2AY7A

Aromatic amino acid aminotransferase with 4-phenylbutyric acid
Total Genus 149
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
149
sequence length
394
structure length
394
Chain Sequence
MLGNLKPQAPDKILALMGEFRADPRQGKIDLGVGVYKDATGHTPIMRAVHAAEQRMLETETTKTYAGLSGEPEFQKAMGELILGDGLKSETTATLATVGGTGALRQALELARMANPDLRVFVSDPTWPNHVSIMNFMGLPVQTYRYFDAETRGVDFEGMKADLAAAKKGDMVLLHGCCHNPTGANLTLDQWAEIASILEKTGALPLIDLAYQGFGDGLEEDAAGTRLIASRIPEVLIAASCSKNFGIYRERTGCLLALCADAATRELAQGAMAFLNRQTYSFPPFHGAKIVSTVLTTPELRADWMAELEAVRSGMLRLREQLAGELRDLSGSDRFGFVAEHRGMFSRLGATPEQVKRIKEEFGIYMVGDSRINIAGLNDNTIPILARAIIEVGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The active site of Paracoccus denitrificans aromatic amino acid aminotransferase has contrary properties: flexibility and rigidity.
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Aminotransferase
molecule keywords AROMATIC AMINO ACID AMINOTRANSFERASE
total genus 149
structure length 394
sequence length 394
chains with identical sequence B
ec nomenclature ec 2.6.1.57: Aromatic-amino-acid transaminase.
pdb deposition date 1998-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 2ay7A02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 2ay7A01
1ORDA 4BMKA 1QZ9A 3FFRA 1B9IA 2CY8A 1DTYA 1J32A 1ASCA 1I41A 2ZUKA 2QA3A 1N8PA 3VK3A 3DODA 3DZZA 2PO3A 2YKYA 3GETA 4Y0IA 3BWNC 2E7JA 1TATA 3EZSA 5HHYA 1OATA 2CJHA 1M6SA 2HP2A 3B1DA 2OATA 1DGEA 4LNMA 4AH3A 4WP0A 5J8QA 1WYTB 4F5JA 4LW4A 2ZY4A 3BCAA 2Z61A 3II0A 1D7RA 2AY1A 3LVMA 1SFFA 2DGMA 1RV4A 1WYVA 2HOXA 3NUIA 1TOIA 1EG5A 1TPLA 3CQ5A 2D66A 1YJZA 1JS3A 1IUGA 1QIRA 1IAYA 1AHFA 1X29A 3FKDA 1DGDA 5G09A 1N2TA 1MGVA 1LKCA 1C7GA 1CS1A 1Y4IA 5DB5A 1CQ6A 4WXBA 4H51A 4MQRA 5FT8A 3N75A 1U08A 4WB0A 1E5EA 1LK9A 5F9SA 2CJDA 2FNIA 2D5YA 4P3MA 3FVXA 1EJIA 5EUNA 3VAXA 1SPAA 2VMPA 4M2JA 3E77A 4M2MA 4WXGA 3PDBA 3E2ZA 1YOOA 1BS0A 2AEVA 4IYOA 2JISA 4OC9A 2VMXA 2OGAA 3E2YA 3ECDA 3L8AA 3ASBA 3D6KA 2W7HA 2Z9UA 3VP6A 3FD0A 2Z67A 5C6UA 2OKKA 2VYCA 4E3RA 3EI6A 4FL0A 4CBSA 2JG2A 1MDOA 1RVUA 3FZ7A 4F5MA 4MQPA 4EMYA 3COGA 1SZSA 3EIBA 1CJ0A 1MDZA 3BWNA 2O1BA 4F5FA 2GSAA 2W8UA 3EZ1A 2OQXA 3NUBA 5G2PA 3MADA 2ZJGA 1IVRA 2YKXA 2CANA 2VMUA 1G4XA 2ZY5A 3LV2A 1QGNA 4OYTA 3FCRA 1C7OA 1MLYA 1UU2A 3FVUA 2VMVA 1G7WA 4XEWA 3AELA 4A6UA 1TASA 2HUFA 1W7LA 4B9BA 1AKAA 3ISLA 2Z1YA 2C81A 5EAVA 3A9XA 2FNUA 4WYAA 2VMOA 2GMUA 2VMSA 3BB8A 4R5FA 5D5SA 5TF5A 4IXOA 3BC8A 3K7YA 4UHOA 5I92A 3B1CA 3L44A 4A6TA 1ZOBA 1M7YA 2O0RA 1AMSA 1ZODA 8AATA 2QB3A 3NU7A 1ASLA 4WYCA 2VGWA 2BWPA 1WKGA 1D2FA 2W7DA 4GE7A 1M4NA 1TOEA 1EQBA 3G8MA 3TFUA 3ZRRA 2JGTA 1DJEA 1MAQA 5E5IA 4Q76A 1GEYA 1JS6A 4KAMA 1AAMA 3GWPA 4OBUA 1OHYA 1D7SA 3NYTA 1B5OA 1CZEA 4RKCA 4ZM3A 1YIZA 4TMRA 1WSTA 4GDYA 3Q8NA 1GDEA 1ELQA 4CBRA 1ASNA 3LVLB 2CSTA 1BJOB 1CQ7A 2CFBA 2AY2A 3TATA 3G7QA 3FRKA 2W7EA 4BHDA 5LH9A 1ARTA 1S06A 1X0MA 2EZ1A 7AATA 5FT4A 4Q75A 3FQ8A 5EIGA 4WD2A 2C44A 4EU1A 4LW2A 1AJRA 1V2EA 2XH1A 4QGRA 2D7YA 4UHNA 2R0TA 3USFA 3N0LA 2ZY2A 4CXQA 1GD9A 2O7CA 2EPJA 1AKBA 1AX4A 3AOVA 2HOZA 3CQ4A 3K28A 2C0RA 3A2BA 2FM1A 2V1PA 3FZ8A 2DGLA 3LY1A 3QM2A 2AY9A 1PMMA 1SF2A 3MAFB 3BN1A 4JF0A 5FT5A 2AY5A 1B9HA 1I29A 2HORA 4Q6RA 3GSBA 2BI9A 3NU8A 1GC0A 1GEXA 4AZKA 2D64A 4IXZA 2D63A 1ASBA 3DU4A 3T32A 1T3IA 2R2NA 3R9AA 1ASFA 4A00A 3KGXA 3BCXA 3AEOA 4XQ2A 4Y0DA 3K40A 4KYOA 4ITXA 5HDMA 2FN6A 2R5EA 4ZWMA 4A72A 1CL1A 1AHYA 1AMRA 1W7NA 2VI9A 4E1OA 3HL2A 1V2FA 2BI1A 4PIWA 4GE9A 3RBFA 4F4EA 3RI6A 1IBJA 3GZDC 4W1VA 1S09A 3EI8A 4N0WA 1S0AA 3HBXA 2DR1A 2WK7A 4XK1A 4U2HA 2XBNA 1M0OA 3DR7A 2VLFA 1AIAA 4IXSA 3FQ7A 4KXKA 1AIBA 2BIEA 3H7FA 1WYUA 4I8AA 5G2QA 1YAAA 3GZCA 1J04A 2W8VA 5M4BA 2CB1A 3PA9A 3EI7A 2YRRA 3NNKA 3IF2A 2W7MA 3A9ZA 4RKDA 3OKSA 1AY4A 1BQDA 1M0PA 1AMAA 2GB3A 3EIAA 4W5KA 2VMTA 3E2ZB 4EB5A 1WYVB 3JU7A 2WKAA 3QHXA 3P1TA 1Z3ZA 4F5GA 4WXFA 5D95A 2D7ZA 2E7IA 2ZYJA 3WCOA 3WKRA 4AO9A 4ZDOA 3I4JA 4WB0B 4ITGA 3AATA 1MAPA 3WKSA 2BIGA 4B98A 1IX6A 3PJ0A 1YNUA 3JZLA 4JEZA 4GE4A 3RQ1A 3VK2A 4MSOA 1KKPA 1VP4A 3MKJA 4JEYA 1YJSA 4R2NA 2VMQA 3UE8A 1D7UA 1C9CA 1PMOA 4J8LA 4ADCA 1IJIA 1ELUA 3ELEA 3TCMA 4A0HA 2DGKA 1X28A 1VJOA 3MC6C 1WKHA 2ORDA 1KKJA 2VGUA 4F5LA 2QB2A 1BKGA 4RIZA 4BQ0A 4CXRA 1QISA 2GMSA 4WYDA 1LW5A 2ZSLA 2CINA 5G0AA 3ZRPA 3JWBA 3FTBA 1AMQA 1PFFA 3MBBA 1IX7A 4R8DA 1BQAA 1SZKA 2BI5A 3NRAA 4TN4A 5DX5A 5EAAA 1S07A 1CQ8A 2E54A 3WY7A 1AAWA 3DR4A 3GBXA 1XEYA 1N31A 4F5KA 1I43A 2VGTA 4LNJA 3P6KA 1YJYA 2DKBA 2VIBA 3A8UX 1PG8A 3UAKA 2C7TA 3PPLA 3LG0A 3AENA 3PDBB 2W8JA 3B1EA 1CZCA 4GRXA 1C4KA 4ZSWA 1BJNA 2W7LA 1V2DA 2EZ2A 1O4SA 1X2AA 3IHJA 4IW7A 3AOWA 5EQCA 4ZDLA 4W91A 4AZJA 3QPGA 3VK4A 2CH1A 2QBTA 1OXOA 1QITA 3PAAA 1RV3A 2R5CA 5G4JA 3PD6A 1W7MA 1AHGA 3F0HA 2BWNA 4DGTA 4ZWVA 1SVVA 2CH2A 2DKJA 2HUIA 3BV0A 3CAIA 5E4ZA 1KMKA 1AKCA 4Y0HA 4W1XA 3FQAA 3LWSA 5IWQA 2YOBA 1AJSA 4JF1A 1LC5A 2E7UA 1P3WA 3MC6A 4MGRA 3H14A 4WBTA 1BW0A 4XJOA 4GEBA 4CVQA 3FDBA 4DBCA 4ADEA 1B4XA 1WYTA 1GC4A 4OTLA 4UQVA 3E9KA 4JEWA 3N5MA 2BIAA 2W7KA 4GSAA 2D61A 4K2IA 1DFOA 5M46A 3JW9A 3MEBA 3F9TA 4ISYA 4OBVA 5EUDA 3AEPA 1BJ4A 1UKJA 2F8JA 5E3KA 1C0NA 5G4IA 4FFCA 1ARGA 4WYGA 1BJWA 4L0OA 2ZC0A 5LHAA 2VGZA 2V0YA 2X5DA 4ADDA 1S08A 3WGBA 2YCNA 1LC8A 3BCBA 4PVFA 5DJ9A 4XJLA 3I5TA 5AX8A 1D7VA 2Z9XA 1QJ3A 2NMPA 2VLHA 5BJ4A 1M0NA 3TFTA 2ZY3A 4E3QA 2VGSA 3LVKA 1GEWA 3F6TA 4EB7A 2EGYA 1I48A 2BI2A 2AY7A 2W8TA 3HLMA 4ZASA 1C7NA 2CJGA 3ZZKA 2Z20A 3LVJA 3CQ6A 4R5ZA 2YCTA 2HZPA 1KL1A 2BYJA 3JTXA 3RCHB 1AY5A 2BKWA 3NX3A 1VEFA 1OXPA 3AEJA 4WYEA 4Q31A 3UWCA 4RITA 4UHMA 4MKKA 3W1HA 2BI3A 2YCPA 1OHVA 2DOUA 4UOYA 3WCNA 4MKJA 1JG8A 5HXXA 2AY8A 2BHXA 2TPLA 4RLGA 1BT4A 1LC7A 1DKAA 4BA5A 3NYSA 3E2FA 4ZM4A 5M49A 2OGEA 3FFHA 2WK9A 2BYLA 1IAXA 1H1CA 4N0BA 4A0RA 3DXWA 4MY5A 4ZAHA 2YHKA 2GQNA 1TARA 1ASGA 1G7XA 1ASMA 3KE3A 5BJ3A 1OHWA 1M0QA 2EH6A 1GC3A 4ATQA 3AENB 2JJFA 2JJGA 3ATHA 3EI9A 2PB0A 4W8IA 2VI8A 2BWOA 1FC4A 3M5UA 4E77A 3E6GA 2VMWA 1FG7A 2W7FA 4WYFA 1DJUA 3MAUA 4LC3A 3FSLA 2JJEA 1GBNA 2R5CB 2AY3A 1DJ9A 4U1TA 1O69A 4M2KA 3AV7A 4JEXA 1AICA 2AATA 1B5PA 2JJHA 2Z9VA 2W7IA 3W1JA 1QJ5A 4IX8A 5EUEA 3VOMA 2W7GA 4OT8A 3PIUA 2QLRA 1LW4A 3CBFA 3JWAA 4JE5A 3WX9A 1W23A 1O62A 1ASAA 4WLHA 3WZFA 4BA4A 4PFNA 1H0CA 1M32A 1ASEA 1ARIA 2YRIA 3FDDA 3AEMA 4HVKA 3NYUA 1ARHA 1LS3A 3WGCA 4RAEA 3EUCA 2HP1A 2ZP7A 3TQXA 1E5FA 2Q7WA 3WLXA 4IY7A 1KL2A 2VMRA 3HQTA 4AO4A 2HUUA 3DC1A 1FG3A 3RUYA 3B46A 2RFVA 4F5HA 3ELPA 3GR9A 1B8GA 1XI9A 1TOJA 4ZLVA 2QMAA 1ASDA 2X8UA 2W8WA 3DRDA 1YIYA 3MAFA 5K8BA 3A9YA 3B8XA 4XAUA 3HT4A 3QBOA 5M4DA 2ZSMA 1JF9A 4A0GA 1G4VA 3FVSA 3KGWA 4HF8A 9AATA 2YKVA 2X3LA 1SZUA 3EI5A 2X5FA 4ADBA 1BJOA 2OKJA 2VGVA 3HDOA 3BWOA 4JEVA 4K2MA 3QI6A 2Z1ZA 1GC2A 2AEUA 2G6WA 4O6ZA 3ASAA 2FYFA 3KKIA 4RM1A 1AJSB 1MDXA 1WYUB 4WLJA 2CTZA 5F8VA 5JAYA 2HOYA 1CL2A 1V72A 2PB2A 4XJPA 3HVYA 3ZZJA 3QGUA 2EO5A 4OCAA 3GZDA 3W1IA 4AOAA 2Z9WA 1ZC9A 1Z7DA 3QN6A 5EFSA 3RCHA 1AHEA 2AY4A 3R4TA 4P7YA 4PFFA 3ZRQA 1GCKA 4MQQA 1AY8A 3RBLA 3AEMC 4RJ0A 4A0FA 3OP7A 2VMNA 2AY6A 5EIGB 4F5IA 2W7JA 3PGYA 5DJ1A 4ZDPA 4RJYA 1TOGA 1UU1A 4W1WA 4ZSYA 3FZ6A 2FQ6A 3G0TA 2D65A 4LNLA 3I16A 4JE5D 3GJUA 4J5UA 2YKUA 4NOGA 1MLZA 2VIAA 1UU0A 1KMJA 3PDXA 4K2BA 3ACZA 3DXVA 3PD6B 1ARSA 5FT6A 4DQ6A 3DYDA 4TV7A 3AEJC 1W3UA 3BS8A 4A6RA 2WK8A 4OMAA 3NTJA 2VMYA 1ECXA 1IX8A 1RVYA 2VMZA 4ATPA 4XJMA 1TOKA 4EFFA 1AHXA 1O61A 3NDNA 3HMUA 4IYOB
chains in the Genus database with same CATH superfamily
1ORDA 4BMKA 1QZ9A 3FFRA 1B9IA 2CY8A 1DTYA 1J32A 1ASCA 1I41A 2ZUKA 2QA3A 1N8PA 3VK3A 3DODA 3DZZA 2PO3A 2YKYA 3GETA 4Y0IA 3BWNC 2E7JA 1TATA 3EZSA 5HHYA 1OATA 2CJHA 1M6SA 2HP2A 3B1DA 2OATA 1DGEA 4LNMA 4AH3A 4WP0A 5J8QA 1WYTB 4F5JA 4LW4A 2ZY4A 3BCAA 2Z61A 2A1VA 3II0A 1D7RA 2AY1A 3LVMA 1SFFA 2DGMA 1RV4A 1WYVA 2HOXA 3NUIA 1TOIA 1EG5A 1TPLA 3CQ5A 2D66A 1YJZA 1JS3A 1IUGA 1QIRA 1IAYA 1AHFA 1X29A 3FKDA 1DGDA 5G09A 1N2TA 1MGVA 1LKCA 1C7GA 1CS1A 1Y4IA 5DB5A 1CQ6A 4WXBA 4H51A 4MQRA 5FT8A 3N75A 1U08A 4WB0A 1E5EA 1LK9A 5F9SA 2CJDA 2FNIA 2D5YA 4P3MA 3FVXA 1EJIA 5EUNA 3VAXA 1SPAA 2VMPA 4M2JA 3E77A 4M2MA 4WXGA 3PDBA 3E2ZA 1YOOA 1BS0A 2AEVA 4IYOA 2JISA 4OC9A 2VMXA 2OGAA 3E2YA 3ECDA 3L8AA 3ASBA 3D6KA 2W7HA 2Z9UA 3VP6A 3FD0A 2Z67A 5C6UA 2OKKA 2VYCA 4E3RA 3EI6A 4FL0A 4CBSA 2JG2A 1MDOA 1RVUA 3FZ7A 4F5MA 4MQPA 4EMYA 3COGA 1SZSA 3EIBA 1CJ0A 1MDZA 3BWNA 2O1BA 4F5FA 2GSAA 2W8UA 3EZ1A 2OQXA 4H63Q 3NUBA 5G2PA 3MADA 2ZJGA 1IVRA 2YKXA 2CANA 2VMUA 1G4XA 2ZY5A 3LV2A 1QGNA 4OYTA 3FCRA 1C7OA 1MLYA 1UU2A 3FVUA 2VMVA 1G7WA 4XEWA 3AELA 4A6UA 1TASA 2HUFA 1W7LA 4B9BA 1AKAA 3ISLA 2Z1YA 2C81A 5EAVA 3A9XA 2FNUA 4WYAA 2VMOA 2GMUA 2VMSA 3BB8A 4R5FA 5D5SA 5TF5A 4IXOA 3BC8A 3K7YA 4UHOA 5I92A 3B1CA 3L44A 4A6TA 1ZOBA 1M7YA 2O0RA 1AMSA 1ZODA 8AATA 2QB3A 3NU7A 3N4XA 1ASLA 4WYCA 2VGWA 2BWPA 1WKGA 1D2FA 2W7DA 4GE7A 1KAFA 1M4NA 1TOEA 1EQBA 3G8MA 3TFUA 3ZRRA 2JGTA 1DJEA 1MAQA 5E5IA 4Q76A 1GEYA 1JS6A 4KAMA 1AAMA 3GWPA 4OBUA 1OHYA 1D7SA 3NYTA 1B5OA 1CZEA 4RKCA 3N4RA 4ZM3A 1YIZA 4TMRA 1WSTA 4GDYA 3Q8NA 1GDEA 1ELQA 4CBRA 1ASNA 3LVLB 2CSTA 1BJOB 1CQ7A 2CFBA 2AY2A 3TATA 3G7QA 3FRKA 2W7EA 4BHDA 5LH9A 1ARTA 1S06A 1X0MA 2EZ1A 7AATA 5FT4A 4Q75A 3FQ8A 5EIGA 4WD2A 2C44A 5KTBA 4EU1A 4LW2A 1AJRA 1V2EA 2XH1A 4QGRA 2D7YA 4UHNA 2R0TA 3USFA 3N0LA 2ZY2A 4CXQA 1GD9A 2O7CA 2EPJA 1AKBA 1AX4A 3AOVA 2HOZA 3CQ4A 3K28A 2C0RA 3A2BA 2FM1A 2V1PA 3FZ8A 2DGLA 3LY1A 3QM2A 2AY9A 1PMMA 1SF2A 3MAFB 3BN1A 4JF0A 5FT5A 2AY5A 1B9HA 1I29A 2HORA 4Q6RA 3GSBA 2BI9A 3NU8A 1GC0A 1GEXA 2WB6A 4AZKA 2D64A 4IXZA 2D63A 1ASBA 3DU4A 3T32A 1T3IA 2R2NA 3R9AA 1ASFA 4A00A 3KGXA 3BCXA 3AEOA 3N4SA 4XQ2A 4Y0DA 3K40A 4KYOA 4K05A 4ITXA 5HDMA 2FN6A 2R5EA 4ZWMA 4A72A 1CL1A 1AHYA 1AMRA 1W7NA 2VI9A 4E1OA 3HL2A 1V2FA 2BI1A 4PIWA 4GE9A 3RBFA 4F4EA 3RI6A 1IBJA 3GZDC 4W1VA 1S09A 3EI8A 4N0WA 1S0AA 3HBXA 2DR1A 2WK7A 4XK1A 4U2HA 2XBNA 1M0OA 3DR7A 2VLFA 1AIAA 4IXSA 3FQ7A 4KXKA 1AIBA 2BIEA 3H7FA 1WYUA 4I8AA 5G2QA 1YAAA 3GZCA 1J04A 2W8VA 5M4BA 2CB1A 3PA9A 3EI7A 2YRRA 3NNKA 3IF2A 2W7MA 3A9ZA 4RKDA 3OKSA 1AY4A 1BQDA 1M0PA 1AMAA 2GB3A 3EIAA 4W5KA 2VMTA 3E2ZB 4EB5A 1WYVB 3JU7A 2WKAA 3QHXA 3P1TA 1Z3ZA 4F5GA 4WXFA 5D95A 2D7ZA 2E7IA 2ZYJA 3WCOA 3WKRA 4AO9A 4ZDOA 3I4JA 4WB0B 4ITGA 3AATA 1MAPA 3WKSA 2BIGA 4B98A 1IX6A 3PJ0A 1YNUA 3JZLA 4JEZA 4GE4A 3RQ1A 3VK2A 4MSOA 1KKPA 1VP4A 3MKJA 4JEYA 1YJSA 4R2NA 2VMQA 3UE8A 1D7UA 1C9CA 1PMOA 4J8LA 4ADCA 1IJIA 1ELUA 3ELEA 3TCMA 4A0HA 2DGKA 1X28A 1VJOA 2G7JA 3MC6C 1WKHA 2ORDA 1KKJA 2VGUA 4F5LA 2QB2A 1BKGA 4RIZA 4BQ0A 4CXRA 1QISA 2GMSA 4WYDA 1LW5A 2ZSLA 2CINA 5G0AA 3ZRPA 3JWBA 3FTBA 1AMQA 1PFFA 3MBBA 1IX7A 4R8DA 1BQAA 1SZKA 2BI5A 3NRAA 4TN4A 5DX5A 5EAAA 1S07A 1CQ8A 2E54A 3WY7A 1AAWA 3DR4A 3GBXA 1XEYA 1N31A 4F5KA 1I43A 2VGTA 4LNJA 3P6KA 1YJYA 2DKBA 2VIBA 3A8UX 1PG8A 3UAKA 2C7TA 3PPLA 3LG0A 3AENA 3PDBB 2W8JA 3B1EA 1CZCA 4GRXA 1C4KA 4ZSWA 1BJNA 2W7LA 1V2DA 2EZ2A 1O4SA 1X2AA 3IHJA 4IW7A 3AOWA 5EQCA 4ZDLA 4W91A 4AZJA 3QPGA 3VK4A 2CH1A 2QBTA 1OXOA 1QITA 3PAAA 1RV3A 2R5CA 5G4JA 3PD6A 1W7MA 1AHGA 3F0HA 2BWNA 4DGTA 4ZWVA 1SVVA 2CH2A 2DKJA 2HUIA 3BV0A 3CAIA 5E4ZA 1KMKA 1AKCA 4Y0HA 4W1XA 3FQAA 3LWSA 5IWQA 2YOBA 1AJSA 4JF1A 1LC5A 2E7UA 1P3WA 3MC6A 4MGRA 3H14A 4WBTA 1BW0A 4XJOA 4GEBA 4CVQA 3FDBA 4DBCA 4ADEA 1B4XA 1WYTA 1GC4A 4OTLA 4UQVA 3E9KA 4JEWA 3N5MA 2FKIA 2BIAA 2W7KA 4GSAA 2D61A 4K2IA 1DFOA 5M46A 3JW9A 3MEBA 3F9TA 4ISYA 4OBVA 5EUDA 3AEPA 1BJ4A 1UKJA 2F8JA 5E3KA 1C0NA 5G4IA 4FFCA 1ARGA 4WYGA 1BJWA 4L0OA 2ZC0A 5LHAA 2VGZA 2V0YA 2X5DA 4ADDA 1S08A 3WGBA 2YCNA 1LC8A 3BCBA 4PVFA 5DJ9A 4XJLA 3I5TA 5AX8A 1D7VA 2Z9XA 1QJ3A 2NMPA 2VLHA 5BJ4A 1M0NA 3TFTA 2ZY3A 4E3QA 2VGSA 3LVKA 1GEWA 3F6TA 4EB7A 2EGYA 1I48A 2BI2A 2AY7A 2W8TA 3HLMA 4ZASA 1C7NA 2CJGA 3ZZKA 2Z20A 3LVJA 3CQ6A 4R5ZA 2YCTA 2HZPA 1KL1A 2BYJA 3JTXA 3RCHB 1AY5A 2BKWA 3NX3A 1VEFA 1OXPA 3AEJA 4WYEA 4Q31A 3UWCA 4RITA 4UHMA 4MKKA 3W1HA 2BI3A 2YCPA 1OHVA 2DOUA 4UOYA 3WCNA 4MKJA 1JG8A 5HXXA 2AY8A 2BHXA 2TPLA 4RLGA 1BT4A 1LC7A 1DKAA 4BA5A 3H9XA 3NYSA 3E2FA 4ZM4A 5M49A 2OGEA 3FFHA 2WK9A 2BYLA 1IAXA 1H1CA 4N0BA 4A0RA 3DXWA 4MY5A 4ZAHA 2YHKA 2GQNA 1TARA 1ASGA 1G7XA 1ASMA 3KE3A 5BJ3A 1OHWA 1M0QA 2EH6A 1GC3A 4ATQA 2QSRA 3AENB 2JJFA 2JJGA 3ATHA 3EI9A 2EYQA 2PB0A 4W8IA 2VI8A 2BWOA 1FC4A 3M5UA 4E77A 3E6GA 2VMWA 1FG7A 2W7FA 4WYFA 1DJUA 3MAUA 4LC3A 3FSLA 2JJEA 1GBNA 2R5CB 2AY3A 1DJ9A 4U1TA 1O69A 4M2KA 3AV7A 4JEXA 1AICA 2AATA 1B5PA 2JJHA 2Z9VA 2W7IA 3W1JA 1QJ5A 4IX8A 5EUEA 3VOMA 2W7GA 4OT8A 3PIUA 2QLRA 1LW4A 3CBFA 3JWAA 4JE5A 3WX9A 1W23A 1O62A 1ASAA 4WLHA 3WZFA 4BA4A 4PFNA 1H0CA 1M32A 1ASEA 1ARIA 2YRIA 3FDDA 3AEMA 4HVKA 3NYUA 1ARHA 1LS3A 3WGCA 4RAEA 3EUCA 2HP1A 2ZP7A 3TQXA 1E5FA 2Q7WA 3WLXA 4IY7A 1KL2A 2VMRA 3HQTA 4AO4A 2HUUA 3DC1A 1FG3A 3RUYA 3B46A 2RFVA 4F5HA 3ELPA 3GR9A 1B8GA 1XI9A 1TOJA 4ZLVA 2QMAA 1ASDA 2X8UA 2W8WA 3DRDA 1YIYA 3MAFA 5K8BA 3A9YA 3B8XA 4XAUA 3HT4A 3QBOA 5M4DA 2ZSMA 1JF9A 4A0GA 1G4VA 3FVSA 3KGWA 4HF8A 9AATA 2YKVA 2X3LA 1SZUA 3EI5A 2X5FA 4ADBA 1BJOA 2OKJA 2VGVA 3HDOA 3BWOA 4JEVA 4K2MA 3QI6A 2Z1ZA 1GC2A 2AEUA 2G6WA 4O6ZA 3ASAA 2FYFA 3KKIA 4RM1A 1AJSB 1MDXA 1WYUB 4WLJA 2CTZA 5F8VA 5JAYA 2HOYA 1CL2A 1V72A 2PB2A 4XJPA 3HVYA 3ZZJA 3QGUA 2EO5A 4OCAA 3GZDA 3W1IA 4AOAA 2Z9WA 1ZC9A 1Z7DA 3QN6A 5EFSA 3RCHA 1AHEA 2AY4A 3R4TA 4P7YA 4PFFA 3ZRQA 1GCKA 4MQQA 1AY8A 3RBLA 3AEMC 4RJ0A 4A0FA 3OP7A 2VMNA 2KFPA 2AY6A 5EIGB 4F5IA 2W7JA 3PGYA 5DJ1A 4ZDPA 4RJYA 1TOGA 1UU1A 4W1WA 4ZSYA 3FZ6A 2FQ6A 3G0TA 2D65A 4LNLA 3I16A 4JE5D 3GJUA 4J5UA 2YKUA 4NOGA 1MLZA 2VIAA 1UU0A 1KMJA 3PDXA 4K2BA 3ACZA 3DXVA 3PD6B 1ARSA 5FT6A 4DQ6A 3DYDA 4TV7A 3AEJC 1W3UA 3BS8A 4A6RA 2WK8A 4OMAA 3NTJA 2VMYA 1ECXA 3N7NA 1IX8A 1RVYA 2VMZA 4ATPA 4XJMA 1TOKA 4EFFA 1AHXA 1O61A 3NDNA 3HMUA 4IYOB
chains in the Genus database with same CATH topology
1ORDA 4BMKA 1QZ9A 3FFRA 1B9IA 2CY8A 1DTYA 1J32A 1ASCA 1I41A 2ZUKA 2QA3A 1N8PA 3VK3A 3DODA 3DZZA 2PO3A 2YKYA 3GETA 4Y0IA 3BWNC 2E7JA 1TATA 3EZSA 5HHYA 1OATA 2CJHA 1M6SA 2HP2A 3B1DA 2OATA 1DGEA 4LNMA 4AH3A 4WP0A 5J8QA 1WYTB 4F5JA 4LW4A 2ZY4A 3BCAA 2Z61A 2A1VA 3II0A 1D7RA 2AY1A 3LVMA 1SFFA 2DGMA 1RV4A 1WYVA 2HOXA 3NUIA 1TOIA 1EG5A 1TPLA 3CQ5A 2D66A 1YJZA 1JS3A 1IUGA 1QIRA 1IAYA 1AHFA 1X29A 3FKDA 1DGDA 5G09A 1N2TA 1MGVA 1LKCA 1C7GA 1CS1A 1Y4IA 5DB5A 1CQ6A 4WXBA 4H51A 4MQRA 5FT8A 3N75A 1U08A 4WB0A 1E5EA 1LK9A 5F9SA 2CJDA 2FNIA 2D5YA 4P3MA 3FVXA 1EJIA 5EUNA 3VAXA 1SPAA 2VMPA 4M2JA 3E77A 4M2MA 4WXGA 3PDBA 3E2ZA 1YOOA 1BS0A 2AEVA 4IYOA 2JISA 4OC9A 2VMXA 2OGAA 3E2YA 3ECDA 3L8AA 3ASBA 3D6KA 2W7HA 2Z9UA 3VP6A 3FD0A 2Z67A 5C6UA 2OKKA 2VYCA 4E3RA 3EI6A 4FL0A 4CBSA 2JG2A 1MDOA 1RVUA 3FZ7A 4F5MA 4MQPA 4EMYA 3COGA 1SZSA 3EIBA 1CJ0A 1MDZA 3BWNA 2O1BA 4F5FA 2GSAA 2W8UA 3EZ1A 2OQXA 4H63Q 3NUBA 5G2PA 3MADA 2ZJGA 1IVRA 2YKXA 2CANA 2VMUA 1G4XA 2ZY5A 3LV2A 1QGNA 4OYTA 3FCRA 1C7OA 1MLYA 1UU2A 3FVUA 2VMVA 1G7WA 4XEWA 3AELA 4A6UA 1TASA 2HUFA 1W7LA 4B9BA 1AKAA 3ISLA 2Z1YA 2C81A 5EAVA 3A9XA 2FNUA 4WYAA 2VMOA 2GMUA 2VMSA 3BB8A 4R5FA 5D5SA 5TF5A 4IXOA 3BC8A 3K7YA 4UHOA 5I92A 3B1CA 3L44A 4A6TA 1ZOBA 1M7YA 2O0RA 1AMSA 1ZODA 8AATA 2QB3A 3NU7A 3N4XA 1ASLA 4WYCA 2VGWA 2BWPA 1WKGA 1D2FA 2W7DA 4GE7A 1M4NA 1TOEA 1EQBA 3G8MA 3TFUA 3ZRRA 2JGTA 1DJEA 1MAQA 5E5IA 4Q76A 1GEYA 1JS6A 4KAMA 1AAMA 3GWPA 4OBUA 1OHYA 1D7SA 3NYTA 1B5OA 1CZEA 4RKCA 3N4RA 4ZM3A 1YIZA 4TMRA 1WSTA 4GDYA 3Q8NA 1GDEA 1ELQA 4CBRA 1ASNA 3LVLB 2CSTA 1BJOB 1CQ7A 2CFBA 2AY2A 3TATA 3G7QA 3FRKA 2W7EA 4BHDA 5LH9A 1ARTA 1S06A 1X0MA 2EZ1A 7AATA 5FT4A 4Q75A 3FQ8A 5EIGA 4WD2A 2C44A 5KTBA 4EU1A 4LW2A 1AJRA 1V2EA 2XH1A 4QGRA 2D7YA 4UHNA 2R0TA 3USFA 3N0LA 2ZY2A 4CXQA 1GD9A 2O7CA 2EPJA 1AKBA 1AX4A 3AOVA 2HOZA 3CQ4A 3K28A 2C0RA 3A2BA 2FM1A 2V1PA 3FZ8A 2DGLA 3LY1A 3QM2A 2AY9A 1PMMA 1SF2A 3MAFB 3BN1A 4JF0A 5FT5A 2AY5A 1B9HA 1I29A 2HORA 4Q6RA 3GSBA 2BI9A 3NU8A 1GC0A 1GEXA 2WB6A 4AZKA 2D64A 4IXZA 2D63A 1ASBA 3DU4A 3T32A 1T3IA 2R2NA 3R9AA 1ASFA 4A00A 3KGXA 3BCXA 3AEOA 3N4SA 4XQ2A 4Y0DA 3K40A 4KYOA 4K05A 4ITXA 5HDMA 2FN6A 2R5EA 4ZWMA 4A72A 1CL1A 1AHYA 1AMRA 1W7NA 2VI9A 4E1OA 3HL2A 1V2FA 2BI1A 4PIWA 4GE9A 3RBFA 4F4EA 3RI6A 1IBJA 3GZDC 4W1VA 1S09A 3EI8A 4N0WA 1S0AA 3HBXA 2DR1A 2WK7A 4XK1A 4U2HA 2XBNA 1M0OA 3DR7A 2VLFA 1AIAA 4IXSA 3FQ7A 4KXKA 1AIBA 2BIEA 3H7FA 1WYUA 4I8AA 5G2QA 1YAAA 3GZCA 1J04A 2W8VA 5M4BA 2CB1A 3PA9A 3EI7A 2YRRA 3NNKA 3IF2A 2W7MA 3A9ZA 4RKDA 3OKSA 1AY4A 1BQDA 1M0PA 1AMAA 2GB3A 3EIAA 4W5KA 2VMTA 3E2ZB 4EB5A 1WYVB 3JU7A 2WKAA 3QHXA 3P1TA 1Z3ZA 4F5GA 4WXFA 5D95A 2D7ZA 2E7IA 2ZYJA 3WCOA 3WKRA 4AO9A 4ZDOA 3I4JA 4WB0B 4ITGA 3AATA 1MAPA 3WKSA 2BIGA 4B98A 1IX6A 3PJ0A 1YNUA 3JZLA 4JEZA 4GE4A 3RQ1A 3VK2A 4MSOA 1KKPA 1VP4A 3MKJA 4JEYA 1YJSA 4R2NA 2VMQA 3UE8A 1D7UA 1C9CA 1PMOA 4J8LA 4ADCA 1IJIA 1ELUA 3ELEA 3TCMA 4A0HA 2DGKA 1X28A 1VJOA 2G7JA 3MC6C 1WKHA 2ORDA 1KKJA 2VGUA 4F5LA 2QB2A 1BKGA 4RIZA 4BQ0A 4CXRA 1QISA 2GMSA 4WYDA 1LW5A 2ZSLA 2CINA 5G0AA 3ZRPA 3JWBA 3FTBA 1AMQA 1PFFA 3MBBA 1IX7A 4R8DA 1BQAA 1SZKA 2BI5A 3NRAA 4TN4A 5DX5A 5EAAA 1S07A 1CQ8A 2E54A 3WY7A 1AAWA 3DR4A 3GBXA 1XEYA 1N31A 4F5KA 1I43A 2VGTA 4LNJA 3P6KA 1YJYA 2DKBA 2VIBA 3A8UX 1PG8A 3UAKA 2C7TA 3PPLA 3LG0A 3AENA 3PDBB 2W8JA 3B1EA 1CZCA 4GRXA 1C4KA 4ZSWA 1BJNA 2W7LA 1V2DA 2EZ2A 1O4SA 1X2AA 3IHJA 4IW7A 3AOWA 5EQCA 4ZDLA 4W91A 4AZJA 3QPGA 3VK4A 2CH1A 2QBTA 1OXOA 1QITA 3PAAA 1RV3A 2R5CA 5G4JA 3PD6A 1W7MA 1AHGA 3F0HA 2BWNA 4DGTA 4ZWVA 1SVVA 2CH2A 2DKJA 2HUIA 3BV0A 3CAIA 5E4ZA 1KMKA 1AKCA 4Y0HA 4W1XA 3FQAA 3LWSA 5IWQA 2YOBA 1AJSA 4JF1A 1LC5A 2E7UA 1P3WA 3MC6A 4MGRA 3H14A 4WBTA 1BW0A 4XJOA 4GEBA 4CVQA 3FDBA 4DBCA 4ADEA 1B4XA 1WYTA 1GC4A 4OTLA 4UQVA 3E9KA 4JEWA 3N5MA 2FKIA 2BIAA 2W7KA 4GSAA 2D61A 4K2IA 1DFOA 5M46A 3JW9A 3MEBA 3F9TA 4ISYA 4OBVA 5EUDA 3AEPA 1BJ4A 1UKJA 2F8JA 5E3KA 1C0NA 5G4IA 4FFCA 1ARGA 4WYGA 1BJWA 4L0OA 2ZC0A 5LHAA 2VGZA 2V0YA 2X5DA 4ADDA 1S08A 3WGBA 2YCNA 1LC8A 3BCBA 4PVFA 5DJ9A 4XJLA 3I5TA 5AX8A 1D7VA 2Z9XA 1QJ3A 2NMPA 2VLHA 5BJ4A 1M0NA 3TFTA 2ZY3A 4E3QA 2VGSA 3LVKA 1GEWA 3F6TA 4EB7A 2EGYA 1I48A 2BI2A 2AY7A 2W8TA 3HLMA 4ZASA 1C7NA 2CJGA 3ZZKA 2Z20A 3LVJA 3CQ6A 4R5ZA 2YCTA 2HZPA 1KL1A 2BYJA 3JTXA 3RCHB 1AY5A 2BKWA 3NX3A 1VEFA 1OXPA 3AEJA 4WYEA 4Q31A 3UWCA 4RITA 4UHMA 4MKKA 3W1HA 2BI3A 2YCPA 1OHVA 2DOUA 4UOYA 3WCNA 4MKJA 1JG8A 5HXXA 2AY8A 2BHXA 2TPLA 4RLGA 1BT4A 1LC7A 1DKAA 4BA5A 3H9XA 3NYSA 3E2FA 4ZM4A 5M49A 2OGEA 3FFHA 2WK9A 2BYLA 1IAXA 1H1CA 4N0BA 4A0RA 3DXWA 4MY5A 4ZAHA 2YHKA 2GQNA 1TARA 1ASGA 1G7XA 1ASMA 3KE3A 5BJ3A 1OHWA 1M0QA 2EH6A 1GC3A 4ATQA 2QSRA 3AENB 2JJFA 2JJGA 3ATHA 3EI9A 2EYQA 2PB0A 4W8IA 2VI8A 2BWOA 1FC4A 3M5UA 4E77A 3E6GA 2VMWA 1FG7A 2W7FA 4WYFA 1DJUA 3MAUA 4LC3A 3FSLA 2JJEA 1GBNA 2R5CB 2AY3A 1DJ9A 4U1TA 1O69A 4M2KA 3AV7A 4JEXA 1AICA 2AATA 1B5PA 2JJHA 2Z9VA 2W7IA 3W1JA 1QJ5A 4IX8A 5EUEA 3VOMA 2W7GA 4OT8A 3PIUA 2QLRA 1LW4A 3CBFA 3JWAA 4JE5A 3WX9A 1W23A 1O62A 1ASAA 4WLHA 3WZFA 4BA4A 4PFNA 1H0CA 1M32A 1ASEA 1ARIA 2YRIA 3FDDA 3AEMA 4HVKA 3NYUA 1ARHA 1LS3A 3WGCA 4RAEA 3EUCA 2HP1A 2ZP7A 3TQXA 1E5FA 2Q7WA 3WLXA 4IY7A 1KL2A 2VMRA 3HQTA 4AO4A 2HUUA 3DC1A 1FG3A 3RUYA 3B46A 2RFVA 4F5HA 3ELPA 3GR9A 1B8GA 1XI9A 1TOJA 4ZLVA 2QMAA 1ASDA 2X8UA 2W8WA 3DRDA 1YIYA 3MAFA 5K8BA 3A9YA 3B8XA 4XAUA 3HT4A 3QBOA 5M4DA 2ZSMA 1JF9A 4A0GA 1G4VA 3FVSA 3KGWA 4HF8A 9AATA 2YKVA 2X3LA 1SZUA 3EI5A 2X5FA 4ADBA 1BJOA 2OKJA 2VGVA 3HDOA 3BWOA 4JEVA 4K2MA 3QI6A 2Z1ZA 1GC2A 2AEUA 2G6WA 4O6ZA 3ASAA 2FYFA 3KKIA 4RM1A 1AJSB 1MDXA 1WYUB 4WLJA 2CTZA 5F8VA 5JAYA 2HOYA 1CL2A 1V72A 2PB2A 4XJPA 3HVYA 3ZZJA 3QGUA 2EO5A 4OCAA 3GZDA 3W1IA 4AOAA 2Z9WA 1ZC9A 1Z7DA 3QN6A 5EFSA 3RCHA 1AHEA 2AY4A 3R4TA 4P7YA 4PFFA 3ZRQA 1GCKA 4MQQA 1AY8A 3RBLA 3AEMC 4RJ0A 4A0FA 3OP7A 2VMNA 2KFPA 2AY6A 5EIGB 4F5IA 2W7JA 3PGYA 5DJ1A 4ZDPA 4RJYA 1TOGA 1UU1A 4W1WA 4ZSYA 3FZ6A 2FQ6A 3G0TA 2D65A 4LNLA 3I16A 4JE5D 3GJUA 4J5UA 2YKUA 4NOGA 1MLZA 2VIAA 1UU0A 1KMJA 3PDXA 4K2BA 3ACZA 3DXVA 3PD6B 1ARSA 5FT6A 4DQ6A 3DYDA 4TV7A 3AEJC 1W3UA 3BS8A 4A6RA 2WK8A 4OMAA 3NTJA 2VMYA 1ECXA 3N7NA 1IX8A 1RVYA 2VMZA 4ATPA 4XJMA 1TOKA 4EFFA 1AHXA 1O61A 3NDNA 3HMUA 4IYOB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ORD A;  4BMK A;  1QZ9 A;  3FFR A;  1B9I A;  2CY8 A;  1DTY A;  1J32 A;  1ASC A;  1I41 A;  2ZUK A;  2QA3 A;  1N8P A;  3VK3 A;  3DOD A;  3DZZ A;  2PO3 A;  2YKY A;  3GET A;  4Y0I A;  3BWN C;  2E7J A;  1TAT A;  3EZS A;  5HHY A;  1OAT A;  2CJH A;  1M6S A;  2HP2 A;  3B1D A;  2OAT A;  1DGE A;  4LNM A;  4AH3 A;  4WP0 A;  5J8Q A;  1WYT B;  4F5J A;  4LW4 A;  2ZY4 A;  3BCA A;  2Z61 A;  3II0 A;  1D7R A;  2AY1 A;  3LVM A;  1SFF A;  2DGM A;  1RV4 A;  1WYV A;  2HOX A;  3NUI A;  1TOI A;  1EG5 A;  1TPL A;  3CQ5 A;  2D66 A;  1YJZ A;  1JS3 A;  1IUG A;  1QIR A;  1IAY A;  1AHF A;  1X29 A;  3FKD A;  1DGD A;  5G09 A;  1N2T A;  1MGV A;  1LKC A;  1C7G A;  1CS1 A;  1Y4I A;  5DB5 A;  1CQ6 A;  4WXB A;  4H51 A;  4MQR A;  5FT8 A;  3N75 A;  1U08 A;  4WB0 A;  1E5E A;  1LK9 A;  5F9S A;  2CJD A;  2FNI A;  2D5Y A;  4P3M A;  3FVX A;  1EJI A;  5EUN A;  3VAX A;  1SPA A;  2VMP A;  4M2J A;  3E77 A;  4M2M A;  4WXG A;  3PDB A;  3E2Z A;  1YOO A;  1BS0 A;  2AEV A;  4IYO A;  2JIS A;  4OC9 A;  2VMX A;  2OGA A;  3E2Y A;  3ECD A;  3L8A A;  3ASB A;  3D6K A;  2W7H A;  2Z9U A;  3VP6 A;  3FD0 A;  2Z67 A;  5C6U A;  2OKK A;  2VYC A;  4E3R A;  3EI6 A;  4FL0 A;  4CBS A;  2JG2 A;  1MDO A;  1RVU A;  3FZ7 A;  4F5M A;  4MQP A;  4EMY A;  3COG A;  1SZS A;  3EIB A;  1CJ0 A;  1MDZ A;  3BWN A;  2O1B A;  4F5F A;  2GSA A;  2W8U A;  3EZ1 A;  2OQX A;  3NUB A;  5G2P A;  3MAD A;  2ZJG A;  1IVR A;  2YKX A;  2CAN A;  2VMU A;  1G4X A;  2ZY5 A;  3LV2 A;  1QGN A;  4OYT A;  3FCR A;  1C7O A;  1MLY A;  1UU2 A;  3FVU A;  2VMV A;  1G7W A;  4XEW A;  3AEL A;  4A6U A;  1TAS A;  2HUF A;  1W7L A;  4B9B A;  1AKA A;  3ISL A;  2Z1Y A;  2C81 A;  5EAV A;  3A9X A;  2FNU A;  4WYA A;  2VMO A;  2GMU A;  2VMS A;  3BB8 A;  4R5F A;  5D5S A;  5TF5 A;  4IXO A;  3BC8 A;  3K7Y A;  4UHO A;  5I92 A;  3B1C A;  3L44 A;  4A6T A;  1ZOB A;  1M7Y A;  2O0R A;  1AMS A;  1ZOD A;  8AAT A;  2QB3 A;  3NU7 A;  1ASL A;  4WYC A;  2VGW A;  2BWP A;  1WKG A;  1D2F A;  2W7D A;  4GE7 A;  1M4N A;  1TOE A;  1EQB A;  3G8M A;  3TFU A;  3ZRR A;  2JGT A;  1DJE A;  1MAQ A;  5E5I A;  4Q76 A;  1GEY A;  1JS6 A;  4KAM A;  1AAM A;  3GWP A;  4OBU A;  1OHY A;  1D7S A;  3NYT A;  1B5O A;  1CZE A;  4RKC A;  4ZM3 A;  1YIZ A;  4TMR A;  1WST A;  4GDY A;  3Q8N A;  1GDE A;  1ELQ A;  4CBR A;  1ASN A;  3LVL B;  2CST A;  1BJO B;  1CQ7 A;  2CFB A;  2AY2 A;  3TAT A;  3G7Q A;  3FRK A;  2W7E A;  4BHD A;  5LH9 A;  1ART A;  1S06 A;  1X0M A;  2EZ1 A;  7AAT A;  5FT4 A;  4Q75 A;  3FQ8 A;  5EIG A;  4WD2 A;  2C44 A;  4EU1 A;  4LW2 A;  1AJR A;  1V2E A;  2XH1 A;  4QGR A;  2D7Y A;  4UHN A;  2R0T A;  3USF A;  3N0L A;  2ZY2 A;  4CXQ A;  1GD9 A;  2O7C A;  2EPJ A;  1AKB A;  1AX4 A;  3AOV A;  2HOZ A;  3CQ4 A;  3K28 A;  2C0R A;  3A2B A;  2FM1 A;  2V1P A;  3FZ8 A;  2DGL A;  3LY1 A;  3QM2 A;  2AY9 A;  1PMM A;  1SF2 A;  3MAF B;  3BN1 A;  4JF0 A;  5FT5 A;  2AY5 A;  1B9H A;  1I29 A;  2HOR A;  4Q6R A;  3GSB A;  2BI9 A;  3NU8 A;  1GC0 A;  1GEX A;  4AZK A;  2D64 A;  4IXZ A;  2D63 A;  1ASB A;  3DU4 A;  3T32 A;  1T3I A;  2R2N A;  3R9A A;  1ASF A;  4A00 A;  3KGX A;  3BCX A;  3AEO A;  4XQ2 A;  4Y0D A;  3K40 A;  4KYO A;  4ITX A;  5HDM A;  2FN6 A;  2R5E A;  4ZWM A;  4A72 A;  1CL1 A;  1AHY A;  1AMR A;  1W7N A;  2VI9 A;  4E1O A;  3HL2 A;  1V2F A;  2BI1 A;  4PIW A;  4GE9 A;  3RBF A;  4F4E A;  3RI6 A;  1IBJ A;  3GZD C;  4W1V A;  1S09 A;  3EI8 A;  4N0W A;  1S0A A;  3HBX A;  2DR1 A;  2WK7 A;  4XK1 A;  4U2H A;  2XBN A;  1M0O A;  3DR7 A;  2VLF A;  1AIA A;  4IXS A;  3FQ7 A;  4KXK A;  1AIB A;  2BIE A;  3H7F A;  1WYU A;  4I8A A;  5G2Q A;  1YAA A;  3GZC A;  1J04 A;  2W8V A;  5M4B A;  2CB1 A;  3PA9 A;  3EI7 A;  2YRR A;  3NNK A;  3IF2 A;  2W7M A;  3A9Z A;  4RKD A;  3OKS A;  1AY4 A;  1BQD A;  1M0P A;  1AMA A;  2GB3 A;  3EIA A;  4W5K A;  2VMT A;  3E2Z B;  4EB5 A;  1WYV B;  3JU7 A;  2WKA A;  3QHX A;  3P1T A;  1Z3Z A;  4F5G A;  4WXF A;  5D95 A;  2D7Z A;  2E7I A;  2ZYJ A;  3WCO A;  3WKR A;  4AO9 A;  4ZDO A;  3I4J A;  4WB0 B;  4ITG A;  3AAT A;  1MAP A;  3WKS A;  2BIG A;  4B98 A;  1IX6 A;  3PJ0 A;  1YNU A;  3JZL A;  4JEZ A;  4GE4 A;  3RQ1 A;  3VK2 A;  4MSO A;  1KKP A;  1VP4 A;  3MKJ A;  4JEY A;  1YJS A;  4R2N A;  2VMQ A;  3UE8 A;  1D7U A;  1C9C A;  1PMO A;  4J8L A;  4ADC A;  1IJI A;  1ELU A;  3ELE A;  3TCM A;  4A0H A;  2DGK A;  1X28 A;  1VJO A;  3MC6 C;  1WKH A;  2ORD A;  1KKJ A;  2VGU A;  4F5L A;  2QB2 A;  1BKG A;  4RIZ A;  4BQ0 A;  4CXR A;  1QIS A;  2GMS A;  4WYD A;  1LW5 A;  2ZSL A;  2CIN A;  5G0A A;  3ZRP A;  3JWB A;  3FTB A;  1AMQ A;  1PFF A;  3MBB A;  1IX7 A;  4R8D A;  1BQA A;  1SZK A;  2BI5 A;  3NRA A;  4TN4 A;  5DX5 A;  5EAA A;  1S07 A;  1CQ8 A;  2E54 A;  3WY7 A;  1AAW A;  3DR4 A;  3GBX A;  1XEY A;  1N31 A;  4F5K A;  1I43 A;  2VGT A;  4LNJ A;  3P6K A;  1YJY A;  2DKB A;  2VIB A;  3A8U X;  1PG8 A;  3UAK A;  2C7T A;  3PPL A;  3LG0 A;  3AEN A;  3PDB B;  2W8J A;  3B1E A;  1CZC A;  4GRX A;  1C4K A;  4ZSW A;  1BJN A;  2W7L A;  1V2D A;  2EZ2 A;  1O4S A;  1X2A A;  3IHJ A;  4IW7 A;  3AOW A;  5EQC A;  4ZDL A;  4W91 A;  4AZJ A;  3QPG A;  3VK4 A;  2CH1 A;  2QBT A;  1OXO A;  1QIT A;  3PAA A;  1RV3 A;  2R5C A;  5G4J A;  3PD6 A;  1W7M A;  1AHG A;  3F0H A;  2BWN A;  4DGT A;  4ZWV A;  1SVV A;  2CH2 A;  2DKJ A;  2HUI A;  3BV0 A;  3CAI A;  5E4Z A;  1KMK A;  1AKC A;  4Y0H A;  4W1X A;  3FQA A;  3LWS A;  5IWQ A;  2YOB A;  1AJS A;  4JF1 A;  1LC5 A;  2E7U A;  1P3W A;  3MC6 A;  4MGR A;  3H14 A;  4WBT A;  1BW0 A;  4XJO A;  4GEB A;  4CVQ A;  3FDB A;  4DBC A;  4ADE A;  1B4X A;  1WYT A;  1GC4 A;  4OTL A;  4UQV A;  3E9K A;  4JEW A;  3N5M A;  2BIA A;  2W7K A;  4GSA A;  2D61 A;  4K2I A;  1DFO A;  5M46 A;  3JW9 A;  3MEB A;  3F9T A;  4ISY A;  4OBV A;  5EUD A;  3AEP A;  1BJ4 A;  1UKJ A;  2F8J A;  5E3K A;  1C0N A;  5G4I A;  4FFC A;  1ARG A;  4WYG A;  1BJW A;  4L0O A;  2ZC0 A;  5LHA A;  2VGZ A;  2V0Y A;  2X5D A;  4ADD A;  1S08 A;  3WGB A;  2YCN A;  1LC8 A;  3BCB A;  4PVF A;  5DJ9 A;  4XJL A;  3I5T A;  5AX8 A;  1D7V A;  2Z9X A;  1QJ3 A;  2NMP A;  2VLH A;  5BJ4 A;  1M0N A;  3TFT A;  2ZY3 A;  4E3Q A;  2VGS A;  3LVK A;  1GEW A;  3F6T A;  4EB7 A;  2EGY A;  1I48 A;  2BI2 A;  2AY7 A;  2W8T A;  3HLM A;  4ZAS A;  1C7N A;  2CJG A;  3ZZK A;  2Z20 A;  3LVJ A;  3CQ6 A;  4R5Z A;  2YCT A;  2HZP A;  1KL1 A;  2BYJ A;  3JTX A;  3RCH B;  1AY5 A;  2BKW A;  3NX3 A;  1VEF A;  1OXP A;  3AEJ A;  4WYE A;  4Q31 A;  3UWC A;  4RIT A;  4UHM A;  4MKK A;  3W1H A;  2BI3 A;  2YCP A;  1OHV A;  2DOU A;  4UOY A;  3WCN A;  4MKJ A;  1JG8 A;  5HXX A;  2AY8 A;  2BHX A;  2TPL A;  4RLG A;  1BT4 A;  1LC7 A;  1DKA A;  4BA5 A;  3NYS A;  3E2F A;  4ZM4 A;  5M49 A;  2OGE A;  3FFH A;  2WK9 A;  2BYL A;  1IAX A;  1H1C A;  4N0B A;  4A0R A;  3DXW A;  4MY5 A;  4ZAH A;  2YHK A;  2GQN A;  1TAR A;  1ASG A;  1G7X A;  1ASM A;  3KE3 A;  5BJ3 A;  1OHW A;  1M0Q A;  2EH6 A;  1GC3 A;  4ATQ A;  3AEN B;  2JJF A;  2JJG A;  3ATH A;  3EI9 A;  2PB0 A;  4W8I A;  2VI8 A;  2BWO A;  1FC4 A;  3M5U A;  4E77 A;  3E6G A;  2VMW A;  1FG7 A;  2W7F A;  4WYF A;  1DJU A;  3MAU A;  4LC3 A;  3FSL A;  2JJE A;  1GBN A;  2R5C B;  2AY3 A;  1DJ9 A;  4U1T A;  1O69 A;  4M2K A;  3AV7 A;  4JEX A;  1AIC A;  2AAT A;  1B5P A;  2JJH A;  2Z9V A;  2W7I A;  3W1J A;  1QJ5 A;  4IX8 A;  5EUE A;  3VOM A;  2W7G A;  4OT8 A;  3PIU A;  2QLR A;  1LW4 A;  3CBF A;  3JWA A;  4JE5 A;  3WX9 A;  1W23 A;  1O62 A;  1ASA A;  4WLH A;  3WZF A;  4BA4 A;  4PFN A;  1H0C A;  1M32 A;  1ASE A;  1ARI A;  2YRI A;  3FDD A;  3AEM A;  4HVK A;  3NYU A;  1ARH A;  1LS3 A;  3WGC A;  4RAE A;  3EUC A;  2HP1 A;  2ZP7 A;  3TQX A;  1E5F A;  2Q7W A;  3WLX A;  4IY7 A;  1KL2 A;  2VMR A;  3HQT A;  4AO4 A;  2HUU A;  3DC1 A;  1FG3 A;  3RUY A;  3B46 A;  2RFV A;  4F5H A;  3ELP A;  3GR9 A;  1B8G A;  1XI9 A;  1TOJ A;  4ZLV A;  2QMA A;  1ASD A;  2X8U A;  2W8W A;  3DRD A;  1YIY A;  3MAF A;  5K8B A;  3A9Y A;  3B8X A;  4XAU A;  3HT4 A;  3QBO A;  5M4D A;  2ZSM A;  1JF9 A;  4A0G A;  1G4V A;  3FVS A;  3KGW A;  4HF8 A;  9AAT A;  2YKV A;  2X3L A;  1SZU A;  3EI5 A;  2X5F A;  4ADB A;  1BJO A;  2OKJ A;  2VGV A;  3HDO A;  3BWO A;  4JEV A;  4K2M A;  3QI6 A;  2Z1Z A;  1GC2 A;  2AEU A;  2G6W A;  4O6Z A;  3ASA A;  2FYF A;  3KKI A;  4RM1 A;  1AJS B;  1MDX A;  1WYU B;  4WLJ A;  2CTZ A;  5F8V A;  5JAY A;  2HOY A;  1CL2 A;  1V72 A;  2PB2 A;  4XJP A;  3HVY A;  3ZZJ A;  3QGU A;  2EO5 A;  4OCA A;  3GZD A;  3W1I A;  4AOA A;  2Z9W A;  1ZC9 A;  1Z7D A;  3QN6 A;  5EFS A;  3RCH A;  1AHE A;  2AY4 A;  3R4T A;  4P7Y A;  4PFF A;  3ZRQ A;  1GCK A;  4MQQ A;  1AY8 A;  3RBL A;  3AEM C;  4RJ0 A;  4A0F A;  3OP7 A;  2VMN A;  2AY6 A;  5EIG B;  4F5I A;  2W7J A;  3PGY A;  5DJ1 A;  4ZDP A;  4RJY A;  1TOG A;  1UU1 A;  4W1W A;  4ZSY A;  3FZ6 A;  2FQ6 A;  3G0T A;  2D65 A;  4LNL A;  3I16 A;  4JE5 D;  3GJU A;  4J5U A;  2YKU A;  4NOG A;  1MLZ A;  2VIA A;  1UU0 A;  1KMJ A;  3PDX A;  4K2B A;  3ACZ A;  3DXV A;  3PD6 B;  1ARS A;  5FT6 A;  4DQ6 A;  3DYD A;  4TV7 A;  3AEJ C;  1W3U A;  3BS8 A;  4A6R A;  2WK8 A;  4OMA A;  3NTJ A;  2VMY A;  1ECX A;  1IX8 A;  1RVY A;  2VMZ A;  4ATP A;  4XJM A;  1TOK A;  4EFF A;  1AHX A;  1O61 A;  3NDN A;  3HMU A;  4IYO B; 
#chains in the Genus database with same CATH topology
 1ORD A;  4BMK A;  1QZ9 A;  3FFR A;  1B9I A;  2CY8 A;  1DTY A;  1J32 A;  1ASC A;  1I41 A;  2ZUK A;  2QA3 A;  1N8P A;  3VK3 A;  3DOD A;  3DZZ A;  2PO3 A;  2YKY A;  3GET A;  4Y0I A;  3BWN C;  2E7J A;  1TAT A;  3EZS A;  5HHY A;  1OAT A;  2CJH A;  1M6S A;  2HP2 A;  3B1D A;  2OAT A;  1DGE A;  4LNM A;  4AH3 A;  4WP0 A;  5J8Q A;  1WYT B;  4F5J A;  4LW4 A;  2ZY4 A;  3BCA A;  2Z61 A;  2A1V A;  3II0 A;  1D7R A;  2AY1 A;  3LVM A;  1SFF A;  2DGM A;  1RV4 A;  1WYV A;  2HOX A;  3NUI A;  1TOI A;  1EG5 A;  1TPL A;  3CQ5 A;  2D66 A;  1YJZ A;  1JS3 A;  1IUG A;  1QIR A;  1IAY A;  1AHF A;  1X29 A;  3FKD A;  1DGD A;  5G09 A;  1N2T A;  1MGV A;  1LKC A;  1C7G A;  1CS1 A;  1Y4I A;  5DB5 A;  1CQ6 A;  4WXB A;  4H51 A;  4MQR A;  5FT8 A;  3N75 A;  1U08 A;  4WB0 A;  1E5E A;  1LK9 A;  5F9S A;  2CJD A;  2FNI A;  2D5Y A;  4P3M A;  3FVX A;  1EJI A;  5EUN A;  3VAX A;  1SPA A;  2VMP A;  4M2J A;  3E77 A;  4M2M A;  4WXG A;  3PDB A;  3E2Z A;  1YOO A;  1BS0 A;  2AEV A;  4IYO A;  2JIS A;  4OC9 A;  2VMX A;  2OGA A;  3E2Y A;  3ECD A;  3L8A A;  3ASB A;  3D6K A;  2W7H A;  2Z9U A;  3VP6 A;  3FD0 A;  2Z67 A;  5C6U A;  2OKK A;  2VYC A;  4E3R A;  3EI6 A;  4FL0 A;  4CBS A;  2JG2 A;  1MDO A;  1RVU A;  3FZ7 A;  4F5M A;  4MQP A;  4EMY A;  3COG A;  1SZS A;  3EIB A;  1CJ0 A;  1MDZ A;  3BWN A;  2O1B A;  4F5F A;  2GSA A;  2W8U A;  3EZ1 A;  2OQX A;  4H63 Q;  3NUB A;  5G2P A;  3MAD A;  2ZJG A;  1IVR A;  2YKX A;  2CAN A;  2VMU A;  1G4X A;  2ZY5 A;  3LV2 A;  1QGN A;  4OYT A;  3FCR A;  1C7O A;  1MLY A;  1UU2 A;  3FVU A;  2VMV A;  1G7W A;  4XEW A;  3AEL A;  4A6U A;  1TAS A;  2HUF A;  1W7L A;  4B9B A;  1AKA A;  3ISL A;  2Z1Y A;  2C81 A;  5EAV A;  3A9X A;  2FNU A;  4WYA A;  2VMO A;  2GMU A;  2VMS A;  3BB8 A;  4R5F A;  5D5S A;  5TF5 A;  4IXO A;  3BC8 A;  3K7Y A;  4UHO A;  5I92 A;  3B1C A;  3L44 A;  4A6T A;  1ZOB A;  1M7Y A;  2O0R A;  1AMS A;  1ZOD A;  8AAT A;  2QB3 A;  3NU7 A;  3N4X A;  1ASL A;  4WYC A;  2VGW A;  2BWP A;  1WKG A;  1D2F A;  2W7D A;  4GE7 A;  1KAF A;  1M4N A;  1TOE A;  1EQB A;  3G8M A;  3TFU A;  3ZRR A;  2JGT A;  1DJE A;  1MAQ A;  5E5I A;  4Q76 A;  1GEY A;  1JS6 A;  4KAM A;  1AAM A;  3GWP A;  4OBU A;  1OHY A;  1D7S A;  3NYT A;  1B5O A;  1CZE A;  4RKC A;  3N4R A;  4ZM3 A;  1YIZ A;  4TMR A;  1WST A;  4GDY A;  3Q8N A;  1GDE A;  1ELQ A;  4CBR A;  1ASN A;  3LVL B;  2CST A;  1BJO B;  1CQ7 A;  2CFB A;  2AY2 A;  3TAT A;  3G7Q A;  3FRK A;  2W7E A;  4BHD A;  5LH9 A;  1ART A;  1S06 A;  1X0M A;  2EZ1 A;  7AAT A;  5FT4 A;  4Q75 A;  3FQ8 A;  5EIG A;  4WD2 A;  2C44 A;  5KTB A;  4EU1 A;  4LW2 A;  1AJR A;  1V2E A;  2XH1 A;  4QGR A;  2D7Y A;  4UHN A;  2R0T A;  3USF A;  3N0L A;  2ZY2 A;  4CXQ A;  1GD9 A;  2O7C A;  2EPJ A;  1AKB A;  1AX4 A;  3AOV A;  2HOZ A;  3CQ4 A;  3K28 A;  2C0R A;  3A2B A;  2FM1 A;  2V1P A;  3FZ8 A;  2DGL A;  3LY1 A;  3QM2 A;  2AY9 A;  1PMM A;  1SF2 A;  3MAF B;  3BN1 A;  4JF0 A;  5FT5 A;  2AY5 A;  1B9H A;  1I29 A;  2HOR A;  4Q6R A;  3GSB A;  2BI9 A;  3NU8 A;  1GC0 A;  1GEX A;  2WB6 A;  4AZK A;  2D64 A;  4IXZ A;  2D63 A;  1ASB A;  3DU4 A;  3T32 A;  1T3I A;  2R2N A;  3R9A A;  1ASF A;  4A00 A;  3KGX A;  3BCX A;  3AEO A;  3N4S A;  4XQ2 A;  4Y0D A;  3K40 A;  4KYO A;  4K05 A;  4ITX A;  5HDM A;  2FN6 A;  2R5E A;  4ZWM A;  4A72 A;  1CL1 A;  1AHY A;  1AMR A;  1W7N A;  2VI9 A;  4E1O A;  3HL2 A;  1V2F A;  2BI1 A;  4PIW A;  4GE9 A;  3RBF A;  4F4E A;  3RI6 A;  1IBJ A;  3GZD C;  4W1V A;  1S09 A;  3EI8 A;  4N0W A;  1S0A A;  3HBX A;  2DR1 A;  2WK7 A;  4XK1 A;  4U2H A;  2XBN A;  1M0O A;  3DR7 A;  2VLF A;  1AIA A;  4IXS A;  3FQ7 A;  4KXK A;  1AIB A;  2BIE A;  3H7F A;  1WYU A;  4I8A A;  5G2Q A;  1YAA A;  3GZC A;  1J04 A;  2W8V A;  5M4B A;  2CB1 A;  3PA9 A;  3EI7 A;  2YRR A;  3NNK A;  3IF2 A;  2W7M A;  3A9Z A;  4RKD A;  3OKS A;  1AY4 A;  1BQD A;  1M0P A;  1AMA A;  2GB3 A;  3EIA A;  4W5K A;  2VMT A;  3E2Z B;  4EB5 A;  1WYV B;  3JU7 A;  2WKA A;  3QHX A;  3P1T A;  1Z3Z A;  4F5G A;  4WXF A;  5D95 A;  2D7Z A;  2E7I A;  2ZYJ A;  3WCO A;  3WKR A;  4AO9 A;  4ZDO A;  3I4J A;  4WB0 B;  4ITG A;  3AAT A;  1MAP A;  3WKS A;  2BIG A;  4B98 A;  1IX6 A;  3PJ0 A;  1YNU A;  3JZL A;  4JEZ A;  4GE4 A;  3RQ1 A;  3VK2 A;  4MSO A;  1KKP A;  1VP4 A;  3MKJ A;  4JEY A;  1YJS A;  4R2N A;  2VMQ A;  3UE8 A;  1D7U A;  1C9C A;  1PMO A;  4J8L A;  4ADC A;  1IJI A;  1ELU A;  3ELE A;  3TCM A;  4A0H A;  2DGK A;  1X28 A;  1VJO A;  2G7J A;  3MC6 C;  1WKH A;  2ORD A;  1KKJ A;  2VGU A;  4F5L A;  2QB2 A;  1BKG A;  4RIZ A;  4BQ0 A;  4CXR A;  1QIS A;  2GMS A;  4WYD A;  1LW5 A;  2ZSL A;  2CIN A;  5G0A A;  3ZRP A;  3JWB A;  3FTB A;  1AMQ A;  1PFF A;  3MBB A;  1IX7 A;  4R8D A;  1BQA A;  1SZK A;  2BI5 A;  3NRA A;  4TN4 A;  5DX5 A;  5EAA A;  1S07 A;  1CQ8 A;  2E54 A;  3WY7 A;  1AAW A;  3DR4 A;  3GBX A;  1XEY A;  1N31 A;  4F5K A;  1I43 A;  2VGT A;  4LNJ A;  3P6K A;  1YJY A;  2DKB A;  2VIB A;  3A8U X;  1PG8 A;  3UAK A;  2C7T A;  3PPL A;  3LG0 A;  3AEN A;  3PDB B;  2W8J A;  3B1E A;  1CZC A;  4GRX A;  1C4K A;  4ZSW A;  1BJN A;  2W7L A;  1V2D A;  2EZ2 A;  1O4S A;  1X2A A;  3IHJ A;  4IW7 A;  3AOW A;  5EQC A;  4ZDL A;  4W91 A;  4AZJ A;  3QPG A;  3VK4 A;  2CH1 A;  2QBT A;  1OXO A;  1QIT A;  3PAA A;  1RV3 A;  2R5C A;  5G4J A;  3PD6 A;  1W7M A;  1AHG A;  3F0H A;  2BWN A;  4DGT A;  4ZWV A;  1SVV A;  2CH2 A;  2DKJ A;  2HUI A;  3BV0 A;  3CAI A;  5E4Z A;  1KMK A;  1AKC A;  4Y0H A;  4W1X A;  3FQA A;  3LWS A;  5IWQ A;  2YOB A;  1AJS A;  4JF1 A;  1LC5 A;  2E7U A;  1P3W A;  3MC6 A;  4MGR A;  3H14 A;  4WBT A;  1BW0 A;  4XJO A;  4GEB A;  4CVQ A;  3FDB A;  4DBC A;  4ADE A;  1B4X A;  1WYT A;  1GC4 A;  4OTL A;  4UQV A;  3E9K A;  4JEW A;  3N5M A;  2FKI A;  2BIA A;  2W7K A;  4GSA A;  2D61 A;  4K2I A;  1DFO A;  5M46 A;  3JW9 A;  3MEB A;  3F9T A;  4ISY A;  4OBV A;  5EUD A;  3AEP A;  1BJ4 A;  1UKJ A;  2F8J A;  5E3K A;  1C0N A;  5G4I A;  4FFC A;  1ARG A;  4WYG A;  1BJW A;  4L0O A;  2ZC0 A;  5LHA A;  2VGZ A;  2V0Y A;  2X5D A;  4ADD A;  1S08 A;  3WGB A;  2YCN A;  1LC8 A;  3BCB A;  4PVF A;  5DJ9 A;  4XJL A;  3I5T A;  5AX8 A;  1D7V A;  2Z9X A;  1QJ3 A;  2NMP A;  2VLH A;  5BJ4 A;  1M0N A;  3TFT A;  2ZY3 A;  4E3Q A;  2VGS A;  3LVK A;  1GEW A;  3F6T A;  4EB7 A;  2EGY A;  1I48 A;  2BI2 A;  2AY7 A;  2W8T A;  3HLM A;  4ZAS A;  1C7N A;  2CJG A;  3ZZK A;  2Z20 A;  3LVJ A;  3CQ6 A;  4R5Z A;  2YCT A;  2HZP A;  1KL1 A;  2BYJ A;  3JTX A;  3RCH B;  1AY5 A;  2BKW A;  3NX3 A;  1VEF A;  1OXP A;  3AEJ A;  4WYE A;  4Q31 A;  3UWC A;  4RIT A;  4UHM A;  4MKK A;  3W1H A;  2BI3 A;  2YCP A;  1OHV A;  2DOU A;  4UOY A;  3WCN A;  4MKJ A;  1JG8 A;  5HXX A;  2AY8 A;  2BHX A;  2TPL A;  4RLG A;  1BT4 A;  1LC7 A;  1DKA A;  4BA5 A;  3H9X A;  3NYS A;  3E2F A;  4ZM4 A;  5M49 A;  2OGE A;  3FFH A;  2WK9 A;  2BYL A;  1IAX A;  1H1C A;  4N0B A;  4A0R A;  3DXW A;  4MY5 A;  4ZAH A;  2YHK A;  2GQN A;  1TAR A;  1ASG A;  1G7X A;  1ASM A;  3KE3 A;  5BJ3 A;  1OHW A;  1M0Q A;  2EH6 A;  1GC3 A;  4ATQ A;  2QSR A;  3AEN B;  2JJF A;  2JJG A;  3ATH A;  3EI9 A;  2EYQ A;  2PB0 A;  4W8I A;  2VI8 A;  2BWO A;  1FC4 A;  3M5U A;  4E77 A;  3E6G A;  2VMW A;  1FG7 A;  2W7F A;  4WYF A;  1DJU A;  3MAU A;  4LC3 A;  3FSL A;  2JJE A;  1GBN A;  2R5C B;  2AY3 A;  1DJ9 A;  4U1T A;  1O69 A;  4M2K A;  3AV7 A;  4JEX A;  1AIC A;  2AAT A;  1B5P A;  2JJH A;  2Z9V A;  2W7I A;  3W1J A;  1QJ5 A;  4IX8 A;  5EUE A;  3VOM A;  2W7G A;  4OT8 A;  3PIU A;  2QLR A;  1LW4 A;  3CBF A;  3JWA A;  4JE5 A;  3WX9 A;  1W23 A;  1O62 A;  1ASA A;  4WLH A;  3WZF A;  4BA4 A;  4PFN A;  1H0C A;  1M32 A;  1ASE A;  1ARI A;  2YRI A;  3FDD A;  3AEM A;  4HVK A;  3NYU A;  1ARH A;  1LS3 A;  3WGC A;  4RAE A;  3EUC A;  2HP1 A;  2ZP7 A;  3TQX A;  1E5F A;  2Q7W A;  3WLX A;  4IY7 A;  1KL2 A;  2VMR A;  3HQT A;  4AO4 A;  2HUU A;  3DC1 A;  1FG3 A;  3RUY A;  3B46 A;  2RFV A;  4F5H A;  3ELP A;  3GR9 A;  1B8G A;  1XI9 A;  1TOJ A;  4ZLV A;  2QMA A;  1ASD A;  2X8U A;  2W8W A;  3DRD A;  1YIY A;  3MAF A;  5K8B A;  3A9Y A;  3B8X A;  4XAU A;  3HT4 A;  3QBO A;  5M4D A;  2ZSM A;  1JF9 A;  4A0G A;  1G4V A;  3FVS A;  3KGW A;  4HF8 A;  9AAT A;  2YKV A;  2X3L A;  1SZU A;  3EI5 A;  2X5F A;  4ADB A;  1BJO A;  2OKJ A;  2VGV A;  3HDO A;  3BWO A;  4JEV A;  4K2M A;  3QI6 A;  2Z1Z A;  1GC2 A;  2AEU A;  2G6W A;  4O6Z A;  3ASA A;  2FYF A;  3KKI A;  4RM1 A;  1AJS B;  1MDX A;  1WYU B;  4WLJ A;  2CTZ A;  5F8V A;  5JAY A;  2HOY A;  1CL2 A;  1V72 A;  2PB2 A;  4XJP A;  3HVY A;  3ZZJ A;  3QGU A;  2EO5 A;  4OCA A;  3GZD A;  3W1I A;  4AOA A;  2Z9W A;  1ZC9 A;  1Z7D A;  3QN6 A;  5EFS A;  3RCH A;  1AHE A;  2AY4 A;  3R4T A;  4P7Y A;  4PFF A;  3ZRQ A;  1GCK A;  4MQQ A;  1AY8 A;  3RBL A;  3AEM C;  4RJ0 A;  4A0F A;  3OP7 A;  2VMN A;  2KFP A;  2AY6 A;  5EIG B;  4F5I A;  2W7J A;  3PGY A;  5DJ1 A;  4ZDP A;  4RJY A;  1TOG A;  1UU1 A;  4W1W A;  4ZSY A;  3FZ6 A;  2FQ6 A;  3G0T A;  2D65 A;  4LNL A;  3I16 A;  4JE5 D;  3GJU A;  4J5U A;  2YKU A;  4NOG A;  1MLZ A;  2VIA A;  1UU0 A;  1KMJ A;  3PDX A;  4K2B A;  3ACZ A;  3DXV A;  3PD6 B;  1ARS A;  5FT6 A;  4DQ6 A;  3DYD A;  4TV7 A;  3AEJ C;  1W3U A;  3BS8 A;  4A6R A;  2WK8 A;  4OMA A;  3NTJ A;  2VMY A;  1ECX A;  3N7N A;  1IX8 A;  1RVY A;  2VMZ A;  4ATP A;  4XJM A;  1TOK A;  4EFF A;  1AHX A;  1O61 A;  3NDN A;  3HMU A;  4IYO B; 
#chains in the Genus database with same CATH homology
 1ORD A;  4BMK A;  1QZ9 A;  3FFR A;  1B9I A;  2CY8 A;  1DTY A;  1J32 A;  1ASC A;  1I41 A;  2ZUK A;  2QA3 A;  1N8P A;  3VK3 A;  3DOD A;  3DZZ A;  2PO3 A;  2YKY A;  3GET A;  4Y0I A;  3BWN C;  2E7J A;  1TAT A;  3EZS A;  5HHY A;  1OAT A;  2CJH A;  1M6S A;  2HP2 A;  3B1D A;  2OAT A;  1DGE A;  4LNM A;  4AH3 A;  4WP0 A;  5J8Q A;  1WYT B;  4F5J A;  4LW4 A;  2ZY4 A;  3BCA A;  2Z61 A;  2A1V A;  3II0 A;  1D7R A;  2AY1 A;  3LVM A;  1SFF A;  2DGM A;  1RV4 A;  1WYV A;  2HOX A;  3NUI A;  1TOI A;  1EG5 A;  1TPL A;  3CQ5 A;  2D66 A;  1YJZ A;  1JS3 A;  1IUG A;  1QIR A;  1IAY A;  1AHF A;  1X29 A;  3FKD A;  1DGD A;  5G09 A;  1N2T A;  1MGV A;  1LKC A;  1C7G A;  1CS1 A;  1Y4I A;  5DB5 A;  1CQ6 A;  4WXB A;  4H51 A;  4MQR A;  5FT8 A;  3N75 A;  1U08 A;  4WB0 A;  1E5E A;  1LK9 A;  5F9S A;  2CJD A;  2FNI A;  2D5Y A;  4P3M A;  3FVX A;  1EJI A;  5EUN A;  3VAX A;  1SPA A;  2VMP A;  4M2J A;  3E77 A;  4M2M A;  4WXG A;  3PDB A;  3E2Z A;  1YOO A;  1BS0 A;  2AEV A;  4IYO A;  2JIS A;  4OC9 A;  2VMX A;  2OGA A;  3E2Y A;  3ECD A;  3L8A A;  3ASB A;  3D6K A;  2W7H A;  2Z9U A;  3VP6 A;  3FD0 A;  2Z67 A;  5C6U A;  2OKK A;  2VYC A;  4E3R A;  3EI6 A;  4FL0 A;  4CBS A;  2JG2 A;  1MDO A;  1RVU A;  3FZ7 A;  4F5M A;  4MQP A;  4EMY A;  3COG A;  1SZS A;  3EIB A;  1CJ0 A;  1MDZ A;  3BWN A;  2O1B A;  4F5F A;  2GSA A;  2W8U A;  3EZ1 A;  2OQX A;  4H63 Q;  3NUB A;  5G2P A;  3MAD A;  2ZJG A;  1IVR A;  2YKX A;  2CAN A;  2VMU A;  1G4X A;  2ZY5 A;  3LV2 A;  1QGN A;  4OYT A;  3FCR A;  1C7O A;  1MLY A;  1UU2 A;  3FVU A;  2VMV A;  1G7W A;  4XEW A;  3AEL A;  4A6U A;  1TAS A;  2HUF A;  1W7L A;  4B9B A;  1AKA A;  3ISL A;  2Z1Y A;  2C81 A;  5EAV A;  3A9X A;  2FNU A;  4WYA A;  2VMO A;  2GMU A;  2VMS A;  3BB8 A;  4R5F A;  5D5S A;  5TF5 A;  4IXO A;  3BC8 A;  3K7Y A;  4UHO A;  5I92 A;  3B1C A;  3L44 A;  4A6T A;  1ZOB A;  1M7Y A;  2O0R A;  1AMS A;  1ZOD A;  8AAT A;  2QB3 A;  3NU7 A;  3N4X A;  1ASL A;  4WYC A;  2VGW A;  2BWP A;  1WKG A;  1D2F A;  2W7D A;  4GE7 A;  1M4N A;  1TOE A;  1EQB A;  3G8M A;  3TFU A;  3ZRR A;  2JGT A;  1DJE A;  1MAQ A;  5E5I A;  4Q76 A;  1GEY A;  1JS6 A;  4KAM A;  1AAM A;  3GWP A;  4OBU A;  1OHY A;  1D7S A;  3NYT A;  1B5O A;  1CZE A;  4RKC A;  3N4R A;  4ZM3 A;  1YIZ A;  4TMR A;  1WST A;  4GDY A;  3Q8N A;  1GDE A;  1ELQ A;  4CBR A;  1ASN A;  3LVL B;  2CST A;  1BJO B;  1CQ7 A;  2CFB A;  2AY2 A;  3TAT A;  3G7Q A;  3FRK A;  2W7E A;  4BHD A;  5LH9 A;  1ART A;  1S06 A;  1X0M A;  2EZ1 A;  7AAT A;  5FT4 A;  4Q75 A;  3FQ8 A;  5EIG A;  4WD2 A;  2C44 A;  5KTB A;  4EU1 A;  4LW2 A;  1AJR A;  1V2E A;  2XH1 A;  4QGR A;  2D7Y A;  4UHN A;  2R0T A;  3USF A;  3N0L A;  2ZY2 A;  4CXQ A;  1GD9 A;  2O7C A;  2EPJ A;  1AKB A;  1AX4 A;  3AOV A;  2HOZ A;  3CQ4 A;  3K28 A;  2C0R A;  3A2B A;  2FM1 A;  2V1P A;  3FZ8 A;  2DGL A;  3LY1 A;  3QM2 A;  2AY9 A;  1PMM A;  1SF2 A;  3MAF B;  3BN1 A;  4JF0 A;  5FT5 A;  2AY5 A;  1B9H A;  1I29 A;  2HOR A;  4Q6R A;  3GSB A;  2BI9 A;  3NU8 A;  1GC0 A;  1GEX A;  2WB6 A;  4AZK A;  2D64 A;  4IXZ A;  2D63 A;  1ASB A;  3DU4 A;  3T32 A;  1T3I A;  2R2N A;  3R9A A;  1ASF A;  4A00 A;  3KGX A;  3BCX A;  3AEO A;  3N4S A;  4XQ2 A;  4Y0D A;  3K40 A;  4KYO A;  4K05 A;  4ITX A;  5HDM A;  2FN6 A;  2R5E A;  4ZWM A;  4A72 A;  1CL1 A;  1AHY A;  1AMR A;  1W7N A;  2VI9 A;  4E1O A;  3HL2 A;  1V2F A;  2BI1 A;  4PIW A;  4GE9 A;  3RBF A;  4F4E A;  3RI6 A;  1IBJ A;  3GZD C;  4W1V A;  1S09 A;  3EI8 A;  4N0W A;  1S0A A;  3HBX A;  2DR1 A;  2WK7 A;  4XK1 A;  4U2H A;  2XBN A;  1M0O A;  3DR7 A;  2VLF A;  1AIA A;  4IXS A;  3FQ7 A;  4KXK A;  1AIB A;  2BIE A;  3H7F A;  1WYU A;  4I8A A;  5G2Q A;  1YAA A;  3GZC A;  1J04 A;  2W8V A;  5M4B A;  2CB1 A;  3PA9 A;  3EI7 A;  2YRR A;  3NNK A;  3IF2 A;  2W7M A;  3A9Z A;  4RKD A;  3OKS A;  1AY4 A;  1BQD A;  1M0P A;  1AMA A;  2GB3 A;  3EIA A;  4W5K A;  2VMT A;  3E2Z B;  4EB5 A;  1WYV B;  3JU7 A;  2WKA A;  3QHX A;  3P1T A;  1Z3Z A;  4F5G A;  4WXF A;  5D95 A;  2D7Z A;  2E7I A;  2ZYJ A;  3WCO A;  3WKR A;  4AO9 A;  4ZDO A;  3I4J A;  4WB0 B;  4ITG A;  3AAT A;  1MAP A;  3WKS A;  2BIG A;  4B98 A;  1IX6 A;  3PJ0 A;  1YNU A;  3JZL A;  4JEZ A;  4GE4 A;  3RQ1 A;  3VK2 A;  4MSO A;  1KKP A;  1VP4 A;  3MKJ A;  4JEY A;  1YJS A;  4R2N A;  2VMQ A;  3UE8 A;  1D7U A;  1C9C A;  1PMO A;  4J8L A;  4ADC A;  1IJI A;  1ELU A;  3ELE A;  3TCM A;  4A0H A;  2DGK A;  1X28 A;  1VJO A;  2G7J A;  3MC6 C;  1WKH A;  2ORD A;  1KKJ A;  2VGU A;  4F5L A;  2QB2 A;  1BKG A;  4RIZ A;  4BQ0 A;  4CXR A;  1QIS A;  2GMS A;  4WYD A;  1LW5 A;  2ZSL A;  2CIN A;  5G0A A;  3ZRP A;  3JWB A;  3FTB A;  1AMQ A;  1PFF A;  3MBB A;  1IX7 A;  4R8D A;  1BQA A;  1SZK A;  2BI5 A;  3NRA A;  4TN4 A;  5DX5 A;  5EAA A;  1S07 A;  1CQ8 A;  2E54 A;  3WY7 A;  1AAW A;  3DR4 A;  3GBX A;  1XEY A;  1N31 A;  4F5K A;  1I43 A;  2VGT A;  4LNJ A;  3P6K A;  1YJY A;  2DKB A;  2VIB A;  3A8U X;  1PG8 A;  3UAK A;  2C7T A;  3PPL A;  3LG0 A;  3AEN A;  3PDB B;  2W8J A;  3B1E A;  1CZC A;  4GRX A;  1C4K A;  4ZSW A;  1BJN A;  2W7L A;  1V2D A;  2EZ2 A;  1O4S A;  1X2A A;  3IHJ A;  4IW7 A;  3AOW A;  5EQC A;  4ZDL A;  4W91 A;  4AZJ A;  3QPG A;  3VK4 A;  2CH1 A;  2QBT A;  1OXO A;  1QIT A;  3PAA A;  1RV3 A;  2R5C A;  5G4J A;  3PD6 A;  1W7M A;  1AHG A;  3F0H A;  2BWN A;  4DGT A;  4ZWV A;  1SVV A;  2CH2 A;  2DKJ A;  2HUI A;  3BV0 A;  3CAI A;  5E4Z A;  1KMK A;  1AKC A;  4Y0H A;  4W1X A;  3FQA A;  3LWS A;  5IWQ A;  2YOB A;  1AJS A;  4JF1 A;  1LC5 A;  2E7U A;  1P3W A;  3MC6 A;  4MGR A;  3H14 A;  4WBT A;  1BW0 A;  4XJO A;  4GEB A;  4CVQ A;  3FDB A;  4DBC A;  4ADE A;  1B4X A;  1WYT A;  1GC4 A;  4OTL A;  4UQV A;  3E9K A;  4JEW A;  3N5M A;  2FKI A;  2BIA A;  2W7K A;  4GSA A;  2D61 A;  4K2I A;  1DFO A;  5M46 A;  3JW9 A;  3MEB A;  3F9T A;  4ISY A;  4OBV A;  5EUD A;  3AEP A;  1BJ4 A;  1UKJ A;  2F8J A;  5E3K A;  1C0N A;  5G4I A;  4FFC A;  1ARG A;  4WYG A;  1BJW A;  4L0O A;  2ZC0 A;  5LHA A;  2VGZ A;  2V0Y A;  2X5D A;  4ADD A;  1S08 A;  3WGB A;  2YCN A;  1LC8 A;  3BCB A;  4PVF A;  5DJ9 A;  4XJL A;  3I5T A;  5AX8 A;  1D7V A;  2Z9X A;  1QJ3 A;  2NMP A;  2VLH A;  5BJ4 A;  1M0N A;  3TFT A;  2ZY3 A;  4E3Q A;  2VGS A;  3LVK A;  1GEW A;  3F6T A;  4EB7 A;  2EGY A;  1I48 A;  2BI2 A;  2AY7 A;  2W8T A;  3HLM A;  4ZAS A;  1C7N A;  2CJG A;  3ZZK A;  2Z20 A;  3LVJ A;  3CQ6 A;  4R5Z A;  2YCT A;  2HZP A;  1KL1 A;  2BYJ A;  3JTX A;  3RCH B;  1AY5 A;  2BKW A;  3NX3 A;  1VEF A;  1OXP A;  3AEJ A;  4WYE A;  4Q31 A;  3UWC A;  4RIT A;  4UHM A;  4MKK A;  3W1H A;  2BI3 A;  2YCP A;  1OHV A;  2DOU A;  4UOY A;  3WCN A;  4MKJ A;  1JG8 A;  5HXX A;  2AY8 A;  2BHX A;  2TPL A;  4RLG A;  1BT4 A;  1LC7 A;  1DKA A;  4BA5 A;  3H9X A;  3NYS A;  3E2F A;  4ZM4 A;  5M49 A;  2OGE A;  3FFH A;  2WK9 A;  2BYL A;  1IAX A;  1H1C A;  4N0B A;  4A0R A;  3DXW A;  4MY5 A;  4ZAH A;  2YHK A;  2GQN A;  1TAR A;  1ASG A;  1G7X A;  1ASM A;  3KE3 A;  5BJ3 A;  1OHW A;  1M0Q A;  2EH6 A;  1GC3 A;  4ATQ A;  2QSR A;  3AEN B;  2JJF A;  2JJG A;  3ATH A;  3EI9 A;  2EYQ A;  2PB0 A;  4W8I A;  2VI8 A;  2BWO A;  1FC4 A;  3M5U A;  4E77 A;  3E6G A;  2VMW A;  1FG7 A;  2W7F A;  4WYF A;  1DJU A;  3MAU A;  4LC3 A;  3FSL A;  2JJE A;  1GBN A;  2R5C B;  2AY3 A;  1DJ9 A;  4U1T A;  1O69 A;  4M2K A;  3AV7 A;  4JEX A;  1AIC A;  2AAT A;  1B5P A;  2JJH A;  2Z9V A;  2W7I A;  3W1J A;  1QJ5 A;  4IX8 A;  5EUE A;  3VOM A;  2W7G A;  4OT8 A;  3PIU A;  2QLR A;  1LW4 A;  3CBF A;  3JWA A;  4JE5 A;  3WX9 A;  1W23 A;  1O62 A;  1ASA A;  4WLH A;  3WZF A;  4BA4 A;  4PFN A;  1H0C A;  1M32 A;  1ASE A;  1ARI A;  2YRI A;  3FDD A;  3AEM A;  4HVK A;  3NYU A;  1ARH A;  1LS3 A;  3WGC A;  4RAE A;  3EUC A;  2HP1 A;  2ZP7 A;  3TQX A;  1E5F A;  2Q7W A;  3WLX A;  4IY7 A;  1KL2 A;  2VMR A;  3HQT A;  4AO4 A;  2HUU A;  3DC1 A;  1FG3 A;  3RUY A;  3B46 A;  2RFV A;  4F5H A;  3ELP A;  3GR9 A;  1B8G A;  1XI9 A;  1TOJ A;  4ZLV A;  2QMA A;  1ASD A;  2X8U A;  2W8W A;  3DRD A;  1YIY A;  3MAF A;  5K8B A;  3A9Y A;  3B8X A;  4XAU A;  3HT4 A;  3QBO A;  5M4D A;  2ZSM A;  1JF9 A;  4A0G A;  1G4V A;  3FVS A;  3KGW A;  4HF8 A;  9AAT A;  2YKV A;  2X3L A;  1SZU A;  3EI5 A;  2X5F A;  4ADB A;  1BJO A;  2OKJ A;  2VGV A;  3HDO A;  3BWO A;  4JEV A;  4K2M A;  3QI6 A;  2Z1Z A;  1GC2 A;  2AEU A;  2G6W A;  4O6Z A;  3ASA A;  2FYF A;  3KKI A;  4RM1 A;  1AJS B;  1MDX A;  1WYU B;  4WLJ A;  2CTZ A;  5F8V A;  5JAY A;  2HOY A;  1CL2 A;  1V72 A;  2PB2 A;  4XJP A;  3HVY A;  3ZZJ A;  3QGU A;  2EO5 A;  4OCA A;  3GZD A;  3W1I A;  4AOA A;  2Z9W A;  1ZC9 A;  1Z7D A;  3QN6 A;  5EFS A;  3RCH A;  1AHE A;  2AY4 A;  3R4T A;  4P7Y A;  4PFF A;  3ZRQ A;  1GCK A;  4MQQ A;  1AY8 A;  3RBL A;  3AEM C;  4RJ0 A;  4A0F A;  3OP7 A;  2VMN A;  2KFP A;  2AY6 A;  5EIG B;  4F5I A;  2W7J A;  3PGY A;  5DJ1 A;  4ZDP A;  4RJY A;  1TOG A;  1UU1 A;  4W1W A;  4ZSY A;  3FZ6 A;  2FQ6 A;  3G0T A;  2D65 A;  4LNL A;  3I16 A;  4JE5 D;  3GJU A;  4J5U A;  2YKU A;  4NOG A;  1MLZ A;  2VIA A;  1UU0 A;  1KMJ A;  3PDX A;  4K2B A;  3ACZ A;  3DXV A;  3PD6 B;  1ARS A;  5FT6 A;  4DQ6 A;  3DYD A;  4TV7 A;  3AEJ C;  1W3U A;  3BS8 A;  4A6R A;  2WK8 A;  4OMA A;  3NTJ A;  2VMY A;  1ECX A;  3N7N A;  1IX8 A;  1RVY A;  2VMZ A;  4ATP A;  4XJM A;  1TOK A;  4EFF A;  1AHX A;  1O61 A;  3NDN A;  3HMU A;  4IYO B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...