2AYKA

Inhibitor-free catalytic fragment of human fibroblast collagenase, nmr, minimized average structure
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
157
structure length
157
Chain Sequence
b'PRWEQTHLTYRIENYTPDLPRADVDHAIEKAFQLWSNVTPLTFTKVSEGQADIMISFVRGDHRDNSPFDGPGGNLAHAFQPGPGIGGDAHFDEDERWTNNFREYNLHRVAAHELGHSLGLSHSTDIGALMYPSYTFSGDVQLAQDDIDGIQAIYGRS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COLLAGENASE
publication title High-resolution solution structure of the inhibitor-free catalytic fragment of human fibroblast collagenase determined by multidimensional NMR.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metalloprotease
total genus 29
structure length 157
sequence length 157
ec nomenclature ec 3.4.24.7: Interstitial collagenase.
pdb deposition date 1997-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 2aykA00
2W13A 2N8RA 4WKEA 4CTHA 2JT6A 4J4MA 1D8FA 2O3EA 1PWWA 4FVLA 4GWNA 5D1SA 4JQGA 2CKIA 3VTGA 4AUOA 1D7XA 3LK8A 3V96B 3KEJA 1KUFA 3LQ0A 4GR0A 1QIAA 5CUHA 2Y6CA 4WZVA 4L63A 3DSLA 1BKCE 3HY9A 3AYUA 5BOYA 5JMYA 3B8ZA 1BUVM 4FU4A 2POJA 4GR8A 2PJTA 1HOVA 2HU6A 3HYGA 1K7GA 4H84A 1A86A 4H3XA 1ZXVA 1AYKA 3F16A 2AIGP 1BM6A 4PKVA 1MMQA 3VI1A 1QUAA 1HV5A 3EHYA 4IUWA 2J0TA 3HDBA 5I2ZA 1BUDA 5I0LA 2V4BA 1ZXCA 1GKCA 1G4KA 2OI0A 1Z3JA 4GWMA 2E3XA 1WNIA 3TSKA 4ON1A 2Z2DA 3HY7A 3ZXHA 1CGEA 5D7WA 5B5OA 2OVXA 1JAOA 1PWPA 1UTZA 1Y0VA 5I12A 1MNCA 1JK3A 2MLSA 1CAQA 2JSDA 3OHLA 1QICA 3USNA 2Y6DA 1IABA 1MMPA 1JANA 3F15A 1UEAA 1MMRA 1CXVA 2OXWA 1SLMA 2AYKA 3AYKA 2OXZA 4I35A 1GE6A 2ERPA 4ILWD 1OS2A 1ROSA 1KUKA 2W12A 2X7MA 4JIJA 3O64A 4PKTA 3LUMA 3ZUKA 2OVZA 1R54A 2TCLA 3K7NA 2J83A 3LJZA 4G9LA 1R55A 1BQOA 2K9CA 4JPAA 3TVCA 3TT4A 3U1RA 2MLRA 5D2BA 3E8RA 1J7NA 3DNGA 3GBOA 3O2XA 2A8HA 3B2ZA 1JIZA 3I7IA 1EAKA 2DDYA 2MZEA 3EHXA 1CIZA 1YCMA 4PKUA 5H8XA 3LUNA 1IACA 1XFVA 4GF1A 1SATA 1JH1A 4H82A 1HFSA 1FLSA 3LE9A 4GR3A 1BSWA 1IAAA 3KMCA 3CKIA 4GQLA 2EROA 1DTHA 4H2EA 4DV8A 3F18A 4JA1A 1OO9A 4DPEA 4AYKA 1QJIA 4PKQA 1ND1A 2SRTA 5I43A 1QIBA 2DW2A 3HBUP 3HBVP 1UMSA 1YP1A 1OM8A 1ZTQA 2YB9A 3L0TA 1IAEA 1GXDA 4JP4A 1BZSA 1JKYA 3DPFA 1YQYA 2X3AA 4H76A 1MMBA 1EUBA 1UTTA 5B5PA 4I03A 1DMTA 4PKSA 1B8YA 3DPEA 1KBCA 2W0DA 1AKLA 2I47A 1GKDA 2WO9A 1R1IA 3SHIA 2OW2A 1PWQA 3AIGA 1G49A 4IJOA 4PKWA 3EDGA 3RTSA 3HDAP 1XURA 4XM8A 1Q3AA 1ATLA 3LMCA 5BOTA 3KECA 1RMZA 1SLNA 1HTDA 3LIRA 4R3VA 1I1IP 1O0QA 1D5JA 4DD8A 1KUIA 1FM1A 3ZVSA 1ZVXA 2JT5A 1HY7A 4H30A 1UMTA 3WV3A 3MA2A 1KAPP 2OXUA 2OY2A 4WF6A 1IADA 1G05A 2W15A 5LABA 1BKCI 2DDFA 2RJPA 4AIGA 1R1HA 4ZR5A 4A3WA 2FV9A 456CA 4EFSA 1K7IA 3LKAA 1SU3A 1OS9A 2ERQA 4L19A 4DF9A 2YIGA 3EDIA 4PKRA 1PWUA 3DL1A 3LGPA 3OHOA 2L0RA 3F1AA 2W14A 3G42A 2XS4A 1GO7P 3Q2GA 1Y93A 2USNA 4FXQA 1I76A 3DWBA 1I73A 4GUYA 2O36A 3RTTA 3N2UA 5I4OA 4FXYP 3P24A 1XFZA 5L79A 1K7QA 2KRJA 1GE7A 1EB6A 3ELMA 2JNPA 1HFCA 1Y8JA 4XBHA 3LIKA 3KRYA 2WO8A 3K7LA 1YOUA 2OY4A 3I7GA 1SMPA 1KUHA 5D1UA 1PWVA 2X3BA 3KHIA 3N2VA 4QKZA 3EWJA 3UVCA 1USNA 1BQQM 2RJQA 1O0TA 4XM6A 4IN9A 1JAQA 1G12A 2D1OA 1CGFA 1L6JA 3L0VA 5CZMA 1ZP5A 1BIWA 1OMJA 1ZS0A 1XFWA 2QPJA 1AF0A 2XS3A 1H71P 1BKCA 1XUCA 1ASTA 1CK7A 1JIWP 1OM6A 3LJGA 4HMAA 1JJ9A 4Q1LA 830CA 3F17A 4H1QA 3P1VA 1XFYA 4WKIA 1KUGA 2JIHA 5BPAA 3BA0A 3F19A 1D8MA 2K2GA 1SRPA 2DW1A 1GO8P 5CXAA 1S4BP 966CA 5I3MA 3LJTA 1C7KA 4A7BA 3HB2P 4WK7A 4XCTA 5D1TA 3TS4A 2E2DA 1CGLA 2CLTA 3KEKA 4XM7A 3EDHA 1A85A 1XUDA 2DW0A 5D3CA 1IAGA 3LEAA 3LILA 3KWVC 3WV1A 2WOAA 3B92A 4L6TA 1RM8A 1QJJA 2X3CA 2FV5A 2OW0A 4AXQA 1C8TA 1OM7A 1R1JA 2OW9A 2MZHA 2MZIA 5L7FA 1FBLA 1JAPA 3Q2HA 3WV2A 1XFXA 3G5CA 3EDZA 1XFUA 1C3IA 4G0DA 3KMEA 2D1NA 2OW1A 1B3DA 4H49A 1CQRA 4HX3A 2OZRA 3LQBA 1G9KA 1GE5A 3NX7A
chains in the Genus database with same CATH superfamily
2W13A 2N8RA 4WKEA 4CTHA 2JT6A 4J4MA 1D8FA 2O3EA 1PWWA 4FVLA 4GWNA 5D1SA 4JQGA 2CKIA 3VTGA 4AUOA 1D7XA 3LK8A 3V96B 3KEJA 1KUFA 3LQ0A 4GR0A 1QIAA 5CUHA 2Y6CA 4WZVA 4L63A 3DSLA 1BKCE 3HY9A 3AYUA 5BOYA 5JMYA 3B8ZA 1BUVM 4FU4A 2POJA 4GR8A 2PJTA 1HOVA 2HU6A 3HYGA 1K7GA 4H84A 1A86A 4H3XA 1ZXVA 1AYKA 3F16A 2AIGP 1BM6A 4PKVA 1MMQA 3VI1A 1QUAA 1HV5A 3EHYA 4IUWA 2J0TA 3HDBA 5I2ZA 1BUDA 5I0LA 2V4BA 1ZXCA 3DTEA 1GKCA 1G4KA 2OI0A 1Z3JA 4GWMA 2E3XA 1WNIA 3TSKA 4ON1A 2Z2DA 3HY7A 3ZXHA 1CGEA 5D7WA 5B5OA 2OVXA 1JAOA 1PWPA 1UTZA 1Y0VA 5I12A 1MNCA 1JK3A 2MLSA 1CAQA 2JSDA 3OHLA 1QICA 3USNA 2Y6DA 1IABA 1MMPA 1JANA 3F15A 1UEAA 1MMRA 1CXVA 2OXWA 1SLMA 2AYKA 3AYKA 2OXZA 4I35A 1GE6A 2ERPA 4ILWD 1OS2A 1ROSA 1KUKA 2W12A 2X7MA 4JIJA 3O64A 4PKTA 3LUMA 3ZUKA 2OVZA 2YUFA 1R54A 2TCLA 3K7NA 2J83A 3LJZA 4G9LA 1R55A 1BQOA 2K9CA 4JPAA 3TVCA 3TT4A 3U1RA 2MLRA 5D2BA 3E8RA 1J7NA 3DNGA 3GBOA 3O2XA 2A8HA 3B2ZA 1JIZA 3I7IA 1EAKA 2DDYA 2MZEA 3EHXA 1CIZA 1YCMA 4PKUA 5H8XA 3LUNA 1IACA 1XFVA 4GF1A 1SATA 1JH1A 4H82A 1HFSA 1FLSA 3DTIA 3LE9A 4GR3A 1BSWA 1IAAA 3KMCA 3CKIA 4GQLA 2EROA 1DTHA 4H2EA 4DV8A 3F18A 4JA1A 1OO9A 4DPEA 4AYKA 1QJIA 4PKQA 1ND1A 2SRTA 5I43A 1QIBA 2DW2A 3HBUP 3HBVP 1UMSA 1YP1A 1OM8A 1ZTQA 2YB9A 1XAXA 3L0TA 1IAEA 1GXDA 4JP4A 1BZSA 1JKYA 3DPFA 1YQYA 2X3AA 4H76A 1MMBA 1EUBA 1UTTA 5B5PA 4I03A 1DMTA 4PKSA 1B8YA 3DPEA 1KBCA 2W0DA 1AKLA 2I47A 1GKDA 2WO9A 1R1IA 3SHIA 2OW2A 1PWQA 4L7AA 3AIGA 1G49A 4IJOA 4PKWA 3EDGA 3RTSA 1XM5A 3HDAP 1XURA 4XM8A 1Q3AA 1ATLA 3LMCA 5BOTA 3KECA 1RMZA 1SLNA 1HTDA 3LIRA 4R3VA 1I1IP 1O0QA 1D5JA 4DD8A 1KUIA 1FM1A 3ZVSA 1ZVXA 2JT5A 1HY7A 4H30A 1UMTA 3WV3A 3MA2A 1KAPP 2OXUA 2OY2A 4WF6A 1IADA 1G05A 2W15A 5LABA 1BKCI 2DDFA 2RJPA 4AIGA 1R1HA 4ZR5A 4A3WA 2FV9A 456CA 4EFSA 1K7IA 3LKAA 1SU3A 1OS9A 2ERQA 4L19A 4DF9A 2YIGA 3EDIA 4PKRA 1PWUA 3DL1A 3LGPA 3OHOA 2L0RA 3F1AA 2W14A 3G42A 2XS4A 3DTKA 1GO7P 3Q2GA 1Y93A 2USNA 4FXQA 1I76A 3DWBA 1I73A 4GUYA 2O36A 3RTTA 3N2UA 5I4OA 4FXYP 3P24A 1XFZA 5L79A 1K7QA 2KRJA 1GE7A 1EB6A 3ELMA 2JNPA 1HFCA 1Y8JA 4XBHA 3LIKA 3KRYA 2WO8A 3K7LA 1YOUA 2OY4A 3I7GA 1SMPA 1KUHA 5D1UA 1PWVA 2X3BA 3KHIA 3N2VA 4QKZA 3EWJA 3UVCA 1USNA 1BQQM 2RJQA 1O0TA 4XM6A 4IN9A 1JAQA 1G12A 2D1OA 1CGFA 1L6JA 3L0VA 5CZMA 1ZP5A 1BIWA 1OMJA 1ZS0A 1XFWA 2QPJA 1AF0A 2XS3A 1H71P 1BKCA 1XUCA 1ASTA 1CK7A 1JIWP 1OM6A 3LJGA 4HMAA 1JJ9A 4Q1LA 830CA 3F17A 4H1QA 3P1VA 1OZ9A 1XFYA 4WKIA 1KUGA 2JIHA 5BPAA 3BA0A 3F19A 1D8MA 2K2GA 1SRPA 2DW1A 1GO8P 5CXAA 1S4BP 966CA 5I3MA 3LJTA 1C7KA 4A7BA 3HB2P 4WK7A 4XCTA 5D1TA 3TS4A 2E2DA 1CGLA 2CLTA 3KEKA 4XM7A 3EDHA 1A85A 1XUDA 2DW0A 5D3CA 1IAGA 3LEAA 3LILA 3KWVC 3WV1A 2WOAA 3B92A 4L6TA 1RM8A 1QJJA 2X3CA 2FV5A 2OW0A 4AXQA 1C8TA 1OM7A 1R1JA 2OW9A 2MZHA 2MZIA 5L7FA 1FBLA 1JAPA 3Q2HA 3WV2A 1XFXA 3G5CA 3EDZA 1XFUA 1C3IA 4G0DA 3KMEA 2D1NA 1TVIA 2OW1A 1B3DA 4H49A 1CQRA 4HX3A 2OZRA 3LQBA 1G9KA 1GE5A 3NX7A
chains in the Genus database with same CATH topology
2W13A 2N8RA 4WKEA 4CTHA 2JT6A 4J4MA 1D8FA 2O3EA 1PWWA 4FVLA 4GWNA 5D1SA 4JQGA 2CKIA 3VTGA 4AUOA 1D7XA 3LK8A 3V96B 3KEJA 1KUFA 3LQ0A 4GR0A 1QIAA 5CUHA 2Y6CA 4WZVA 4L63A 3DSLA 1BKCE 3HY9A 3AYUA 5BOYA 5JMYA 3B8ZA 1BUVM 4FU4A 2POJA 4GR8A 2PJTA 1HOVA 2HU6A 3HYGA 1K7GA 4H84A 1A86A 4H3XA 1ZXVA 1AYKA 3F16A 2AIGP 1BM6A 4PKVA 1MMQA 3VI1A 1QUAA 1HV5A 3EHYA 4IUWA 2J0TA 3HDBA 5I2ZA 1BUDA 5I0LA 2V4BA 1ZXCA 3DTEA 1GKCA 1G4KA 2OI0A 1Z3JA 4GWMA 2E3XA 1WNIA 3TSKA 4ON1A 2Z2DA 3HY7A 3ZXHA 1CGEA 5D7WA 5B5OA 2OVXA 1JAOA 1PWPA 1UTZA 1Y0VA 5I12A 1MNCA 1JK3A 2MLSA 1CAQA 2JSDA 3OHLA 1QICA 3USNA 2Y6DA 1IABA 1MMPA 1JANA 3F15A 1UEAA 1MMRA 1CXVA 2OXWA 1SLMA 2AYKA 3AYKA 2OXZA 4I35A 1GE6A 2ERPA 4ILWD 1OS2A 1ROSA 1KUKA 2W12A 2X7MA 4JIJA 3O64A 4PKTA 3LUMA 3ZUKA 2OVZA 2YUFA 1R54A 2TCLA 3K7NA 2J83A 3LJZA 4G9LA 1R55A 1BQOA 2K9CA 4JPAA 3TVCA 3TT4A 3U1RA 2MLRA 5D2BA 3E8RA 1J7NA 3DNGA 3GBOA 3O2XA 2A8HA 3B2ZA 1JIZA 3I7IA 1EAKA 2DDYA 2MZEA 3EHXA 1CIZA 1YCMA 4PKUA 5H8XA 3LUNA 1IACA 1XFVA 4GF1A 1SATA 1JH1A 4H82A 1HFSA 1FLSA 3DTIA 3LE9A 4GR3A 1BSWA 1IAAA 3KMCA 3CKIA 4GQLA 2EROA 1DTHA 4H2EA 4DV8A 3F18A 4JA1A 1OO9A 4DPEA 4AYKA 1QJIA 4PKQA 1ND1A 2SRTA 5I43A 1QIBA 2DW2A 3HBUP 3HBVP 1UMSA 1YP1A 1OM8A 1ZTQA 2YB9A 3L0TA 1IAEA 1GXDA 4JP4A 1BZSA 1JKYA 3DPFA 1YQYA 2X3AA 4H76A 1MMBA 1EUBA 1UTTA 5B5PA 4I03A 1DMTA 4PKSA 1B8YA 3DPEA 1KBCA 2W0DA 1AKLA 2I47A 1GKDA 2WO9A 1R1IA 3SHIA 2OW2A 1PWQA 4L7AA 3AIGA 1G49A 4IJOA 4PKWA 3EDGA 3RTSA 3HDAP 1XURA 4XM8A 1Q3AA 1ATLA 3LMCA 5BOTA 3KECA 1RMZA 1SLNA 1HTDA 3LIRA 4R3VA 1I1IP 1O0QA 1D5JA 4DD8A 1KUIA 1FM1A 3ZVSA 1ZVXA 2JT5A 1HY7A 4H30A 1UMTA 3WV3A 3MA2A 1KAPP 2OXUA 2OY2A 4WF6A 1IADA 1G05A 2W15A 5LABA 1BKCI 2DDFA 2RJPA 4AIGA 1R1HA 4ZR5A 4A3WA 2FV9A 456CA 4EFSA 1K7IA 3LKAA 1SU3A 1OS9A 2ERQA 4L19A 4DF9A 2YIGA 3EDIA 4PKRA 1PWUA 3DL1A 3LGPA 3OHOA 2L0RA 3F1AA 2W14A 3G42A 2XS4A 3DTKA 1GO7P 3Q2GA 1Y93A 2USNA 4FXQA 1I76A 3DWBA 1I73A 4GUYA 2O36A 3RTTA 3N2UA 5I4OA 4FXYP 3P24A 1XFZA 5L79A 1K7QA 2KRJA 1GE7A 1EB6A 3ELMA 2JNPA 1HFCA 1Y8JA 4XBHA 3LIKA 3KRYA 2WO8A 3K7LA 1YOUA 2OY4A 3I7GA 1SMPA 1KUHA 5D1UA 1PWVA 2X3BA 3KHIA 3N2VA 4QKZA 3EWJA 3UVCA 1USNA 1BQQM 2RJQA 1O0TA 4XM6A 4IN9A 1JAQA 1G12A 2D1OA 1CGFA 1L6JA 3L0VA 5CZMA 1ZP5A 1BIWA 1OMJA 1ZS0A 1XFWA 2QPJA 1AF0A 2XS3A 1H71P 1BKCA 1XUCA 1ASTA 1CK7A 1JIWP 1OM6A 3LJGA 4HMAA 1JJ9A 4Q1LA 830CA 3F17A 4H1QA 3P1VA 1XFYA 4WKIA 1KUGA 2JIHA 5BPAA 3BA0A 3F19A 1D8MA 2K2GA 1SRPA 2DW1A 1GO8P 5CXAA 1S4BP 966CA 5I3MA 3LJTA 1C7KA 4A7BA 3HB2P 4WK7A 4XCTA 5D1TA 3TS4A 2E2DA 1CGLA 2CLTA 3KEKA 4XM7A 3EDHA 1A85A 1XUDA 2DW0A 5D3CA 1IAGA 3LEAA 3LILA 3KWVC 3WV1A 2WOAA 3B92A 4L6TA 1RM8A 1QJJA 2X3CA 2FV5A 2OW0A 4AXQA 1C8TA 1OM7A 1R1JA 2OW9A 2MZHA 2MZIA 5L7FA 1FBLA 1JAPA 3Q2HA 3WV2A 1XFXA 3G5CA 3EDZA 1XFUA 1C3IA 4G0DA 3KMEA 2D1NA 2OW1A 1B3DA 4H49A 1CQRA 4HX3A 2OZRA 3LQBA 1G9KA 1GE5A 3NX7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W13 A;  2N8R A;  4WKE A;  4CTH A;  2JT6 A;  4J4M A;  1D8F A;  2O3E A;  1PWW A;  4FVL A;  4GWN A;  5D1S A;  4JQG A;  2CKI A;  3VTG A;  4AUO A;  1D7X A;  3LK8 A;  3V96 B;  3KEJ A;  1KUF A;  3LQ0 A;  4GR0 A;  1QIA A;  5CUH A;  2Y6C A;  4WZV A;  4L63 A;  3DSL A;  1BKC E;  3HY9 A;  3AYU A;  5BOY A;  5JMY A;  3B8Z A;  1BUV M;  4FU4 A;  2POJ A;  4GR8 A;  2PJT A;  1HOV A;  2HU6 A;  3HYG A;  1K7G A;  4H84 A;  1A86 A;  4H3X A;  1ZXV A;  1AYK A;  3F16 A;  2AIG P;  1BM6 A;  4PKV A;  1MMQ A;  3VI1 A;  1QUA A;  1HV5 A;  3EHY A;  4IUW A;  2J0T A;  3HDB A;  5I2Z A;  1BUD A;  5I0L A;  2V4B A;  1ZXC A;  1GKC A;  1G4K A;  2OI0 A;  1Z3J A;  4GWM A;  2E3X A;  1WNI A;  3TSK A;  4ON1 A;  2Z2D A;  3HY7 A;  3ZXH A;  1CGE A;  5D7W A;  5B5O A;  2OVX A;  1JAO A;  1PWP A;  1UTZ A;  1Y0V A;  5I12 A;  1MNC A;  1JK3 A;  2MLS A;  1CAQ A;  2JSD A;  3OHL A;  1QIC A;  3USN A;  2Y6D A;  1IAB A;  1MMP A;  1JAN A;  3F15 A;  1UEA A;  1MMR A;  1CXV A;  2OXW A;  1SLM A;  2AYK A;  3AYK A;  2OXZ A;  4I35 A;  1GE6 A;  2ERP A;  4ILW D;  1OS2 A;  1ROS A;  1KUK A;  2W12 A;  2X7M A;  4JIJ A;  3O64 A;  4PKT A;  3LUM A;  3ZUK A;  2OVZ A;  1R54 A;  2TCL A;  3K7N A;  2J83 A;  3LJZ A;  4G9L A;  1R55 A;  1BQO A;  2K9C A;  4JPA A;  3TVC A;  3TT4 A;  3U1R A;  2MLR A;  5D2B A;  3E8R A;  1J7N A;  3DNG A;  3GBO A;  3O2X A;  2A8H A;  3B2Z A;  1JIZ A;  3I7I A;  1EAK A;  2DDY A;  2MZE A;  3EHX A;  1CIZ A;  1YCM A;  4PKU A;  5H8X A;  3LUN A;  1IAC A;  1XFV A;  4GF1 A;  1SAT A;  1JH1 A;  4H82 A;  1HFS A;  1FLS A;  3LE9 A;  4GR3 A;  1BSW A;  1IAA A;  3KMC A;  3CKI A;  4GQL A;  2ERO A;  1DTH A;  4H2E A;  4DV8 A;  3F18 A;  4JA1 A;  1OO9 A;  4DPE A;  4AYK A;  1QJI A;  4PKQ A;  1ND1 A;  2SRT A;  5I43 A;  1QIB A;  2DW2 A;  3HBU P;  3HBV P;  1UMS A;  1YP1 A;  1OM8 A;  1ZTQ A;  2YB9 A;  3L0T A;  1IAE A;  1GXD A;  4JP4 A;  1BZS A;  1JKY A;  3DPF A;  1YQY A;  2X3A A;  4H76 A;  1MMB A;  1EUB A;  1UTT A;  5B5P A;  4I03 A;  1DMT A;  4PKS A;  1B8Y A;  3DPE A;  1KBC A;  2W0D A;  1AKL A;  2I47 A;  1GKD A;  2WO9 A;  1R1I A;  3SHI A;  2OW2 A;  1PWQ A;  3AIG A;  1G49 A;  4IJO A;  4PKW A;  3EDG A;  3RTS A;  3HDA P;  1XUR A;  4XM8 A;  1Q3A A;  1ATL A;  3LMC A;  5BOT A;  3KEC A;  1RMZ A;  1SLN A;  1HTD A;  3LIR A;  4R3V A;  1I1I P;  1O0Q A;  1D5J A;  4DD8 A;  1KUI A;  1FM1 A;  3ZVS A;  1ZVX A;  2JT5 A;  1HY7 A;  4H30 A;  1UMT A;  3WV3 A;  3MA2 A;  1KAP P;  2OXU A;  2OY2 A;  4WF6 A;  1IAD A;  1G05 A;  2W15 A;  5LAB A;  1BKC I;  2DDF A;  2RJP A;  4AIG A;  1R1H A;  4ZR5 A;  4A3W A;  2FV9 A;  456C A;  4EFS A;  1K7I A;  3LKA A;  1SU3 A;  1OS9 A;  2ERQ A;  4L19 A;  4DF9 A;  2YIG A;  3EDI A;  4PKR A;  1PWU A;  3DL1 A;  3LGP A;  3OHO A;  2L0R A;  3F1A A;  2W14 A;  3G42 A;  2XS4 A;  1GO7 P;  3Q2G A;  1Y93 A;  2USN A;  4FXQ A;  1I76 A;  3DWB A;  1I73 A;  4GUY A;  2O36 A;  3RTT A;  3N2U A;  5I4O A;  4FXY P;  3P24 A;  1XFZ A;  5L79 A;  1K7Q A;  2KRJ A;  1GE7 A;  1EB6 A;  3ELM A;  2JNP A;  1HFC A;  1Y8J A;  4XBH A;  3LIK A;  3KRY A;  2WO8 A;  3K7L A;  1YOU A;  2OY4 A;  3I7G A;  1SMP A;  1KUH A;  5D1U A;  1PWV A;  2X3B A;  3KHI A;  3N2V A;  4QKZ A;  3EWJ A;  3UVC A;  1USN A;  1BQQ M;  2RJQ A;  1O0T A;  4XM6 A;  4IN9 A;  1JAQ A;  1G12 A;  2D1O A;  1CGF A;  1L6J A;  3L0V A;  5CZM A;  1ZP5 A;  1BIW A;  1OMJ A;  1ZS0 A;  1XFW A;  2QPJ A;  1AF0 A;  2XS3 A;  1H71 P;  1BKC A;  1XUC A;  1AST A;  1CK7 A;  1JIW P;  1OM6 A;  3LJG A;  4HMA A;  1JJ9 A;  4Q1L A;  830C A;  3F17 A;  4H1Q A;  3P1V A;  1XFY A;  4WKI A;  1KUG A;  2JIH A;  5BPA A;  3BA0 A;  3F19 A;  1D8M A;  2K2G A;  1SRP A;  2DW1 A;  1GO8 P;  5CXA A;  1S4B P;  966C A;  5I3M A;  3LJT A;  1C7K A;  4A7B A;  3HB2 P;  4WK7 A;  4XCT A;  5D1T A;  3TS4 A;  2E2D A;  1CGL A;  2CLT A;  3KEK A;  4XM7 A;  3EDH A;  1A85 A;  1XUD A;  2DW0 A;  5D3C A;  1IAG A;  3LEA A;  3LIL A;  3KWV C;  3WV1 A;  2WOA A;  3B92 A;  4L6T A;  1RM8 A;  1QJJ A;  2X3C A;  2FV5 A;  2OW0 A;  4AXQ A;  1C8T A;  1OM7 A;  1R1J A;  2OW9 A;  2MZH A;  2MZI A;  5L7F A;  1FBL A;  1JAP A;  3Q2H A;  3WV2 A;  1XFX A;  3G5C A;  3EDZ A;  1XFU A;  1C3I A;  4G0D A;  3KME A;  2D1N A;  2OW1 A;  1B3D A;  4H49 A;  1CQR A;  4HX3 A;  2OZR A;  3LQB A;  1G9K A;  1GE5 A;  3NX7 A; 
#chains in the Genus database with same CATH topology
 2W13 A;  2N8R A;  4WKE A;  4CTH A;  2JT6 A;  4J4M A;  1D8F A;  2O3E A;  1PWW A;  4FVL A;  4GWN A;  5D1S A;  4JQG A;  2CKI A;  3VTG A;  4AUO A;  1D7X A;  3LK8 A;  3V96 B;  3KEJ A;  1KUF A;  3LQ0 A;  4GR0 A;  1QIA A;  5CUH A;  2Y6C A;  4WZV A;  4L63 A;  3DSL A;  1BKC E;  3HY9 A;  3AYU A;  5BOY A;  5JMY A;  3B8Z A;  1BUV M;  4FU4 A;  2POJ A;  4GR8 A;  2PJT A;  1HOV A;  2HU6 A;  3HYG A;  1K7G A;  4H84 A;  1A86 A;  4H3X A;  1ZXV A;  1AYK A;  3F16 A;  2AIG P;  1BM6 A;  4PKV A;  1MMQ A;  3VI1 A;  1QUA A;  1HV5 A;  3EHY A;  4IUW A;  2J0T A;  3HDB A;  5I2Z A;  1BUD A;  5I0L A;  2V4B A;  1ZXC A;  3DTE A;  1GKC A;  1G4K A;  2OI0 A;  1Z3J A;  4GWM A;  2E3X A;  1WNI A;  3TSK A;  4ON1 A;  2Z2D A;  3HY7 A;  3ZXH A;  1CGE A;  5D7W A;  5B5O A;  2OVX A;  1JAO A;  1PWP A;  1UTZ A;  1Y0V A;  5I12 A;  1MNC A;  1JK3 A;  2MLS A;  1CAQ A;  2JSD A;  3OHL A;  1QIC A;  3USN A;  2Y6D A;  1IAB A;  1MMP A;  1JAN A;  3F15 A;  1UEA A;  1MMR A;  1CXV A;  2OXW A;  1SLM A;  2AYK A;  3AYK A;  2OXZ A;  4I35 A;  1GE6 A;  2ERP A;  4ILW D;  1OS2 A;  1ROS A;  1KUK A;  2W12 A;  2X7M A;  4JIJ A;  3O64 A;  4PKT A;  3LUM A;  3ZUK A;  2OVZ A;  2YUF A;  1R54 A;  2TCL A;  3K7N A;  2J83 A;  3LJZ A;  4G9L A;  1R55 A;  1BQO A;  2K9C A;  4JPA A;  3TVC A;  3TT4 A;  3U1R A;  2MLR A;  5D2B A;  3E8R A;  1J7N A;  3DNG A;  3GBO A;  3O2X A;  2A8H A;  3B2Z A;  1JIZ A;  3I7I A;  1EAK A;  2DDY A;  2MZE A;  3EHX A;  1CIZ A;  1YCM A;  4PKU A;  5H8X A;  3LUN A;  1IAC A;  1XFV A;  4GF1 A;  1SAT A;  1JH1 A;  4H82 A;  1HFS A;  1FLS A;  3DTI A;  3LE9 A;  4GR3 A;  1BSW A;  1IAA A;  3KMC A;  3CKI A;  4GQL A;  2ERO A;  1DTH A;  4H2E A;  4DV8 A;  3F18 A;  4JA1 A;  1OO9 A;  4DPE A;  4AYK A;  1QJI A;  4PKQ A;  1ND1 A;  2SRT A;  5I43 A;  1QIB A;  2DW2 A;  3HBU P;  3HBV P;  1UMS A;  1YP1 A;  1OM8 A;  1ZTQ A;  2YB9 A;  1XAX A;  3L0T A;  1IAE A;  1GXD A;  4JP4 A;  1BZS A;  1JKY A;  3DPF A;  1YQY A;  2X3A A;  4H76 A;  1MMB A;  1EUB A;  1UTT A;  5B5P A;  4I03 A;  1DMT A;  4PKS A;  1B8Y A;  3DPE A;  1KBC A;  2W0D A;  1AKL A;  2I47 A;  1GKD A;  2WO9 A;  1R1I A;  3SHI A;  2OW2 A;  1PWQ A;  4L7A A;  3AIG A;  1G49 A;  4IJO A;  4PKW A;  3EDG A;  3RTS A;  1XM5 A;  3HDA P;  1XUR A;  4XM8 A;  1Q3A A;  1ATL A;  3LMC A;  5BOT A;  3KEC A;  1RMZ A;  1SLN A;  1HTD A;  3LIR A;  4R3V A;  1I1I P;  1O0Q A;  1D5J A;  4DD8 A;  1KUI A;  1FM1 A;  3ZVS A;  1ZVX A;  2JT5 A;  1HY7 A;  4H30 A;  1UMT A;  3WV3 A;  3MA2 A;  1KAP P;  2OXU A;  2OY2 A;  4WF6 A;  1IAD A;  1G05 A;  2W15 A;  5LAB A;  1BKC I;  2DDF A;  2RJP A;  4AIG A;  1R1H A;  4ZR5 A;  4A3W A;  2FV9 A;  456C A;  4EFS A;  1K7I A;  3LKA A;  1SU3 A;  1OS9 A;  2ERQ A;  4L19 A;  4DF9 A;  2YIG A;  3EDI A;  4PKR A;  1PWU A;  3DL1 A;  3LGP A;  3OHO A;  2L0R A;  3F1A A;  2W14 A;  3G42 A;  2XS4 A;  3DTK A;  1GO7 P;  3Q2G A;  1Y93 A;  2USN A;  4FXQ A;  1I76 A;  3DWB A;  1I73 A;  4GUY A;  2O36 A;  3RTT A;  3N2U A;  5I4O A;  4FXY P;  3P24 A;  1XFZ A;  5L79 A;  1K7Q A;  2KRJ A;  1GE7 A;  1EB6 A;  3ELM A;  2JNP A;  1HFC A;  1Y8J A;  4XBH A;  3LIK A;  3KRY A;  2WO8 A;  3K7L A;  1YOU A;  2OY4 A;  3I7G A;  1SMP A;  1KUH A;  5D1U A;  1PWV A;  2X3B A;  3KHI A;  3N2V A;  4QKZ A;  3EWJ A;  3UVC A;  1USN A;  1BQQ M;  2RJQ A;  1O0T A;  4XM6 A;  4IN9 A;  1JAQ A;  1G12 A;  2D1O A;  1CGF A;  1L6J A;  3L0V A;  5CZM A;  1ZP5 A;  1BIW A;  1OMJ A;  1ZS0 A;  1XFW A;  2QPJ A;  1AF0 A;  2XS3 A;  1H71 P;  1BKC A;  1XUC A;  1AST A;  1CK7 A;  1JIW P;  1OM6 A;  3LJG A;  4HMA A;  1JJ9 A;  4Q1L A;  830C A;  3F17 A;  4H1Q A;  3P1V A;  1OZ9 A;  1XFY A;  4WKI A;  1KUG A;  2JIH A;  5BPA A;  3BA0 A;  3F19 A;  1D8M A;  2K2G A;  1SRP A;  2DW1 A;  1GO8 P;  5CXA A;  1S4B P;  966C A;  5I3M A;  3LJT A;  1C7K A;  4A7B A;  3HB2 P;  4WK7 A;  4XCT A;  5D1T A;  3TS4 A;  2E2D A;  1CGL A;  2CLT A;  3KEK A;  4XM7 A;  3EDH A;  1A85 A;  1XUD A;  2DW0 A;  5D3C A;  1IAG A;  3LEA A;  3LIL A;  3KWV C;  3WV1 A;  2WOA A;  3B92 A;  4L6T A;  1RM8 A;  1QJJ A;  2X3C A;  2FV5 A;  2OW0 A;  4AXQ A;  1C8T A;  1OM7 A;  1R1J A;  2OW9 A;  2MZH A;  2MZI A;  5L7F A;  1FBL A;  1JAP A;  3Q2H A;  3WV2 A;  1XFX A;  3G5C A;  3EDZ A;  1XFU A;  1C3I A;  4G0D A;  3KME A;  2D1N A;  1TVI A;  2OW1 A;  1B3D A;  4H49 A;  1CQR A;  4HX3 A;  2OZR A;  3LQB A;  1G9K A;  1GE5 A;  3NX7 A; 
#chains in the Genus database with same CATH homology
 2W13 A;  2N8R A;  4WKE A;  4CTH A;  2JT6 A;  4J4M A;  1D8F A;  2O3E A;  1PWW A;  4FVL A;  4GWN A;  5D1S A;  4JQG A;  2CKI A;  3VTG A;  4AUO A;  1D7X A;  3LK8 A;  3V96 B;  3KEJ A;  1KUF A;  3LQ0 A;  4GR0 A;  1QIA A;  5CUH A;  2Y6C A;  4WZV A;  4L63 A;  3DSL A;  1BKC E;  3HY9 A;  3AYU A;  5BOY A;  5JMY A;  3B8Z A;  1BUV M;  4FU4 A;  2POJ A;  4GR8 A;  2PJT A;  1HOV A;  2HU6 A;  3HYG A;  1K7G A;  4H84 A;  1A86 A;  4H3X A;  1ZXV A;  1AYK A;  3F16 A;  2AIG P;  1BM6 A;  4PKV A;  1MMQ A;  3VI1 A;  1QUA A;  1HV5 A;  3EHY A;  4IUW A;  2J0T A;  3HDB A;  5I2Z A;  1BUD A;  5I0L A;  2V4B A;  1ZXC A;  3DTE A;  1GKC A;  1G4K A;  2OI0 A;  1Z3J A;  4GWM A;  2E3X A;  1WNI A;  3TSK A;  4ON1 A;  2Z2D A;  3HY7 A;  3ZXH A;  1CGE A;  5D7W A;  5B5O A;  2OVX A;  1JAO A;  1PWP A;  1UTZ A;  1Y0V A;  5I12 A;  1MNC A;  1JK3 A;  2MLS A;  1CAQ A;  2JSD A;  3OHL A;  1QIC A;  3USN A;  2Y6D A;  1IAB A;  1MMP A;  1JAN A;  3F15 A;  1UEA A;  1MMR A;  1CXV A;  2OXW A;  1SLM A;  2AYK A;  3AYK A;  2OXZ A;  4I35 A;  1GE6 A;  2ERP A;  4ILW D;  1OS2 A;  1ROS A;  1KUK A;  2W12 A;  2X7M A;  4JIJ A;  3O64 A;  4PKT A;  3LUM A;  3ZUK A;  2OVZ A;  2YUF A;  1R54 A;  2TCL A;  3K7N A;  2J83 A;  3LJZ A;  4G9L A;  1R55 A;  1BQO A;  2K9C A;  4JPA A;  3TVC A;  3TT4 A;  3U1R A;  2MLR A;  5D2B A;  3E8R A;  1J7N A;  3DNG A;  3GBO A;  3O2X A;  2A8H A;  3B2Z A;  1JIZ A;  3I7I A;  1EAK A;  2DDY A;  2MZE A;  3EHX A;  1CIZ A;  1YCM A;  4PKU A;  5H8X A;  3LUN A;  1IAC A;  1XFV A;  4GF1 A;  1SAT A;  1JH1 A;  4H82 A;  1HFS A;  1FLS A;  3DTI A;  3LE9 A;  4GR3 A;  1BSW A;  1IAA A;  3KMC A;  3CKI A;  4GQL A;  2ERO A;  1DTH A;  4H2E A;  4DV8 A;  3F18 A;  4JA1 A;  1OO9 A;  4DPE A;  4AYK A;  1QJI A;  4PKQ A;  1ND1 A;  2SRT A;  5I43 A;  1QIB A;  2DW2 A;  3HBU P;  3HBV P;  1UMS A;  1YP1 A;  1OM8 A;  1ZTQ A;  2YB9 A;  3L0T A;  1IAE A;  1GXD A;  4JP4 A;  1BZS A;  1JKY A;  3DPF A;  1YQY A;  2X3A A;  4H76 A;  1MMB A;  1EUB A;  1UTT A;  5B5P A;  4I03 A;  1DMT A;  4PKS A;  1B8Y A;  3DPE A;  1KBC A;  2W0D A;  1AKL A;  2I47 A;  1GKD A;  2WO9 A;  1R1I A;  3SHI A;  2OW2 A;  1PWQ A;  4L7A A;  3AIG A;  1G49 A;  4IJO A;  4PKW A;  3EDG A;  3RTS A;  3HDA P;  1XUR A;  4XM8 A;  1Q3A A;  1ATL A;  3LMC A;  5BOT A;  3KEC A;  1RMZ A;  1SLN A;  1HTD A;  3LIR A;  4R3V A;  1I1I P;  1O0Q A;  1D5J A;  4DD8 A;  1KUI A;  1FM1 A;  3ZVS A;  1ZVX A;  2JT5 A;  1HY7 A;  4H30 A;  1UMT A;  3WV3 A;  3MA2 A;  1KAP P;  2OXU A;  2OY2 A;  4WF6 A;  1IAD A;  1G05 A;  2W15 A;  5LAB A;  1BKC I;  2DDF A;  2RJP A;  4AIG A;  1R1H A;  4ZR5 A;  4A3W A;  2FV9 A;  456C A;  4EFS A;  1K7I A;  3LKA A;  1SU3 A;  1OS9 A;  2ERQ A;  4L19 A;  4DF9 A;  2YIG A;  3EDI A;  4PKR A;  1PWU A;  3DL1 A;  3LGP A;  3OHO A;  2L0R A;  3F1A A;  2W14 A;  3G42 A;  2XS4 A;  3DTK A;  1GO7 P;  3Q2G A;  1Y93 A;  2USN A;  4FXQ A;  1I76 A;  3DWB A;  1I73 A;  4GUY A;  2O36 A;  3RTT A;  3N2U A;  5I4O A;  4FXY P;  3P24 A;  1XFZ A;  5L79 A;  1K7Q A;  2KRJ A;  1GE7 A;  1EB6 A;  3ELM A;  2JNP A;  1HFC A;  1Y8J A;  4XBH A;  3LIK A;  3KRY A;  2WO8 A;  3K7L A;  1YOU A;  2OY4 A;  3I7G A;  1SMP A;  1KUH A;  5D1U A;  1PWV A;  2X3B A;  3KHI A;  3N2V A;  4QKZ A;  3EWJ A;  3UVC A;  1USN A;  1BQQ M;  2RJQ A;  1O0T A;  4XM6 A;  4IN9 A;  1JAQ A;  1G12 A;  2D1O A;  1CGF A;  1L6J A;  3L0V A;  5CZM A;  1ZP5 A;  1BIW A;  1OMJ A;  1ZS0 A;  1XFW A;  2QPJ A;  1AF0 A;  2XS3 A;  1H71 P;  1BKC A;  1XUC A;  1AST A;  1CK7 A;  1JIW P;  1OM6 A;  3LJG A;  4HMA A;  1JJ9 A;  4Q1L A;  830C A;  3F17 A;  4H1Q A;  3P1V A;  1XFY A;  4WKI A;  1KUG A;  2JIH A;  5BPA A;  3BA0 A;  3F19 A;  1D8M A;  2K2G A;  1SRP A;  2DW1 A;  1GO8 P;  5CXA A;  1S4B P;  966C A;  5I3M A;  3LJT A;  1C7K A;  4A7B A;  3HB2 P;  4WK7 A;  4XCT A;  5D1T A;  3TS4 A;  2E2D A;  1CGL A;  2CLT A;  3KEK A;  4XM7 A;  3EDH A;  1A85 A;  1XUD A;  2DW0 A;  5D3C A;  1IAG A;  3LEA A;  3LIL A;  3KWV C;  3WV1 A;  2WOA A;  3B92 A;  4L6T A;  1RM8 A;  1QJJ A;  2X3C A;  2FV5 A;  2OW0 A;  4AXQ A;  1C8T A;  1OM7 A;  1R1J A;  2OW9 A;  2MZH A;  2MZI A;  5L7F A;  1FBL A;  1JAP A;  3Q2H A;  3WV2 A;  1XFX A;  3G5C A;  3EDZ A;  1XFU A;  1C3I A;  4G0D A;  3KME A;  2D1N A;  2OW1 A;  1B3D A;  4H49 A;  1CQR A;  4HX3 A;  2OZR A;  3LQB A;  1G9K A;  1GE5 A;  3NX7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...