 4WP0A 5M46A 1CL2A 3EI7A 3FQAA 1FG7A 5BJ3A 2EZ2A 1GDEA 3E2ZA 4W91A 2E7UA 1ZC9A 1S06A 1TOIA 4F5JA 2JISA 1AKCA 2E7IA 3QM2A 4OBUA 5G2QA 2V0YA 2YHKA 2VMWA 3LVMA 4RIZA 3PAAA 2HZPA 4KXKA 3JWAA 3WX9A 4PVFA 1AJSA 1AHEA 4CBRA 2AY8A 2BIAA 3PGYA 1LC5A 2AEVA 2VLFA 4A00A 3EI9A 3KGXA 4LW2A 3W1IA 5JAYA 1BJOA 1UU0A 4GRXA 2FQ6A 4K2IA 4MY5A 3RBLA 1W7MA 1ELUA 1LKCA 3AEPA 2JGTA 1ORDA 4ZAHA 3GJUA 4DGTA 2DGMA 4EB7A 1W3UA 4XK1A 1IAYA 1AAMA 4MQPA 4TN4A 4ATQA 4E3RA 1CS1A 1LW5A 4WXBA 4ADEA 1D7VA 3ASBA 3MC6C 2VLHA 3HLMA 3NRAA 2BI3A 3DZZA 3GZDC 1DGEA 4IXOA 1G4VA 1AIBA 1O61A 3EUCA 1AICA 1AY4A 4W8IA 4UHNA 1DKAA 1MDZA 2D7ZA 4ZWVA 3CBFA 2CFBA 3DODA 5C6UA 1TATA 3PDBB 2VMRA 2OGAA 3GR9A 1DTYA 1KKJA 2VGUA 2Z9XA 2W7LA 4ZASA 4JEWA 3H7FA 1B8GA 1G7WA 4WB0A 3UE8A 3DYDA 1MDOA 3RCHA 3RQ1A 1YJSA 3NU7A 4RITA 1SZUA 5EUDA 1ZOBA 1FC4A 1D7SA 1AY5A 4EFFA 2CANA 1X29A 4UQVA 1GEWA 2AY9A 3QGUA 4IXSA 5G0AA 4A0FA 3ZZJA 1WYVB 2YOBA 2VYCA 1YIZA 2ZUKA 4Q75A 4ADDA 1GCKA 3A9YA 4F5LA 2Q7WA 3PDXA 4XJOA 4M2MA 3FVUA 3N5MA 5DJ1A 2BI1A 3A9ZA 7AATA 3ZRQA 1C0NA 3VK4A 3WLXA 3EI5A 1J04A 4ADBA 2D65A 1BQDA 4M2JA 2BYJA 4H63Q 2VMVA 2Z1ZA 1H0CA 3FCRA 4E77A 9AATA 2CB1A 3FTBA 1YNUA 4F4EA 2W7JA 4AH3A 2W7GA 3LY1A 1U08A 3EZ1A 2FNIA 4KAMA 1LW4A 2W8VA 4IYOA 1X2AA 5LH9A 5M49A 5KTBA 1LC8A 4R5FA 3W1JA 3JZLA 3UWCA 3FD0A 4JEZA 2CY8A 2CJGA 4CVQA 1KKPA 1WKGA 4E1OA 2DGKA 2OGEA 3HMUA 1M0OA 2HORA 3K7YA 5EUNA 3GZDA 3N7NA 1AKBA 3FFRA 1D7UA 3EI8A 2GMUA 5G2PA 4XJLA 3HT4A 3W1HA 2VMUA 4GDYA 3ZRRA 1ASDA 3RBFA 2R5CA 1X28A 2FNUA 2YRIA 2C81A 2YKVA 4ZM4A 2CJDA 2W8UA 2HOZA 2RFVA 4Y0HA 1BJNA 2EO5A 1BKGA 3PA9A 4NOGA 3TFUA 4ATPA 1J32A 3JTXA 3BS8A 4XAUA 5D5SA 3A8UX 1Z7DA 5FT8A 1VEFA 3NYSA 3E9KA 4GE7A 2VMSA 2FN6A 2HUUA 2VMTA 1BS0A 1IBJA 4LW4A 1TOEA 2QB3A 1CZEA 3B46A 3USFA 3AEMC 5HDMA 2E54A 2OQXA 4JE5D 3CAIA 3G7QA 1IX8A 1QIRA 3Q8NA 3II0A 3MBBA 3DXWA 1OXOA 1CZCA 1ARSA 1JG8A 3N75A 3I4JA 2TPLA 5G4IA 3QI6A 3RUYA 1WYTB 1LK9A 3G8MA 3K28A 4MKJA 3GBXA 3LV2A 4EB5A 2WKAA 1WKHA 4ADCA 1W7NA 3BC8A 2CH2A 2EZ1A 4A72A 4BA5A 4PFNA 3ZRPA 2JG2A 3FDDA 1GC4A 3DR7A 1IAXA 2BIGA 4KYOA 4ZSYA 2HOYA 2D5YA 3B1EA 1QJ3A 1AHGA 2GB3A 4XEWA 1I43A 1JS6A 2HUIA 3M5UA 5D95A 4BQ0A 2Z9VA 3AEOA 3DC1A 5TF5A 3WCNA 1BT4A 1ASGA 1SF2A 3NDNA 3BWNC 4A6RA 3G0TA 4AO9A 3I5TA 4P7YA 1QZ9A 1N8PA 4LNMA 4CXRA 1BW0A 2AY1A 3NUBA 3WKRA 4MKKA 1G7XA 3BCAA 3LVKA 4IX8A 1ARTA 2QLRA 4ITGA 4XJPA 3EI6A 2W7DA 5EIGB 5EQCA 1PMMA 4OT8A 3K40A 5E3KA 2JJHA 3ZZKA 2BI9A
chains in the Genus database with same CATH topology
3RI6A 4N0WA 2BWPA 1QISA 1UKJA 2DKJA 2EPJA 3A2BA 4WYGA 2X8UA 1E5EA 5F9SA 3TCMA 2R2NA 4LNJA 4EMYA 1AMSA 1C7GA 4W1WA 2VGSA 1M4NA 1IUGA 1GBNA 1QGNA 3MAFB 5E4ZA 2YKYA 2VGTA 3CQ6A 1YIYA 2AATA 3ATHA 1VP4A 2VIBA 1PFFA 1EG5A 5HXXA 2Z9WA 4A0RA 1OHWA 1BJWA 1PMOA 3E6GA 1N31A 3N4SA 4R2NA 4WYFA 2W8JA 4QGRA 2W7MA 2WK7A 1D2FA 3AEMA 4EU1A 1SZSA 2C0RA 4DBCA 2C44A 8AATA 3HDOA 3P6KA 2PO3A 3L8AA 2XH1A 3EIAA 1KMKA 2EYQA 4WYDA 4TV7A 1AHYA 5FT4A 4LC3A 3T32A 1CJ0A 3CQ5A 4XQ2A 3NNKA 4OBVA 3KKIA 4ZM3A 1SFFA 1OATA 2DKBA 5G09A 4MSOA 2FKIA 2KFPA 3AATA 2D63A 2YCTA 2W7HA 4DQ6A 3PDBA 1YJZA 1WYUB 1OHVA 2BHXA 5E5IA 1ASNA 1B4XA 1IX7A 2AY5A 3WZFA 2VMZA 1UU2A 3PD6B 2YKUA 2ZY4A 1BJ4A 4U2HA 4Y0DA 1VJOA 2EGYA 1AAWA 3DRDA 3AOVA 2ZYJA 1S0AA 1MLZA 1O69A 4Q76A 2QA3A 1MAPA 1FG3A 1XI9A 1YAAA 3BWNA 2C7TA 3FQ7A 3ACZA 2ZY5A 4GE4A 1EJIA 1TPLA 3COGA 4WD2A 3EIBA 2ORDA 3NYTA 2ZY3A 3N0LA 5G4JA 1DJ9A 2QMAA 3QN6A 4UOYA 1WYVA 4OCAA 3AENB 4A0GA 1Z3ZA 5EFSA 4ITXA 4IXZA 2YCNA 4CXQA 2ZSLA 3GWPA 3FDBA 4F5KA 4BA4A 4OMAA 3H14A 3E2ZB 3NTJA 3TFTA 2PB0A 1S09A 1W7LA 2NMPA 3EZSA 2R5EA 3FZ6A 3KE3A 4FL0A 4K05A 1DJEA 4ZSWA 3ELEA 2AY7A 3JWBA 4ISYA 5F8VA 4O6ZA 1D7RA 2GSAA 3WY7A 1B9HA 2QB2A 1AJSB 2JJEA 3BCBA 4JF0A 3UAKA 1ECXA 2Z1YA 1IJIA 4GE9A 3I16A 1MLYA 2ZP7A 5DB5A 1BJOB 1I48A 2HP1A 3MAUA 2OATA 2HP2A 3CQ4A 1SVVA 3BV0A 1EQBA 4B98A 4F5GA 1MGVA 1QITA 2A1VA 1N2TA 1G4XA 5K8BA 1CQ8A 2AY3A 1TOKA 1GEXA 4RJ0A 4F5HA 4HVKA 2E7JA 4MQQA 1ASEA 2G7JA 1JS3A 1V2DA 1MAQA 1CQ7A 1WSTA 1C7NA 4TMRA 1CQ6A 4WBTA 1ASCA 1O62A 1ARHA 3LVLB 4XJMA 4JF1A 3VP6A 4A0HA 2BI5A 2YCPA 3PIUA 3KGWA 3QBOA 4N0BA 1H1CA 4UHMA 1GC3A 1LS3A 1AX4A 4ZDLA 4CBSA 2YRRA 3B8XA 2AY2A 3DR4A 4RAEA 3AOWA 2JJFA 1TASA 3IF2A 4WB0B 1C7OA 3MEBA 3OKSA 3VOMA 4AZKA 4WYEA 2OKKA 3RCHB 1TOJA 5FT5A 2R0TA 4BHDA 3DU4A 1E5FA 2XBNA 3AV7A 1GEYA 2CSTA 2W8WA 3N4RA 1RVUA 1AHXA 3HL2A 4LNLA 2W7EA 2HUFA 4M2KA 2EH6A 3LG0A 1OHYA 3MKJA 4AOAA 2BIEA 4OC9A 4ZDOA 1ASLA 4WLJA 5HHYA 3JW9A 3QHXA 1I29A 4F5FA 4AZJA 1GC0A 2AY4A 3GETA 4WLHA 1V2FA 1M0QA 3PJ0A 1M0PA 1LC7A 4OTLA 4ZWMA 3FZ7A 3OP7A 3AELA 4GSAA 3DXVA 4JEVA 5EAAA 2GMSA 4UHOA 5I92A 3BWOA 1ARIA 3GSBA 2D7YA 2ZC0A 3FFHA 2YKXA 2HOXA 3BCXA 2ZJGA 1AKAA 3MADA 3BN1A 2QSRA 1WYTA 1OXPA 2Z67A 2BWOA 4B9BA 2PB2A 2VI8A 1DJUA 5EUEA 2Z9UA 1O4SA 4FFCA 2Z20A 3ELPA 1GC2A 3ASAA 1T3IA 2BKWA 3B1DA 3QPGA 4R8DA 1SPAA 4GEBA 2FM1A 1M6SA 2O0RA 2VMXA 2QBTA 4R5ZA 1B5OA 1V72A 2V1PA 4RM1A 3NU8A 2AY6A 1AMQA 2ZSMA 3ISLA 4H51A 2WK9A 2X3LA 4HF8A 5IWQA 1GD9A 2VMNA 3FKDA 1W23A 2W7FA 2VIAA 4Q6RA 2BI2A 4IYOB 1RVYA 3FQ8A 3FSLA 4WYAA 2W7IA 4WXGA 4PIWA 1TOGA 3TATA 2F8JA 2GQNA 3WGBA 2O7CA 2O1BA 4W1XA 1IX6A 1X0MA 4BMKA 4RJYA 2D66A 4I8AA 2CJHA 4IY7A 4OYTA 1ASFA 1DGDA 2WK8A 2VI9A 5FT6A 1YOOA 3E2FA 3VAXA 1Y4IA 5M4DA 1S07A 2W8TA 1YJYA 3VK3A 4RLGA 5EIGA 3PPLA 2BYLA 1ASAA 2CTZA 2VMQA 3HVYA 3AEJA 3LVJA 2W7KA 4ZDPA 1I41A 2DGLA 1P3WA 3E2YA 1IVRA 1MDXA 3D6KA 2VGWA 3GZCA 4A6TA 2R5CB 4WYCA 2VGZA 1AHFA 3A9XA 1RV4A 3BB8A 2VMYA 5M4BA 1SZKA 4K2BA 2AEUA 1TARA 2D64A 2JJGA 3MAFA 1AY8A 4WXFA 3IHJA 3P1TA 1V2EA 1XEYA 4W5KA 5AX8A 3F0HA 3ECDA 5LHAA 1M32A 1M7YA 1RV3A 4K2MA 1KMJA 4JE5A 5DX5A 2FYFA 5BJ4A 3B1CA 4IW7A 1CL1A 4JEYA 3N4XA 1DFOA 4PFFA 3E77A 1AJRA 1UU1A 4ZLVA 4E3QA 3H9XA 4J8LA 2X5DA 2OKJA 3FVXA 3TQXA 1B9IA 1PG8A 2VGVA 1BQAA 1QJ5A 3FVSA 4MGRA 1B5PA 2VMOA 2X5FA 2WB6A 1KL2A 3F9TA 1M0NA 2G6WA 4JEXA 1C9CA 3MC6A 1ASMA 1KL1A 3NX3A 1WYUA 1ELQA 2CH1A 4AO4A 3JU7A 2DR1A 2ZY2A 4U1TA 5DJ9A 3PD6A 1ARGA 3L44A 4MQRA 4RKDA 2BWNA 5J8QA 2DOUA 4RKCA 1JF9A 3FZ8A 2Z61A 3LWSA 1C4KA 1AMAA 3F6TA 2VMPA 4Q31A 4Y0IA 3R4TA 1AIAA 4L0OA 3HQTA 4F5MA 1S08A 3WKSA 1AMRA 1ZODA 3NUIA 3NYUA 4P3MA 3HBXA 4J5UA 2CINA 4W1VA 5EAVA 4A6UA 3WGCA 1ASBA 2D61A 4F5IA 3AENA 3AEJC 3R9AA 3FRKA 3VK2A 3WCOA 4WP0A 5M46A 1CL2A 3EI7A 3FQAA 1FG7A 5BJ3A 2EZ2A 1GDEA 3E2ZA 4W91A 2E7UA 1ZC9A 1S06A 1TOIA 4F5JA 2JISA 1AKCA 2E7IA 3QM2A 4OBUA 5G2QA 2V0YA 2YHKA 2VMWA 3LVMA 4RIZA 3PAAA 2HZPA 4KXKA 3JWAA 3WX9A 4PVFA 1AJSA 1AHEA 4CBRA 2AY8A 2BIAA 3PGYA 1LC5A 2AEVA 2VLFA 4A00A 3EI9A 3KGXA 4LW2A 3W1IA 5JAYA 1BJOA 1UU0A 4GRXA 2FQ6A 4K2IA 4MY5A 3RBLA 1W7MA 1ELUA 1LKCA 3AEPA 2JGTA 1ORDA 4ZAHA 3GJUA 4DGTA 2DGMA 4EB7A 1W3UA 4XK1A 1IAYA 1AAMA 4MQPA 4TN4A 4ATQA 4E3RA 1CS1A 1LW5A 4WXBA 4ADEA 1D7VA 3ASBA 3MC6C 2VLHA 3HLMA 3NRAA 2BI3A 3DZZA 3GZDC 1DGEA 4IXOA 1G4VA 1AIBA 1O61A 3EUCA 1AICA 1AY4A 4W8IA 4UHNA 1DKAA 1MDZA 2D7ZA 4ZWVA 3CBFA 2CFBA 3DODA 5C6UA 1TATA 3PDBB 2VMRA 2OGAA 3GR9A 1DTYA 1KKJA 2VGUA 2Z9XA 2W7LA 4ZASA 4JEWA 3H7FA 1B8GA 1G7WA 4WB0A 3UE8A 3DYDA 1MDOA 3RCHA 3RQ1A 1YJSA 3NU7A 4RITA 1SZUA 5EUDA 1ZOBA 1FC4A 1D7SA 1AY5A 4EFFA 2CANA 1X29A 4UQVA 1GEWA 2AY9A 3QGUA 4IXSA 5G0AA 4A0FA 3ZZJA 1WYVB 2YOBA 2VYCA 1YIZA 2ZUKA 4Q75A 4ADDA 1GCKA 3A9YA 4F5LA 2Q7WA 3PDXA 4XJOA 4M2MA 3FVUA 3N5MA 5DJ1A 2BI1A 3A9ZA 7AATA 3ZRQA 1C0NA 3VK4A 3WLXA 3EI5A 1J04A 4ADBA 2D65A 1BQDA 4M2JA 2BYJA 4H63Q 2VMVA 2Z1ZA 1H0CA 3FCRA 4E77A 9AATA 2CB1A 3FTBA 1YNUA 4F4EA 2W7JA 4AH3A 2W7GA 3LY1A 1U08A 3EZ1A 2FNIA 4KAMA 1LW4A 2W8VA 4IYOA 1X2AA 5LH9A 5M49A 5KTBA 1LC8A 4R5FA 3W1JA 3JZLA 3UWCA 3FD0A 4JEZA 2CY8A 2CJGA 4CVQA 1KKPA 1WKGA 4E1OA 2DGKA 2OGEA 3HMUA 1M0OA 2HORA 3K7YA 5EUNA 3GZDA 3N7NA 1AKBA 3FFRA 1D7UA 3EI8A 2GMUA 5G2PA 4XJLA 3HT4A 3W1HA 2VMUA 4GDYA 3ZRRA 1ASDA 3RBFA 2R5CA 1X28A 2FNUA 2YRIA 2C81A 2YKVA 4ZM4A 2CJDA 2W8UA 2HOZA 2RFVA 4Y0HA 1BJNA 2EO5A 1BKGA 3PA9A 4NOGA 3TFUA 4ATPA 1J32A 3JTXA 3BS8A 4XAUA 5D5SA 3A8UX 1Z7DA 5FT8A 1VEFA 3NYSA 3E9KA 4GE7A 2VMSA 2FN6A 2HUUA 2VMTA 1BS0A 1IBJA 4LW4A 1TOEA 2QB3A 1CZEA 3B46A 3USFA 3AEMC 5HDMA 2E54A 2OQXA 4JE5D 3CAIA 3G7QA 1IX8A 1QIRA 3Q8NA 3II0A 3MBBA 3DXWA 1OXOA 1CZCA 1ARSA 1JG8A 3N75A 3I4JA 2TPLA 5G4IA 3QI6A 3RUYA 1WYTB 1LK9A 3G8MA 3K28A 4MKJA 3GBXA 3LV2A 4EB5A 2WKAA 1WKHA 4ADCA 1W7NA 3BC8A 2CH2A 2EZ1A 4A72A 4BA5A 4PFNA 3ZRPA 2JG2A 3FDDA 1GC4A 3DR7A 1IAXA 2BIGA 4KYOA 4ZSYA 2HOYA 2D5YA 3B1EA 1QJ3A 1AHGA 2GB3A 4XEWA 1I43A 1JS6A 2HUIA 3M5UA 5D95A 4BQ0A 2Z9VA 3AEOA 3DC1A 5TF5A 3WCNA 1BT4A 1ASGA 1SF2A 3NDNA 3BWNC 4A6RA 3G0TA 4AO9A 3I5TA 4P7YA 1QZ9A 1N8PA 4LNMA 4CXRA 1BW0A 2AY1A 3NUBA 3WKRA 4MKKA 1G7XA 3BCAA 3LVKA 4IX8A 1ARTA 2QLRA 4ITGA 4XJPA 3EI6A 2W7DA 5EIGB 5EQCA 1PMMA 4OT8A 3K40A 5E3KA 2JJHA 3ZZKA 2BI9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RI6 A;  4N0W A;  2BWP A;  1QIS A;  1UKJ A;  2DKJ A;  2EPJ A;  3A2B A;  4WYG A;  2X8U A;  1E5E A;  5F9S A;  3TCM A;  2R2N A;  4LNJ A;  4EMY A;  1AMS A;  1C7G A;  4W1W A;  2VGS A;  1M4N A;  1IUG A;  1GBN A;  1QGN A;  3MAF B;  5E4Z A;  2YKY A;  2VGT A;  3CQ6 A;  1YIY A;  2AAT A;  3ATH A;  1VP4 A;  2VIB A;  1PFF A;  1EG5 A;  5HXX A;  2Z9W A;  4A0R A;  1OHW A;  1BJW A;  1PMO A;  3E6G A;  1N31 A;  4R2N A;  4WYF A;  2W8J A;  4QGR A;  2W7M A;  2WK7 A;  1D2F A;  3AEM A;  4EU1 A;  1SZS A;  2C0R A;  4DBC A;  2C44 A;  8AAT A;  3HDO A;  3P6K A;  2PO3 A;  3L8A A;  2XH1 A;  3EIA A;  1KMK A;  4WYD A;  4TV7 A;  1AHY A;  5FT4 A;  4LC3 A;  3T32 A;  1CJ0 A;  3CQ5 A;  4XQ2 A;  3NNK A;  4OBV A;  3KKI A;  4ZM3 A;  1SFF A;  1OAT A;  2DKB A;  5G09 A;  4MSO A;  3AAT A;  2D63 A;  2YCT A;  2W7H A;  4DQ6 A;  3PDB A;  1YJZ A;  1WYU B;  1OHV A;  2BHX A;  5E5I A;  1ASN A;  1B4X A;  1IX7 A;  2AY5 A;  3WZF A;  2VMZ A;  1UU2 A;  3PD6 B;  2YKU A;  2ZY4 A;  1BJ4 A;  4U2H A;  4Y0D A;  1VJO A;  2EGY A;  1AAW A;  3DRD A;  3AOV A;  2ZYJ A;  1S0A A;  1MLZ A;  1O69 A;  4Q76 A;  2QA3 A;  1MAP A;  1FG3 A;  1XI9 A;  1YAA A;  3BWN A;  2C7T A;  3FQ7 A;  3ACZ A;  2ZY5 A;  4GE4 A;  1EJI A;  1TPL A;  3COG A;  4WD2 A;  3EIB A;  2ORD A;  3NYT A;  2ZY3 A;  3N0L A;  5G4J A;  1DJ9 A;  2QMA A;  3QN6 A;  4UOY A;  1WYV A;  4OCA A;  3AEN B;  4A0G A;  1Z3Z A;  5EFS A;  4ITX A;  4IXZ A;  2YCN A;  4CXQ A;  2ZSL A;  3GWP A;  3FDB A;  4F5K A;  4BA4 A;  4OMA A;  3H14 A;  3E2Z B;  3NTJ A;  3TFT A;  2PB0 A;  1S09 A;  1W7L A;  2NMP A;  3EZS A;  2R5E A;  3FZ6 A;  3KE3 A;  4FL0 A;  1DJE A;  4ZSW A;  3ELE A;  2AY7 A;  3JWB A;  4ISY A;  5F8V A;  4O6Z A;  1D7R A;  2GSA A;  3WY7 A;  1B9H A;  2QB2 A;  1AJS B;  2JJE A;  3BCB A;  4JF0 A;  3UAK A;  1ECX A;  2Z1Y A;  1IJI A;  4GE9 A;  3I16 A;  1MLY A;  2ZP7 A;  5DB5 A;  1BJO B;  1I48 A;  2HP1 A;  3MAU A;  2OAT A;  2HP2 A;  3CQ4 A;  1SVV A;  3BV0 A;  1EQB A;  4B98 A;  4F5G A;  1MGV A;  1QIT A;  1N2T A;  1G4X A;  5K8B A;  1CQ8 A;  2AY3 A;  1TOK A;  1GEX A;  4RJ0 A;  4F5H A;  4HVK A;  2E7J A;  4MQQ A;  1ASE A;  1JS3 A;  1V2D A;  1MAQ A;  1CQ7 A;  1WST A;  1C7N A;  4TMR A;  1CQ6 A;  4WBT A;  1ASC A;  1O62 A;  1ARH A;  3LVL B;  4XJM A;  4JF1 A;  3VP6 A;  4A0H A;  2BI5 A;  2YCP A;  3PIU A;  3KGW A;  3QBO A;  4N0B A;  1H1C A;  4UHM A;  1GC3 A;  1LS3 A;  1AX4 A;  4ZDL A;  4CBS A;  2YRR A;  3B8X A;  2AY2 A;  3DR4 A;  4RAE A;  3AOW A;  2JJF A;  1TAS A;  3IF2 A;  4WB0 B;  1C7O A;  3MEB A;  3OKS A;  3VOM A;  4AZK A;  4WYE A;  2OKK A;  3RCH B;  1TOJ A;  5FT5 A;  2R0T A;  4BHD A;  3DU4 A;  1E5F A;  2XBN A;  3AV7 A;  1GEY A;  2CST A;  2W8W A;  1RVU A;  1AHX A;  3HL2 A;  4LNL A;  2W7E A;  2HUF A;  4M2K A;  2EH6 A;  3LG0 A;  1OHY A;  3MKJ A;  4AOA A;  2BIE A;  4OC9 A;  4ZDO A;  1ASL A;  4WLJ A;  5HHY A;  3JW9 A;  3QHX A;  1I29 A;  4F5F A;  4AZJ A;  1GC0 A;  2AY4 A;  3GET A;  4WLH A;  1V2F A;  1M0Q A;  3PJ0 A;  1M0P A;  1LC7 A;  4OTL A;  4ZWM A;  3FZ7 A;  3OP7 A;  3AEL A;  4GSA A;  3DXV A;  4JEV A;  5EAA A;  2GMS A;  4UHO A;  5I92 A;  3BWO A;  1ARI A;  3GSB A;  2D7Y A;  2ZC0 A;  3FFH A;  2YKX A;  2HOX A;  3BCX A;  2ZJG A;  1AKA A;  3MAD A;  3BN1 A;  1WYT A;  1OXP A;  2Z67 A;  2BWO A;  4B9B A;  2PB2 A;  2VI8 A;  1DJU A;  5EUE A;  2Z9U A;  1O4S A;  4FFC A;  2Z20 A;  3ELP A;  1GC2 A;  3ASA A;  1T3I A;  2BKW A;  3B1D A;  3QPG A;  4R8D A;  1SPA A;  4GEB A;  2FM1 A;  1M6S A;  2O0R A;  2VMX A;  2QBT A;  4R5Z A;  1B5O A;  1V72 A;  2V1P A;  4RM1 A;  3NU8 A;  2AY6 A;  1AMQ A;  2ZSM A;  3ISL A;  4H51 A;  2WK9 A;  2X3L A;  4HF8 A;  5IWQ A;  1GD9 A;  2VMN A;  3FKD A;  1W23 A;  2W7F A;  2VIA A;  4Q6R A;  2BI2 A;  4IYO B;  1RVY A;  3FQ8 A;  3FSL A;  4WYA A;  2W7I A;  4WXG A;  4PIW A;  1TOG A;  3TAT A;  2F8J A;  2GQN A;  3WGB A;  2O7C A;  2O1B A;  4W1X A;  1IX6 A;  1X0M A;  4BMK A;  4RJY A;  2D66 A;  4I8A A;  2CJH A;  4IY7 A;  4OYT A;  1ASF A;  1DGD A;  2WK8 A;  2VI9 A;  5FT6 A;  1YOO A;  3E2F A;  3VAX A;  1Y4I A;  5M4D A;  1S07 A;  2W8T A;  1YJY A;  3VK3 A;  4RLG A;  5EIG A;  3PPL A;  2BYL A;  1ASA A;  2CTZ A;  2VMQ A;  3HVY A;  3AEJ A;  3LVJ A;  2W7K A;  4ZDP A;  1I41 A;  2DGL A;  1P3W A;  3E2Y A;  1IVR A;  1MDX A;  3D6K A;  2VGW A;  3GZC A;  4A6T A;  2R5C B;  4WYC A;  2VGZ A;  1AHF A;  3A9X A;  1RV4 A;  3BB8 A;  2VMY A;  5M4B A;  1SZK A;  4K2B A;  2AEU A;  1TAR A;  2D64 A;  2JJG A;  3MAF A;  1AY8 A;  4WXF A;  3IHJ A;  3P1T A;  1V2E A;  1XEY A;  4W5K A;  5AX8 A;  3F0H A;  3ECD A;  5LHA A;  1M32 A;  1M7Y A;  1RV3 A;  4K2M A;  1KMJ A;  4JE5 A;  5DX5 A;  2FYF A;  5BJ4 A;  3B1C A;  4IW7 A;  1CL1 A;  4JEY A;  1DFO A;  4PFF A;  3E77 A;  1AJR A;  1UU1 A;  4ZLV A;  4E3Q A;  4J8L A;  2X5D A;  2OKJ A;  3FVX A;  3TQX A;  1B9I A;  1PG8 A;  2VGV A;  1BQA A;  1QJ5 A;  3FVS A;  4MGR A;  1B5P A;  2VMO A;  2X5F A;  1KL2 A;  3F9T A;  1M0N A;  2G6W A;  4JEX A;  1C9C A;  3MC6 A;  1ASM A;  1KL1 A;  3NX3 A;  1WYU A;  1ELQ A;  2CH1 A;  4AO4 A;  3JU7 A;  2DR1 A;  2ZY2 A;  4U1T A;  5DJ9 A;  3PD6 A;  1ARG A;  3L44 A;  4MQR A;  4RKD A;  2BWN A;  5J8Q A;  2DOU A;  4RKC A;  1JF9 A;  3FZ8 A;  2Z61 A;  3LWS A;  1C4K A;  1AMA A;  3F6T A;  2VMP A;  4Q31 A;  4Y0I A;  3R4T A;  1AIA A;  4L0O A;  3HQT A;  4F5M A;  1S08 A;  3WKS A;  1AMR A;  1ZOD A;  3NUI A;  3NYU A;  4P3M A;  3HBX A;  4J5U A;  2CIN A;  4W1V A;  5EAV A;  4A6U A;  3WGC A;  1ASB A;  2D61 A;  4F5I A;  3AEN A;  3AEJ C;  3R9A A;  3FRK A;  3VK2 A;  3WCO A;  4WP0 A;  5M46 A;  1CL2 A;  3EI7 A;  3FQA A;  1FG7 A;  5BJ3 A;  2EZ2 A;  1GDE A;  3E2Z A;  4W91 A;  2E7U A;  1ZC9 A;  1S06 A;  1TOI A;  4F5J A;  2JIS A;  1AKC A;  2E7I A;  3QM2 A;  4OBU A;  5G2Q A;  2V0Y A;  2YHK A;  2VMW A;  3LVM A;  4RIZ A;  3PAA A;  2HZP A;  4KXK A;  3JWA A;  3WX9 A;  4PVF A;  1AJS A;  1AHE A;  4CBR A;  2AY8 A;  2BIA A;  3PGY A;  1LC5 A;  2AEV A;  2VLF A;  4A00 A;  3EI9 A;  3KGX A;  4LW2 A;  3W1I A;  5JAY A;  1BJO A;  1UU0 A;  4GRX A;  2FQ6 A;  4K2I A;  4MY5 A;  3RBL A;  1W7M A;  1ELU A;  1LKC A;  3AEP A;  2JGT A;  1ORD A;  4ZAH A;  3GJU A;  4DGT A;  2DGM A;  4EB7 A;  1W3U A;  4XK1 A;  1IAY A;  1AAM A;  4MQP A;  4TN4 A;  4ATQ A;  4E3R A;  1CS1 A;  1LW5 A;  4WXB A;  4ADE A;  1D7V A;  3ASB A;  3MC6 C;  2VLH A;  3HLM A;  3NRA A;  2BI3 A;  3DZZ A;  3GZD C;  1DGE A;  4IXO A;  1G4V A;  1AIB A;  1O61 A;  3EUC A;  1AIC A;  1AY4 A;  4W8I A;  4UHN A;  1DKA A;  1MDZ A;  2D7Z A;  4ZWV A;  3CBF A;  2CFB A;  3DOD A;  5C6U A;  1TAT A;  3PDB B;  2VMR A;  2OGA A;  3GR9 A;  1DTY A;  1KKJ A;  2VGU A;  2Z9X A;  2W7L A;  4ZAS A;  4JEW A;  3H7F A;  1B8G A;  1G7W A;  4WB0 A;  3UE8 A;  3DYD A;  1MDO A;  3RCH A;  3RQ1 A;  1YJS A;  3NU7 A;  4RIT A;  1SZU A;  5EUD A;  1ZOB A;  1FC4 A;  1D7S A;  1AY5 A;  4EFF A;  2CAN A;  1X29 A;  4UQV A;  1GEW A;  2AY9 A;  3QGU A;  4IXS A;  5G0A A;  4A0F A;  3ZZJ A;  1WYV B;  2YOB A;  2VYC A;  1YIZ A;  2ZUK A;  4Q75 A;  4ADD A;  1GCK A;  3A9Y A;  4F5L A;  2Q7W A;  3PDX A;  4XJO A;  4M2M A;  3FVU A;  3N5M A;  5DJ1 A;  2BI1 A;  3A9Z A;  7AAT A;  3ZRQ A;  1C0N A;  3VK4 A;  3WLX A;  3EI5 A;  1J04 A;  4ADB A;  2D65 A;  1BQD A;  4M2J A;  2BYJ A;  2VMV A;  2Z1Z A;  1H0C A;  3FCR A;  4E77 A;  9AAT A;  2CB1 A;  3FTB A;  1YNU A;  4F4E A;  2W7J A;  4AH3 A;  2W7G A;  3LY1 A;  1U08 A;  3EZ1 A;  2FNI A;  4KAM A;  1LW4 A;  2W8V A;  4IYO A;  1X2A A;  5LH9 A;  5M49 A;  1LC8 A;  4R5F A;  3W1J A;  3JZL A;  3UWC A;  3FD0 A;  4JEZ A;  2CY8 A;  2CJG A;  4CVQ A;  1KKP A;  1WKG A;  4E1O A;  2DGK A;  2OGE A;  3HMU A;  1M0O A;  2HOR A;  3K7Y A;  5EUN A;  3GZD A;  1AKB A;  3FFR A;  1D7U A;  3EI8 A;  2GMU A;  5G2P A;  4XJL A;  3HT4 A;  3W1H A;  2VMU A;  4GDY A;  3ZRR A;  1ASD A;  3RBF A;  2R5C A;  1X28 A;  2FNU A;  2YRI A;  2C81 A;  2YKV A;  4ZM4 A;  2CJD A;  2W8U A;  2HOZ A;  2RFV A;  4Y0H A;  1BJN A;  2EO5 A;  1BKG A;  3PA9 A;  4NOG A;  3TFU A;  4ATP A;  1J32 A;  3JTX A;  3BS8 A;  4XAU A;  5D5S A;  3A8U X;  1Z7D A;  5FT8 A;  1VEF A;  3NYS A;  3E9K A;  4GE7 A;  2VMS A;  2FN6 A;  2HUU A;  2VMT A;  1BS0 A;  1IBJ A;  4LW4 A;  1TOE A;  2QB3 A;  1CZE A;  3B46 A;  3USF A;  3AEM C;  5HDM A;  2E54 A;  2OQX A;  4JE5 D;  3CAI A;  3G7Q A;  1IX8 A;  1QIR A;  3Q8N A;  3II0 A;  3MBB A;  3DXW A;  1OXO A;  1CZC A;  1ARS A;  1JG8 A;  3N75 A;  3I4J A;  2TPL A;  5G4I A;  3QI6 A;  3RUY A;  1WYT B;  1LK9 A;  3G8M A;  3K28 A;  4MKJ A;  3GBX A;  3LV2 A;  4EB5 A;  2WKA A;  1WKH A;  4ADC A;  1W7N A;  3BC8 A;  2CH2 A;  2EZ1 A;  4A72 A;  4BA5 A;  4PFN A;  3ZRP A;  2JG2 A;  3FDD A;  1GC4 A;  3DR7 A;  1IAX A;  2BIG A;  4KYO A;  4ZSY A;  2HOY A;  2D5Y A;  3B1E A;  1QJ3 A;  1AHG A;  2GB3 A;  4XEW A;  1I43 A;  1JS6 A;  2HUI A;  3M5U A;  5D95 A;  4BQ0 A;  2Z9V A;  3AEO A;  3DC1 A;  5TF5 A;  3WCN A;  1BT4 A;  1ASG A;  1SF2 A;  3NDN A;  3BWN C;  4A6R A;  3G0T A;  4AO9 A;  3I5T A;  4P7Y A;  1QZ9 A;  1N8P A;  4LNM A;  4CXR A;  1BW0 A;  2AY1 A;  3NUB A;  3WKR A;  4MKK A;  1G7X A;  3BCA A;  3LVK A;  4IX8 A;  1ART A;  2QLR A;  4ITG A;  4XJP A;  3EI6 A;  2W7D A;  5EIG B;  5EQC A;  1PMM A;  4OT8 A;  3K40 A;  5E3K A;  2JJH A;  3ZZK A;  2BI9 A; 
#chains in the Genus database with same CATH topology
 3RI6 A;  4N0W A;  2BWP A;  1QIS A;  1UKJ A;  2DKJ A;  2EPJ A;  3A2B A;  4WYG A;  2X8U A;  1E5E A;  5F9S A;  3TCM A;  2R2N A;  4LNJ A;  4EMY A;  1AMS A;  1C7G A;  4W1W A;  2VGS A;  1M4N A;  1IUG A;  1GBN A;  1QGN A;  3MAF B;  5E4Z A;  2YKY A;  2VGT A;  3CQ6 A;  1YIY A;  2AAT A;  3ATH A;  1VP4 A;  2VIB A;  1PFF A;  1EG5 A;  5HXX A;  2Z9W A;  4A0R A;  1OHW A;  1BJW A;  1PMO A;  3E6G A;  1N31 A;  3N4S A;  4R2N A;  4WYF A;  2W8J A;  4QGR A;  2W7M A;  2WK7 A;  1D2F A;  3AEM A;  4EU1 A;  1SZS A;  2C0R A;  4DBC A;  2C44 A;  8AAT A;  3HDO A;  3P6K A;  2PO3 A;  3L8A A;  2XH1 A;  3EIA A;  1KMK A;  2EYQ A;  4WYD A;  4TV7 A;  1AHY A;  5FT4 A;  4LC3 A;  3T32 A;  1CJ0 A;  3CQ5 A;  4XQ2 A;  3NNK A;  4OBV A;  3KKI A;  4ZM3 A;  1SFF A;  1OAT A;  2DKB A;  5G09 A;  4MSO A;  2FKI A;  2KFP A;  3AAT A;  2D63 A;  2YCT A;  2W7H A;  4DQ6 A;  3PDB A;  1YJZ A;  1WYU B;  1OHV A;  2BHX A;  5E5I A;  1ASN A;  1B4X A;  1IX7 A;  2AY5 A;  3WZF A;  2VMZ A;  1UU2 A;  3PD6 B;  2YKU A;  2ZY4 A;  1BJ4 A;  4U2H A;  4Y0D A;  1KAF A;  1VJO A;  2EGY A;  1AAW A;  3DRD A;  3AOV A;  2ZYJ A;  1S0A A;  1MLZ A;  1O69 A;  4Q76 A;  2QA3 A;  1MAP A;  1FG3 A;  1XI9 A;  1YAA A;  3BWN A;  2C7T A;  3FQ7 A;  3ACZ A;  2ZY5 A;  4GE4 A;  1EJI A;  1TPL A;  3COG A;  4WD2 A;  3EIB A;  2ORD A;  3NYT A;  2ZY3 A;  3N0L A;  5G4J A;  1DJ9 A;  2QMA A;  3QN6 A;  4UOY A;  1WYV A;  4OCA A;  3AEN B;  4A0G A;  1Z3Z A;  5EFS A;  4ITX A;  4IXZ A;  2YCN A;  4CXQ A;  2ZSL A;  3GWP A;  3FDB A;  4F5K A;  4BA4 A;  4OMA A;  3H14 A;  3E2Z B;  3NTJ A;  3TFT A;  2PB0 A;  1S09 A;  1W7L A;  2NMP A;  3EZS A;  2R5E A;  3FZ6 A;  3KE3 A;  4FL0 A;  4K05 A;  1DJE A;  4ZSW A;  3ELE A;  2AY7 A;  3JWB A;  4ISY A;  5F8V A;  4O6Z A;  1D7R A;  2GSA A;  3WY7 A;  1B9H A;  2QB2 A;  1AJS B;  2JJE A;  3BCB A;  4JF0 A;  3UAK A;  1ECX A;  2Z1Y A;  1IJI A;  4GE9 A;  3I16 A;  1MLY A;  2ZP7 A;  5DB5 A;  1BJO B;  1I48 A;  2HP1 A;  3MAU A;  2OAT A;  2HP2 A;  3CQ4 A;  1SVV A;  3BV0 A;  1EQB A;  4B98 A;  4F5G A;  1MGV A;  1QIT A;  2A1V A;  1N2T A;  1G4X A;  5K8B A;  1CQ8 A;  2AY3 A;  1TOK A;  1GEX A;  4RJ0 A;  4F5H A;  4HVK A;  2E7J A;  4MQQ A;  1ASE A;  2G7J A;  1JS3 A;  1V2D A;  1MAQ A;  1CQ7 A;  1WST A;  1C7N A;  4TMR A;  1CQ6 A;  4WBT A;  1ASC A;  1O62 A;  1ARH A;  3LVL B;  4XJM A;  4JF1 A;  3VP6 A;  4A0H A;  2BI5 A;  2YCP A;  3PIU A;  3KGW A;  3QBO A;  4N0B A;  1H1C A;  4UHM A;  1GC3 A;  1LS3 A;  1AX4 A;  4ZDL A;  4CBS A;  2YRR A;  3B8X A;  2AY2 A;  3DR4 A;  4RAE A;  3AOW A;  2JJF A;  1TAS A;  3IF2 A;  4WB0 B;  1C7O A;  3MEB A;  3OKS A;  3VOM A;  4AZK A;  4WYE A;  2OKK A;  3RCH B;  1TOJ A;  5FT5 A;  2R0T A;  4BHD A;  3DU4 A;  1E5F A;  2XBN A;  3AV7 A;  1GEY A;  2CST A;  2W8W A;  3N4R A;  1RVU A;  1AHX A;  3HL2 A;  4LNL A;  2W7E A;  2HUF A;  4M2K A;  2EH6 A;  3LG0 A;  1OHY A;  3MKJ A;  4AOA A;  2BIE A;  4OC9 A;  4ZDO A;  1ASL A;  4WLJ A;  5HHY A;  3JW9 A;  3QHX A;  1I29 A;  4F5F A;  4AZJ A;  1GC0 A;  2AY4 A;  3GET A;  4WLH A;  1V2F A;  1M0Q A;  3PJ0 A;  1M0P A;  1LC7 A;  4OTL A;  4ZWM A;  3FZ7 A;  3OP7 A;  3AEL A;  4GSA A;  3DXV A;  4JEV A;  5EAA A;  2GMS A;  4UHO A;  5I92 A;  3BWO A;  1ARI A;  3GSB A;  2D7Y A;  2ZC0 A;  3FFH A;  2YKX A;  2HOX A;  3BCX A;  2ZJG A;  1AKA A;  3MAD A;  3BN1 A;  2QSR A;  1WYT A;  1OXP A;  2Z67 A;  2BWO A;  4B9B A;  2PB2 A;  2VI8 A;  1DJU A;  5EUE A;  2Z9U A;  1O4S A;  4FFC A;  2Z20 A;  3ELP A;  1GC2 A;  3ASA A;  1T3I A;  2BKW A;  3B1D A;  3QPG A;  4R8D A;  1SPA A;  4GEB A;  2FM1 A;  1M6S A;  2O0R A;  2VMX A;  2QBT A;  4R5Z A;  1B5O A;  1V72 A;  2V1P A;  4RM1 A;  3NU8 A;  2AY6 A;  1AMQ A;  2ZSM A;  3ISL A;  4H51 A;  2WK9 A;  2X3L A;  4HF8 A;  5IWQ A;  1GD9 A;  2VMN A;  3FKD A;  1W23 A;  2W7F A;  2VIA A;  4Q6R A;  2BI2 A;  4IYO B;  1RVY A;  3FQ8 A;  3FSL A;  4WYA A;  2W7I A;  4WXG A;  4PIW A;  1TOG A;  3TAT A;  2F8J A;  2GQN A;  3WGB A;  2O7C A;  2O1B A;  4W1X A;  1IX6 A;  1X0M A;  4BMK A;  4RJY A;  2D66 A;  4I8A A;  2CJH A;  4IY7 A;  4OYT A;  1ASF A;  1DGD A;  2WK8 A;  2VI9 A;  5FT6 A;  1YOO A;  3E2F A;  3VAX A;  1Y4I A;  5M4D A;  1S07 A;  2W8T A;  1YJY A;  3VK3 A;  4RLG A;  5EIG A;  3PPL A;  2BYL A;  1ASA A;  2CTZ A;  2VMQ A;  3HVY A;  3AEJ A;  3LVJ A;  2W7K A;  4ZDP A;  1I41 A;  2DGL A;  1P3W A;  3E2Y A;  1IVR A;  1MDX A;  3D6K A;  2VGW A;  3GZC A;  4A6T A;  2R5C B;  4WYC A;  2VGZ A;  1AHF A;  3A9X A;  1RV4 A;  3BB8 A;  2VMY A;  5M4B A;  1SZK A;  4K2B A;  2AEU A;  1TAR A;  2D64 A;  2JJG A;  3MAF A;  1AY8 A;  4WXF A;  3IHJ A;  3P1T A;  1V2E A;  1XEY A;  4W5K A;  5AX8 A;  3F0H A;  3ECD A;  5LHA A;  1M32 A;  1M7Y A;  1RV3 A;  4K2M A;  1KMJ A;  4JE5 A;  5DX5 A;  2FYF A;  5BJ4 A;  3B1C A;  4IW7 A;  1CL1 A;  4JEY A;  3N4X A;  1DFO A;  4PFF A;  3E77 A;  1AJR A;  1UU1 A;  4ZLV A;  4E3Q A;  3H9X A;  4J8L A;  2X5D A;  2OKJ A;  3FVX A;  3TQX A;  1B9I A;  1PG8 A;  2VGV A;  1BQA A;  1QJ5 A;  3FVS A;  4MGR A;  1B5P A;  2VMO A;  2X5F A;  2WB6 A;  1KL2 A;  3F9T A;  1M0N A;  2G6W A;  4JEX A;  1C9C A;  3MC6 A;  1ASM A;  1KL1 A;  3NX3 A;  1WYU A;  1ELQ A;  2CH1 A;  4AO4 A;  3JU7 A;  2DR1 A;  2ZY2 A;  4U1T A;  5DJ9 A;  3PD6 A;  1ARG A;  3L44 A;  4MQR A;  4RKD A;  2BWN A;  5J8Q A;  2DOU A;  4RKC A;  1JF9 A;  3FZ8 A;  2Z61 A;  3LWS A;  1C4K A;  1AMA A;  3F6T A;  2VMP A;  4Q31 A;  4Y0I A;  3R4T A;  1AIA A;  4L0O A;  3HQT A;  4F5M A;  1S08 A;  3WKS A;  1AMR A;  1ZOD A;  3NUI A;  3NYU A;  4P3M A;  3HBX A;  4J5U A;  2CIN A;  4W1V A;  5EAV A;  4A6U A;  3WGC A;  1ASB A;  2D61 A;  4F5I A;  3AEN A;  3AEJ C;  3R9A A;  3FRK A;  3VK2 A;  3WCO A;  4WP0 A;  5M46 A;  1CL2 A;  3EI7 A;  3FQA A;  1FG7 A;  5BJ3 A;  2EZ2 A;  1GDE A;  3E2Z A;  4W91 A;  2E7U A;  1ZC9 A;  1S06 A;  1TOI A;  4F5J A;  2JIS A;  1AKC A;  2E7I A;  3QM2 A;  4OBU A;  5G2Q A;  2V0Y A;  2YHK A;  2VMW A;  3LVM A;  4RIZ A;  3PAA A;  2HZP A;  4KXK A;  3JWA A;  3WX9 A;  4PVF A;  1AJS A;  1AHE A;  4CBR A;  2AY8 A;  2BIA A;  3PGY A;  1LC5 A;  2AEV A;  2VLF A;  4A00 A;  3EI9 A;  3KGX A;  4LW2 A;  3W1I A;  5JAY A;  1BJO A;  1UU0 A;  4GRX A;  2FQ6 A;  4K2I A;  4MY5 A;  3RBL A;  1W7M A;  1ELU A;  1LKC A;  3AEP A;  2JGT A;  1ORD A;  4ZAH A;  3GJU A;  4DGT A;  2DGM A;  4EB7 A;  1W3U A;  4XK1 A;  1IAY A;  1AAM A;  4MQP A;  4TN4 A;  4ATQ A;  4E3R A;  1CS1 A;  1LW5 A;  4WXB A;  4ADE A;  1D7V A;  3ASB A;  3MC6 C;  2VLH A;  3HLM A;  3NRA A;  2BI3 A;  3DZZ A;  3GZD C;  1DGE A;  4IXO A;  1G4V A;  1AIB A;  1O61 A;  3EUC A;  1AIC A;  1AY4 A;  4W8I A;  4UHN A;  1DKA A;  1MDZ A;  2D7Z A;  4ZWV A;  3CBF A;  2CFB A;  3DOD A;  5C6U A;  1TAT A;  3PDB B;  2VMR A;  2OGA A;  3GR9 A;  1DTY A;  1KKJ A;  2VGU A;  2Z9X A;  2W7L A;  4ZAS A;  4JEW A;  3H7F A;  1B8G A;  1G7W A;  4WB0 A;  3UE8 A;  3DYD A;  1MDO A;  3RCH A;  3RQ1 A;  1YJS A;  3NU7 A;  4RIT A;  1SZU A;  5EUD A;  1ZOB A;  1FC4 A;  1D7S A;  1AY5 A;  4EFF A;  2CAN A;  1X29 A;  4UQV A;  1GEW A;  2AY9 A;  3QGU A;  4IXS A;  5G0A A;  4A0F A;  3ZZJ A;  1WYV B;  2YOB A;  2VYC A;  1YIZ A;  2ZUK A;  4Q75 A;  4ADD A;  1GCK A;  3A9Y A;  4F5L A;  2Q7W A;  3PDX A;  4XJO A;  4M2M A;  3FVU A;  3N5M A;  5DJ1 A;  2BI1 A;  3A9Z A;  7AAT A;  3ZRQ A;  1C0N A;  3VK4 A;  3WLX A;  3EI5 A;  1J04 A;  4ADB A;  2D65 A;  1BQD A;  4M2J A;  2BYJ A;  4H63 Q;  2VMV A;  2Z1Z A;  1H0C A;  3FCR A;  4E77 A;  9AAT A;  2CB1 A;  3FTB A;  1YNU A;  4F4E A;  2W7J A;  4AH3 A;  2W7G A;  3LY1 A;  1U08 A;  3EZ1 A;  2FNI A;  4KAM A;  1LW4 A;  2W8V A;  4IYO A;  1X2A A;  5LH9 A;  5M49 A;  5KTB A;  1LC8 A;  4R5F A;  3W1J A;  3JZL A;  3UWC A;  3FD0 A;  4JEZ A;  2CY8 A;  2CJG A;  4CVQ A;  1KKP A;  1WKG A;  4E1O A;  2DGK A;  2OGE A;  3HMU A;  1M0O A;  2HOR A;  3K7Y A;  5EUN A;  3GZD A;  3N7N A;  1AKB A;  3FFR A;  1D7U A;  3EI8 A;  2GMU A;  5G2P A;  4XJL A;  3HT4 A;  3W1H A;  2VMU A;  4GDY A;  3ZRR A;  1ASD A;  3RBF A;  2R5C A;  1X28 A;  2FNU A;  2YRI A;  2C81 A;  2YKV A;  4ZM4 A;  2CJD A;  2W8U A;  2HOZ A;  2RFV A;  4Y0H A;  1BJN A;  2EO5 A;  1BKG A;  3PA9 A;  4NOG A;  3TFU A;  4ATP A;  1J32 A;  3JTX A;  3BS8 A;  4XAU A;  5D5S A;  3A8U X;  1Z7D A;  5FT8 A;  1VEF A;  3NYS A;  3E9K A;  4GE7 A;  2VMS A;  2FN6 A;  2HUU A;  2VMT A;  1BS0 A;  1IBJ A;  4LW4 A;  1TOE A;  2QB3 A;  1CZE A;  3B46 A;  3USF A;  3AEM C;  5HDM A;  2E54 A;  2OQX A;  4JE5 D;  3CAI A;  3G7Q A;  1IX8 A;  1QIR A;  3Q8N A;  3II0 A;  3MBB A;  3DXW A;  1OXO A;  1CZC A;  1ARS A;  1JG8 A;  3N75 A;  3I4J A;  2TPL A;  5G4I A;  3QI6 A;  3RUY A;  1WYT B;  1LK9 A;  3G8M A;  3K28 A;  4MKJ A;  3GBX A;  3LV2 A;  4EB5 A;  2WKA A;  1WKH A;  4ADC A;  1W7N A;  3BC8 A;  2CH2 A;  2EZ1 A;  4A72 A;  4BA5 A;  4PFN A;  3ZRP A;  2JG2 A;  3FDD A;  1GC4 A;  3DR7 A;  1IAX A;  2BIG A;  4KYO A;  4ZSY A;  2HOY A;  2D5Y A;  3B1E A;  1QJ3 A;  1AHG A;  2GB3 A;  4XEW A;  1I43 A;  1JS6 A;  2HUI A;  3M5U A;  5D95 A;  4BQ0 A;  2Z9V A;  3AEO A;  3DC1 A;  5TF5 A;  3WCN A;  1BT4 A;  1ASG A;  1SF2 A;  3NDN A;  3BWN C;  4A6R A;  3G0T A;  4AO9 A;  3I5T A;  4P7Y A;  1QZ9 A;  1N8P A;  4LNM A;  4CXR A;  1BW0 A;  2AY1 A;  3NUB A;  3WKR A;  4MKK A;  1G7X A;  3BCA A;  3LVK A;  4IX8 A;  1ART A;  2QLR A;  4ITG A;  4XJP A;  3EI6 A;  2W7D A;  5EIG B;  5EQC A;  1PMM A;  4OT8 A;  3K40 A;  5E3K A;  2JJH A;  3ZZK A;  2BI9 A; 
#chains in the Genus database with same CATH homology
 3RI6 A;  4N0W A;  2BWP A;  1QIS A;  1UKJ A;  2DKJ A;  2EPJ A;  3A2B A;  4WYG A;  2X8U A;  1E5E A;  5F9S A;  3TCM A;  2R2N A;  4LNJ A;  4EMY A;  1AMS A;  1C7G A;  4W1W A;  2VGS A;  1M4N A;  1IUG A;  1GBN A;  1QGN A;  3MAF B;  5E4Z A;  2YKY A;  2VGT A;  3CQ6 A;  1YIY A;  2AAT A;  3ATH A;  1VP4 A;  2VIB A;  1PFF A;  1EG5 A;  5HXX A;  2Z9W A;  4A0R A;  1OHW A;  1BJW A;  1PMO A;  3E6G A;  1N31 A;  3N4S A;  4R2N A;  4WYF A;  2W8J A;  4QGR A;  2W7M A;  2WK7 A;  1D2F A;  3AEM A;  4EU1 A;  1SZS A;  2C0R A;  4DBC A;  2C44 A;  8AAT A;  3HDO A;  3P6K A;  2PO3 A;  3L8A A;  2XH1 A;  3EIA A;  1KMK A;  2EYQ A;  4WYD A;  4TV7 A;  1AHY A;  5FT4 A;  4LC3 A;  3T32 A;  1CJ0 A;  3CQ5 A;  4XQ2 A;  3NNK A;  4OBV A;  3KKI A;  4ZM3 A;  1SFF A;  1OAT A;  2DKB A;  5G09 A;  4MSO A;  2FKI A;  2KFP A;  3AAT A;  2D63 A;  2YCT A;  2W7H A;  4DQ6 A;  3PDB A;  1YJZ A;  1WYU B;  1OHV A;  2BHX A;  5E5I A;  1ASN A;  1B4X A;  1IX7 A;  2AY5 A;  3WZF A;  2VMZ A;  1UU2 A;  3PD6 B;  2YKU A;  2ZY4 A;  1BJ4 A;  4U2H A;  4Y0D A;  1VJO A;  2EGY A;  1AAW A;  3DRD A;  3AOV A;  2ZYJ A;  1S0A A;  1MLZ A;  1O69 A;  4Q76 A;  2QA3 A;  1MAP A;  1FG3 A;  1XI9 A;  1YAA A;  3BWN A;  2C7T A;  3FQ7 A;  3ACZ A;  2ZY5 A;  4GE4 A;  1EJI A;  1TPL A;  3COG A;  4WD2 A;  3EIB A;  2ORD A;  3NYT A;  2ZY3 A;  3N0L A;  5G4J A;  1DJ9 A;  2QMA A;  3QN6 A;  4UOY A;  1WYV A;  4OCA A;  3AEN B;  4A0G A;  1Z3Z A;  5EFS A;  4ITX A;  4IXZ A;  2YCN A;  4CXQ A;  2ZSL A;  3GWP A;  3FDB A;  4F5K A;  4BA4 A;  4OMA A;  3H14 A;  3E2Z B;  3NTJ A;  3TFT A;  2PB0 A;  1S09 A;  1W7L A;  2NMP A;  3EZS A;  2R5E A;  3FZ6 A;  3KE3 A;  4FL0 A;  4K05 A;  1DJE A;  4ZSW A;  3ELE A;  2AY7 A;  3JWB A;  4ISY A;  5F8V A;  4O6Z A;  1D7R A;  2GSA A;  3WY7 A;  1B9H A;  2QB2 A;  1AJS B;  2JJE A;  3BCB A;  4JF0 A;  3UAK A;  1ECX A;  2Z1Y A;  1IJI A;  4GE9 A;  3I16 A;  1MLY A;  2ZP7 A;  5DB5 A;  1BJO B;  1I48 A;  2HP1 A;  3MAU A;  2OAT A;  2HP2 A;  3CQ4 A;  1SVV A;  3BV0 A;  1EQB A;  4B98 A;  4F5G A;  1MGV A;  1QIT A;  2A1V A;  1N2T A;  1G4X A;  5K8B A;  1CQ8 A;  2AY3 A;  1TOK A;  1GEX A;  4RJ0 A;  4F5H A;  4HVK A;  2E7J A;  4MQQ A;  1ASE A;  2G7J A;  1JS3 A;  1V2D A;  1MAQ A;  1CQ7 A;  1WST A;  1C7N A;  4TMR A;  1CQ6 A;  4WBT A;  1ASC A;  1O62 A;  1ARH A;  3LVL B;  4XJM A;  4JF1 A;  3VP6 A;  4A0H A;  2BI5 A;  2YCP A;  3PIU A;  3KGW A;  3QBO A;  4N0B A;  1H1C A;  4UHM A;  1GC3 A;  1LS3 A;  1AX4 A;  4ZDL A;  4CBS A;  2YRR A;  3B8X A;  2AY2 A;  3DR4 A;  4RAE A;  3AOW A;  2JJF A;  1TAS A;  3IF2 A;  4WB0 B;  1C7O A;  3MEB A;  3OKS A;  3VOM A;  4AZK A;  4WYE A;  2OKK A;  3RCH B;  1TOJ A;  5FT5 A;  2R0T A;  4BHD A;  3DU4 A;  1E5F A;  2XBN A;  3AV7 A;  1GEY A;  2CST A;  2W8W A;  3N4R A;  1RVU A;  1AHX A;  3HL2 A;  4LNL A;  2W7E A;  2HUF A;  4M2K A;  2EH6 A;  3LG0 A;  1OHY A;  3MKJ A;  4AOA A;  2BIE A;  4OC9 A;  4ZDO A;  1ASL A;  4WLJ A;  5HHY A;  3JW9 A;  3QHX A;  1I29 A;  4F5F A;  4AZJ A;  1GC0 A;  2AY4 A;  3GET A;  4WLH A;  1V2F A;  1M0Q A;  3PJ0 A;  1M0P A;  1LC7 A;  4OTL A;  4ZWM A;  3FZ7 A;  3OP7 A;  3AEL A;  4GSA A;  3DXV A;  4JEV A;  5EAA A;  2GMS A;  4UHO A;  5I92 A;  3BWO A;  1ARI A;  3GSB A;  2D7Y A;  2ZC0 A;  3FFH A;  2YKX A;  2HOX A;  3BCX A;  2ZJG A;  1AKA A;  3MAD A;  3BN1 A;  2QSR A;  1WYT A;  1OXP A;  2Z67 A;  2BWO A;  4B9B A;  2PB2 A;  2VI8 A;  1DJU A;  5EUE A;  2Z9U A;  1O4S A;  4FFC A;  2Z20 A;  3ELP A;  1GC2 A;  3ASA A;  1T3I A;  2BKW A;  3B1D A;  3QPG A;  4R8D A;  1SPA A;  4GEB A;  2FM1 A;  1M6S A;  2O0R A;  2VMX A;  2QBT A;  4R5Z A;  1B5O A;  1V72 A;  2V1P A;  4RM1 A;  3NU8 A;  2AY6 A;  1AMQ A;  2ZSM A;  3ISL A;  4H51 A;  2WK9 A;  2X3L A;  4HF8 A;  5IWQ A;  1GD9 A;  2VMN A;  3FKD A;  1W23 A;  2W7F A;  2VIA A;  4Q6R A;  2BI2 A;  4IYO B;  1RVY A;  3FQ8 A;  3FSL A;  4WYA A;  2W7I A;  4WXG A;  4PIW A;  1TOG A;  3TAT A;  2F8J A;  2GQN A;  3WGB A;  2O7C A;  2O1B A;  4W1X A;  1IX6 A;  1X0M A;  4BMK A;  4RJY A;  2D66 A;  4I8A A;  2CJH A;  4IY7 A;  4OYT A;  1ASF A;  1DGD A;  2WK8 A;  2VI9 A;  5FT6 A;  1YOO A;  3E2F A;  3VAX A;  1Y4I A;  5M4D A;  1S07 A;  2W8T A;  1YJY A;  3VK3 A;  4RLG A;  5EIG A;  3PPL A;  2BYL A;  1ASA A;  2CTZ A;  2VMQ A;  3HVY A;  3AEJ A;  3LVJ A;  2W7K A;  4ZDP A;  1I41 A;  2DGL A;  1P3W A;  3E2Y A;  1IVR A;  1MDX A;  3D6K A;  2VGW A;  3GZC A;  4A6T A;  2R5C B;  4WYC A;  2VGZ A;  1AHF A;  3A9X A;  1RV4 A;  3BB8 A;  2VMY A;  5M4B A;  1SZK A;  4K2B A;  2AEU A;  1TAR A;  2D64 A;  2JJG A;  3MAF A;  1AY8 A;  4WXF A;  3IHJ A;  3P1T A;  1V2E A;  1XEY A;  4W5K A;  5AX8 A;  3F0H A;  3ECD A;  5LHA A;  1M32 A;  1M7Y A;  1RV3 A;  4K2M A;  1KMJ A;  4JE5 A;  5DX5 A;  2FYF A;  5BJ4 A;  3B1C A;  4IW7 A;  1CL1 A;  4JEY A;  3N4X A;  1DFO A;  4PFF A;  3E77 A;  1AJR A;  1UU1 A;  4ZLV A;  4E3Q A;  3H9X A;  4J8L A;  2X5D A;  2OKJ A;  3FVX A;  3TQX A;  1B9I A;  1PG8 A;  2VGV A;  1BQA A;  1QJ5 A;  3FVS A;  4MGR A;  1B5P A;  2VMO A;  2X5F A;  2WB6 A;  1KL2 A;  3F9T A;  1M0N A;  2G6W A;  4JEX A;  1C9C A;  3MC6 A;  1ASM A;  1KL1 A;  3NX3 A;  1WYU A;  1ELQ A;  2CH1 A;  4AO4 A;  3JU7 A;  2DR1 A;  2ZY2 A;  4U1T A;  5DJ9 A;  3PD6 A;  1ARG A;  3L44 A;  4MQR A;  4RKD A;  2BWN A;  5J8Q A;  2DOU A;  4RKC A;  1JF9 A;  3FZ8 A;  2Z61 A;  3LWS A;  1C4K A;  1AMA A;  3F6T A;  2VMP A;  4Q31 A;  4Y0I A;  3R4T A;  1AIA A;  4L0O A;  3HQT A;  4F5M A;  1S08 A;  3WKS A;  1AMR A;  1ZOD A;  3NUI A;  3NYU A;  4P3M A;  3HBX A;  4J5U A;  2CIN A;  4W1V A;  5EAV A;  4A6U A;  3WGC A;  1ASB A;  2D61 A;  4F5I A;  3AEN A;  3AEJ C;  3R9A A;  3FRK A;  3VK2 A;  3WCO A;  4WP0 A;  5M46 A;  1CL2 A;  3EI7 A;  3FQA A;  1FG7 A;  5BJ3 A;  2EZ2 A;  1GDE A;  3E2Z A;  4W91 A;  2E7U A;  1ZC9 A;  1S06 A;  1TOI A;  4F5J A;  2JIS A;  1AKC A;  2E7I A;  3QM2 A;  4OBU A;  5G2Q A;  2V0Y A;  2YHK A;  2VMW A;  3LVM A;  4RIZ A;  3PAA A;  2HZP A;  4KXK A;  3JWA A;  3WX9 A;  4PVF A;  1AJS A;  1AHE A;  4CBR A;  2AY8 A;  2BIA A;  3PGY A;  1LC5 A;  2AEV A;  2VLF A;  4A00 A;  3EI9 A;  3KGX A;  4LW2 A;  3W1I A;  5JAY A;  1BJO A;  1UU0 A;  4GRX A;  2FQ6 A;  4K2I A;  4MY5 A;  3RBL A;  1W7M A;  1ELU A;  1LKC A;  3AEP A;  2JGT A;  1ORD A;  4ZAH A;  3GJU A;  4DGT A;  2DGM A;  4EB7 A;  1W3U A;  4XK1 A;  1IAY A;  1AAM A;  4MQP A;  4TN4 A;  4ATQ A;  4E3R A;  1CS1 A;  1LW5 A;  4WXB A;  4ADE A;  1D7V A;  3ASB A;  3MC6 C;  2VLH A;  3HLM A;  3NRA A;  2BI3 A;  3DZZ A;  3GZD C;  1DGE A;  4IXO A;  1G4V A;  1AIB A;  1O61 A;  3EUC A;  1AIC A;  1AY4 A;  4W8I A;  4UHN A;  1DKA A;  1MDZ A;  2D7Z A;  4ZWV A;  3CBF A;  2CFB A;  3DOD A;  5C6U A;  1TAT A;  3PDB B;  2VMR A;  2OGA A;  3GR9 A;  1DTY A;  1KKJ A;  2VGU A;  2Z9X A;  2W7L A;  4ZAS A;  4JEW A;  3H7F A;  1B8G A;  1G7W A;  4WB0 A;  3UE8 A;  3DYD A;  1MDO A;  3RCH A;  3RQ1 A;  1YJS A;  3NU7 A;  4RIT A;  1SZU A;  5EUD A;  1ZOB A;  1FC4 A;  1D7S A;  1AY5 A;  4EFF A;  2CAN A;  1X29 A;  4UQV A;  1GEW A;  2AY9 A;  3QGU A;  4IXS A;  5G0A A;  4A0F A;  3ZZJ A;  1WYV B;  2YOB A;  2VYC A;  1YIZ A;  2ZUK A;  4Q75 A;  4ADD A;  1GCK A;  3A9Y A;  4F5L A;  2Q7W A;  3PDX A;  4XJO A;  4M2M A;  3FVU A;  3N5M A;  5DJ1 A;  2BI1 A;  3A9Z A;  7AAT A;  3ZRQ A;  1C0N A;  3VK4 A;  3WLX A;  3EI5 A;  1J04 A;  4ADB A;  2D65 A;  1BQD A;  4M2J A;  2BYJ A;  4H63 Q;  2VMV A;  2Z1Z A;  1H0C A;  3FCR A;  4E77 A;  9AAT A;  2CB1 A;  3FTB A;  1YNU A;  4F4E A;  2W7J A;  4AH3 A;  2W7G A;  3LY1 A;  1U08 A;  3EZ1 A;  2FNI A;  4KAM A;  1LW4 A;  2W8V A;  4IYO A;  1X2A A;  5LH9 A;  5M49 A;  5KTB A;  1LC8 A;  4R5F A;  3W1J A;  3JZL A;  3UWC A;  3FD0 A;  4JEZ A;  2CY8 A;  2CJG A;  4CVQ A;  1KKP A;  1WKG A;  4E1O A;  2DGK A;  2OGE A;  3HMU A;  1M0O A;  2HOR A;  3K7Y A;  5EUN A;  3GZD A;  3N7N A;  1AKB A;  3FFR A;  1D7U A;  3EI8 A;  2GMU A;  5G2P A;  4XJL A;  3HT4 A;  3W1H A;  2VMU A;  4GDY A;  3ZRR A;  1ASD A;  3RBF A;  2R5C A;  1X28 A;  2FNU A;  2YRI A;  2C81 A;  2YKV A;  4ZM4 A;  2CJD A;  2W8U A;  2HOZ A;  2RFV A;  4Y0H A;  1BJN A;  2EO5 A;  1BKG A;  3PA9 A;  4NOG A;  3TFU A;  4ATP A;  1J32 A;  3JTX A;  3BS8 A;  4XAU A;  5D5S A;  3A8U X;  1Z7D A;  5FT8 A;  1VEF A;  3NYS A;  3E9K A;  4GE7 A;  2VMS A;  2FN6 A;  2HUU A;  2VMT A;  1BS0 A;  1IBJ A;  4LW4 A;  1TOE A;  2QB3 A;  1CZE A;  3B46 A;  3USF A;  3AEM C;  5HDM A;  2E54 A;  2OQX A;  4JE5 D;  3CAI A;  3G7Q A;  1IX8 A;  1QIR A;  3Q8N A;  3II0 A;  3MBB A;  3DXW A;  1OXO A;  1CZC A;  1ARS A;  1JG8 A;  3N75 A;  3I4J A;  2TPL A;  5G4I A;  3QI6 A;  3RUY A;  1WYT B;  1LK9 A;  3G8M A;  3K28 A;  4MKJ A;  3GBX A;  3LV2 A;  4EB5 A;  2WKA A;  1WKH A;  4ADC A;  1W7N A;  3BC8 A;  2CH2 A;  2EZ1 A;  4A72 A;  4BA5 A;  4PFN A;  3ZRP A;  2JG2 A;  3FDD A;  1GC4 A;  3DR7 A;  1IAX A;  2BIG A;  4KYO A;  4ZSY A;  2HOY A;  2D5Y A;  3B1E A;  1QJ3 A;  1AHG A;  2GB3 A;  4XEW A;  1I43 A;  1JS6 A;  2HUI A;  3M5U A;  5D95 A;  4BQ0 A;  2Z9V A;  3AEO A;  3DC1 A;  5TF5 A;  3WCN A;  1BT4 A;  1ASG A;  1SF2 A;  3NDN A;  3BWN C;  4A6R A;  3G0T A;  4AO9 A;  3I5T A;  4P7Y A;  1QZ9 A;  1N8P A;  4LNM A;  4CXR A;  1BW0 A;  2AY1 A;  3NUB A;  3WKR A;  4MKK A;  1G7X A;  3BCA A;  3LVK A;  4IX8 A;  1ART A;  2QLR A;  4ITG A;  4XJP A;  3EI6 A;  2W7D A;  5EIG B;  5EQC A;  1PMM A;  4OT8 A;  3K40 A;  5E3K A;  2JJH A;  3ZZK A;  2BI9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...