2AYMA

Solution structure of drosophila melanogaster snf rbd2
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
83
structure length
83
Chain Sequence
AQTEQPPNQILFLTNLPEETNEMMLSMLFNQFPGFKEVRLVPNRHDIAFVEFTTELQSNAAKEALQGFKITPTHAMKITFAKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution Structure of Drosophila melanogaster SNF RBD2
rcsb
source organism Drosophila melanogaster
molecule tags Rna binding protein
molecule keywords U1 small nuclear ribonucleoprotein A
total genus 23
structure length 83
sequence length 83
ec nomenclature
pdb deposition date 2005-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2aymA00
5HL7Q 2DITA 1X5OA 2K8GA 4Y00A 5GAGU 2XS2A 1IQTA 2L41A 4Y0FA 2BZ2A 1WHYA 1U1KA 2O3DA 1SJFA 4WCEQ 2MKIA 1WEZA 2KU7A 2CQ0A 2RS2A 2ADCA 4BS2A 1X4CA 1URNA 3PIOQ 3H2UB 2KXNB 2CPZA 2KXHA 3VAIA 4C4WA 1FHTA 3MUTP 2RQCA 1KOHA 2D9OA 3CMES 5IM0A 3MUMP 2HYIB 1P27B 1K8AT 2KM8B 2DNQA 2V94A 5DDRC 2CPDA 2KRRA 2NZ4A 2Q79A 2J0QD 2I2YA 2CQIA 3VALA 1VQ6S 2FC9A 1OPIA 3S8SA 2DGQA 1UAWA 1K9MT 2FPHX 2X1GA 3S7RA 1X4HA 2A3JA 3V4MA 1YJWS 2LXUA 2JX2A 3NNCA 4ZKAA 3SDEA 2RS8A 3D2WA 2XS7A 3P6YC 2DGWA 2DNYA 3TP2A 1VQKS 3NMRA 2HZCA 1YHQS 2CQCA 3Q2SC 2DIVA 1X4BA 1VQNS 1JJHA 2KG1A 2OSQA 1WG5A 2YKAA 2CQHA 4F02A 2MZRA 5D78A 2KRBA 2DHGA 2MMYA 1FT8A 4A8XA 4C0OC 5CA5A 2DO0A 4IUFA 4J5OA 3MURP 2XS5A 2DHSA 3R1LA 1N54B 1YJ9S 2MKCA 2OSRA 2EK1A 1H2TZ 2M7SA 1WG1A 3R27A 2QA4S 2JWNA 1Q81T 3VAJA 1JJ2R 2KHCA 3VAKA 5DM6Q 2KG0A 2JVRA 2RT3A 2CQ3A 4WIIA 1U1OA 2MSTA 2RRBA 2E5HA 3HHNB 2E5GA 4CQ1A 2MPUA 2DO4A 1W2BR 4EGLA 2MQMA 3CPWR 2LQ5A 5ITHA 2MJNA 1KD1T 3CC4S 2VONA 3IRWP 3CULA 3BEGB 1JJ4A 4V19X 2DNOA 2DNNA 2G1DA 1CVJA 1KQSR 5GMKa 1L3KA 3P49B 1D9AA 2CPEA 1VQ9S 5GAHU 3VAGA 2XB2D 3S6EA 1WF0A 3B4MA 1VQ8S 1VQ7S 2DHAA 1FJCA 2X1AA 3TO8A 2CPYA 3UCUP 3UCZP 2NLWA 5MLCV 2U1AA 5CXTA 2YH1A 4QQBA 2J8AA 2F9DA 2QEXS 2F9JA 4P6QA 3UD3P 5DM7Q 1OO0B 1HD0A 3LPYA 1A9NB 2MHNA 2OTLS 3VAMA 4WFAQ 2BOPA 3K0JA 1U6FA 3CUNA 1H2UX 2L08A 1QVGR 2MQLA 2CPXA 2M8HA 2DNGA 5DETA 3OW2R 1WI6A 1VQ4S 5IQQA 1QM9A 1YITS 5GADU 3VAHA 2MY8A 4OZ0A 1YWXA 2MSSA 2DB1A 5HO4A 1OIAA 1UP1A 2CQGA 3DLLQ 1OWXA 1WEYA 4FXWA 4WF9Q 3CC7S 1U2FA 3IWNC 4YOEA 2MYFA 1WHXA 4IOCQ 3Q2TC 1U1NA 2RUGA 5EN1A 1AUDA 1P1TA 2E5JA 1DBDA 2DGSA 2DGXA 2MZ1A 3VAFA 2MKSA 1U6BA 3RW6A 1F9FA 2DNPA 1PO6A 3CCSS 4F25A 2X1BA 5LSLA 4Z2XA 2KXFA 1WEXA 1JMTA 1RK8A 2CQDA 3P3DA 1X4DA 1A7GE 3CMAS 2RRAA 2AYMA 1SJ3P 2MKKA 2JVOA 3J7YU 5GVQA 2ZJPQ 1X4AA 2M4MA 2MQNA 2DK2A 2EK6A 2MKHA 1U1RA 4IOAQ 2RNEA 1NU4A 2CPHA 3CCRS 2OJ3A 1XN9A 1WELA 3FEXB 3EGZA 3G71S 2EVZA 3CCUS 2LA6A 3HI9A 4RU2A 4ED5A 1VQMS 1QVFR 2DGOA 3MOJB 2MGZA 2M2BA 2DNZA 2XNQA 4TU8A 3EX7B 1WF1A 1M5VC 1FJEB 1VQPS 1YIJS 2GO9A 2KT5A 1WF2A 2AD9A 2FY1A 2VODA 1HA1A 4WFBQ 2D3OR 2I38A 2FC8A 2KN4A 3ZZYA 2CQ1A 1WHWA 5LSOA 2LECA 4UQTA 4PKDB 1B7FA 1WWHA 1YJNS 1U1MA 2KFYA 5BJRA 3ZZZA 4U67Q 3PIPQ 4IO9Q 2YTCA 2AYBA 2M70A 3CCJS 3MDFA 2HGNA 3CCES 3DXBA 1UW4A 2MKJA 3L3CA 2MQQA 2K3KA 1U1QA 2MZSA 1SXLA 2YWKA 2M0GB 1H2VZ 1SJRA 1VBZA 1ZZFA 5LJ5Y 2LKZA 2B0GA 3NNAA 2E5IA 4TU9A 2JRSA 2FHOB 3CC2S 3N9UC 5CYJA 3G6ES 5IFMA 3THPA 3SDEB 2CQPA 3G9CA 1UFWA 2CQBA 4LIRA 5JVHQ 3CD6S 2KI2A 3CCVS 1VC0A 4CH1A 2MXYA 1FJ7A 5IM0B 5LJ3Y 2YH0A 2J76E 3S01A 3MXHP 2XNRA 3B4DA 1DRZA 4UY8T 1FXLA 1N8RT 2DNMA 5DDOC 2DIUA 2GHPA 3ULHA 3SMZA 2DGTA 4C7QA 5LXRA 3EGNA 5D77A 2N3OA 2QFJA 3US5A 2WBRA 4WFNQ 1M5PC 1KOOA 3CCLS 2MGZB 1VQOS 1U1LA 1M5OC 1R8HA 2D9PA 1U1PA 2ADBA 2L9WA 1VQLS 3NS6A 5DDQC 3CF5Q 1FO1A 2ZJQQ 2ERRA 5FJ4A 2DGVA 1WG4A 3P5TL 3BO2A 3U1LA 1G2EA 5JVGQ 2CPJA 2DNKA 3R1HA 2M9KA 2HVZA 1FNXH 4QPTA 2LCWA 1VQ5S 4PR6A 4LJMA 3RW7A 5DDPC 2MQOA 3I56S 3H2VE 1S72S 4CIOA 3BO4A 2X1FA 4M5DB 1M1KT 2HGLA 3UE2A 1X5TA 2LYVA 2N3LA 3SXLA 2G4BA 3LQVA 2DH7A 3MD3A 2CJKA 3UWTA 1VBXA 2MB0B 4TU7A 2M8DB 1RKJA 3MD1A 2OIHA 1O0PA 2F3JA 2LEAA 4OZ1A 5LXYA 3J7ZT 1VC6A 1Q86T 1D8ZA 1M5KC 3G8TA 2DNRA 2CPFA 1K73T 5H1SV 1PGZA 4W92B 4QU7A 4PRFA 2HGMA 2M88A 3CCMS 3FEYB 3NS5A 1HL6A 3MUVP 1Q82T 1NJIT 2M52A 2MZJA 3BO3A 1DHMA 2RU3A 1R8PA 2PE8A 1X4GA 1N52B 1WI8A 2LMIA 1WTBA 2E44A 2XSFA 2DH8A 2N82B 4W90B 3CTRA 2CQ2A 1VBYA 1Q7YT 5GAEU 2N7CA 1WHVA 3VF0B 2VOPA 1BY9A 2DHXA 2KVIA 3THTA 4TLQA 3MI7X 1X4EA 1ZH5A 3UD4P 3CXCR 1X5SA 1X0FA 2DNHA 2CPIA 3G8SA 2G0CA 2LA4A 1SJQA 4WKRA 2RVJA 2RQ4A 1YTYA 1YI2S 3U1MA 4FXVA 1VC5A 3CCQS 2J0SD 1X5PA 2U2FA 1KC8T 1DZ5A 2OTJS 1H6KX 2DH9A 2KYXA 2ZJRQ 4ERDA 3UCGA 2CQ4A 3G4SS 1N88A 2MZQA 3JB9k 1M90T 3G96A 2UP1A 4YB1P 1SJ4P 2AYGA 2KM8C 1HD1A 2LEBA 2KH9A 2SXLA 3BS9A 4YUDA 2PEHA 4CH0S 2MJUA 4QU6A 2MQPA 2VOOA 2LXIA 3NNHA 2DISA 1S79A 1X4FA 2DNLA 3TYTA 2DGUA 1ZZNA 3I55S 2AYEA 2MY7A 4F26A 4LMZA 1NO8A 2MZTA
chains in the Genus database with same CATH superfamily
2HQDA 3KHLA 2BJ3A 5J2MB 2YX1A 1TK8A 4JI7J 1RTZA 5GAGU 1S99A 2EBEA 3EJMA 3LPEA 1ZA1B 4Y00A 2B7BB 2B9WA 2BW7A 2EKNA 2HK3A 2IRXA 2R7OA 4ZHRA 1WHYA 2V0NA 3JSRA 4CYUB 5I3UB 2QYCA 3MPWA 4NLUA 4NPOA 3KLGB 2KU7A 3LGNA 4OI0A 1K0TA 3AA9A 2ADCA 3PIOQ 3EPIA 1EAYC 2FTRA 4USIA 4M94A 2VG6A 3C8YA 1UFKA 4UF4A 4YR0A 4HI1A 3ITHB 5J2QB 2HNZB 1FHTA 4OQJA 4K5SA 4DR1J 2ATCB 2IMWP 3BV8A 4B9MA 4X62J 4PG5A 4YR3A 4ZP9A 3IO1A 1PYTA 4X4OA 2VUGA 1IBMJ 3KK1B 1Q8KA 2GCFA 3T1HF 2HYIB 4FBTA 1P27B 3UDEA 4OZ3A 3N6LA 4ZVRB 1FRIA 1IM4A 3Q22A 1HMVA 3BH7B 2NZ4A 1J2VA 2GMLA 3VALA 1VQ6S 1L3UA 1HWJA 4LSLA 1OPIA 1HWIA 3NY0A 2FVSA 1UEKA 2FPHX 3EDRB 3KUHA 3HHLC 3V4MA 2XYHB 3A8EA 2LXUA 1YSJA 1NM2A 3QSYB 3NNCA 3KJQB 4ZVSB 4ZVUB 2ZH4A 3BDEA 3PKYA 3AOBA 4NZ6A 4IRDA 4OIXA 1N48A 1TFYA 1CC8A 1JLEB 1UTAA 2BUNA 3BREA 1D0EA 2CZVC 1NXIA 2JZ5A 1HQEB 2CQCA 1QSSA 3BGRB 4N47A 2G0JA 3BKTA 1X4BA 3EMTA 2ILZA 2EWHA 1VQNS 2KG1A 2BE7D 4D3GA 2CQHA 4U96A 2XYPB 3NWRA 3DRYA 3HVTB 5D78A 4J91A 4JI4F 2YKNB 3QRQA 1Y00A 1UJ4A 5A8WA 3BGOP 2KL8A 1RAJA 2E7VA 2G2OA 1H0HB 4NRTA 4PEOA 2C1EB 4A8XA 5G0RA 3IGNA 1OYEA 4C0OC 2B9EA 2FB0A 2Q1LA 4IG0B 4J5OA 1XIQA 1EJ7L 3KLVA 1DJ0A 2CKWA 4C0BA 4DLGA 4LF6J 1NSPA 2NPIA 1N56A 3JAMY 1H2TZ 1WG1A 3R27A 3TQEA 2JWNA 2ZZNA 2ASDA 3O8WA 4NYPA 1Q81T 3EICA 1N33J 3GSIA 3KJVA 4HKQA 4DXLA 1PAUB 3EVMA 4ZPDA 1JJ2R 4DN9A 2ZUAA 2KHCA 1KLMA 4P72A 2HS3A 2OO4A 3HVWA 3NOCA 2RT3A 2DD8S 1K44A 1FF2A 4DV1J 1N5QA 3DHXA 5HMZA 4TQRA 2E5GA 4CQ1A 2JLFA 4FNHA 4LFBF 4KGMA 3QJPA 3BQ2A 2PN6A 3HDSA 5DLGA 4J9KA 5HP1B 1CJTA 4M63A 2C3OA 2C2MB 2VJUA 2VDHA 2MQMA 5IC6B 4LT6A 2QG9B 3N28A 4MJKA 1GAOA 1VOMA 2MJNA 2CDRB 5C2GA 1NK0A 4PXBA 8ATCB 1RT2A 1DTTA 1RU2A 2B8QA 5H9EK 2F8MA 2A6OA 1XK8A 4KE5A 3W62A 1H38A 4A8OA 1AW0A 4QW8A 2XMKA 2G1DA 3OHAA 4M5DA 1V6HA 4WE1A 4KHPF 4P9SA 1SQFA 3Q83A 3W9JA 3P49B 4CO4A 5KFMA 3GMGA 2XCPA 2W24A 1NRKA 1VHIA 2XWXA 2BKPA 2XTJP 2WW8A 4X62F 3QAEA 2R7TA 3CWJA 4DFJA 2IBOA 3ILLA 2HFNA 4B3MJ 5DG7A 4DSLA 4ECRA 2GV1A 3GR1A 2EEYA 2NZCA 5KT3A 4BCAA 3PX0A 2I5JA 4RW4A 2ZNZA 5KFLA 3UCUP 1S10A 4RBTA 4RO0A 1NNDA 3ILIA 4CNZA 1GXUA 2W8KA 3DLGA 4NE9C 1MMNA 2F9DA 3BF4A 3MMJA 2V4QA 4P52A 4P6QA 1HIYA 5DM7Q 3A8IA 3OXGA 3OBIA 1HD0A 2UVWA 4DR4F 3HHDA 2NS1B 3Q23A 1RWUA 3KLEB 2QIFA 3RG6A 4DL2A 1KVIA 3M6UA 2AV5A 2GAHC 2VQFJ 3CDBA 3FGVA 3NMAA 3CO0P 2QC3A 4TY8A 1KP6A 1G6BA 2YNGB 5ETNA 1RWVB 2R8GA 1U6FA 1Z4UA 1H2UX 1KFSA 4L72B 1QVGR 3PCOB 3BQ0A 4DV3F 1WKKA 2QMXA 3D9BA 3WX4A 5G4DA 4DV4J 4E2FB 3FDSA 2MY8A 3K89A 3PVXA 1FDNA 4QIVA 4YB6A 2UUAF 1T95A 1S9GB 1FCAA 4KO0B 2DB1A 4EMDA 3D67A 4YB5A 1N6QA 1S48A 2YPYA 3OFEA 2Y8WA 3DOLB 4OZ5A 5EWGA 3DLLQ 4LF5F 1WEYA 1UMJA 2F1FA 4ZDNA 3KLHB 1JQGA 2YKNA 1ZM4A 4C2MA 4ECQA 4NLYA 1JJCB 2ZHAA 3EZUA 4JP8A 4OZLA 1R43A 2RUGA 1MWYA 4ZVQB 2BXJA 3UN2A 5SZTA 1AUDA 2E5JA 1DBDA 1S57A 3HFVA 1MU2A 2VZ9A 3LP1A 2ZNYA 4I2PA 3RZAA 4CLPA 4ZIWA 1YKWA 2RRNA 3SQGB 2B6AB 3MEEA 1UZDA 3HD1A 2DBBA 1NDLA 4A47A 3QIPA 4CO2A 2DEIA 2XMVA 1SL0A 4IH7A 2PA8D 3Q8YA 2YKPA 2YQ0A 1WEXA 1L3SA 5L8RC 2HK2A 3TA1A 2BQUA 2XMAA 4DF8A 1RCOB 2PEBA 2AYMA 1HPZB 3T1AA 4R8UA 1UL3A 3UDVA 3J7YU 3MMAA 1SBRA 4N77A 1EKRA 5GVQA 4NZ7A 3FSIA 2J9DA 3GG1A 1IKYB 1PAEX 2M4MA 3MEGB 2ZJPQ 2MQNA 4AQYJ 4ES3A 4KJIA 2IJRA 1LNQA 2EK6A 5K9FA 3FVYA 3GYGA 2CXEA 2NCKL 2HQGA 2NUUG 3BBFA 2OEJA 5E5NA 4NMXA 4K4VA 4MAKA 4C11B 2CJXB 4HVZA 2W7OA 1KLNA 2OJ3A 2NR0A 1NJYA 1WELA 2MHEA 2MTLA 2RIJA 1E6VA 3G71S 2V6AA 4DV6F 1SQGA 4RU2A 4OHXA 2HG4A 2IA6A 1S9EB 2ALYB 3MOJB 2LQJA 3AAWB 1IKWB 5DZ7A 4ZIVA 5HN0A 2W9CA 1JLCA 3QLHB 4ILLA 4EBDA 2YPZA 2GGPB 3ISND 2Q3PA 1T3NA 5KFAA 4CNYA 4HYKA 2Y8YA 3KLHA 4FDFA 3IC1A 1VHFA 4TU8A 3ZTOA 1ELOA 4RWXA 5HROA 1FJEB 1VQPS 4YP3A 1N6QB 3C16B 2UXCF 4CYUA 1JB0C 4UOFA 4YHHF 2VQEJ 2VODA 1HARA 1HA1A 1LKZA 3E51A 2D3OR 2FC8A 1NZAA 3ET6B 1VJQA 3M2VB 4DUZJ 3SQGA 1FRJA 1D9DA 2APOA 1EZZB 3GJRB 4P7TA 2VC0A 4UQTA 1H3DA 1RABB 4FN5A 4X64F 1LK5A 1WTFA 1B7FA 1E6YB 3W66A 5J2NA 4UQGA 2D7SA 3F44A 1S1WA 3N5FA 4EUVA 2QZ8A 4ED3A 1KQGB 3MHYA 2XHWA 1IBKF 4U67Q 3PIPQ 4RX6A 1ZETA 4P7VA 3FRZA 2M70A 2VPZB 1U0SA 3CCJS 3HM9A 1V5VA 4QPXA 2H4WB 4IH6A 1AZSB 1UEUA 4NLQA 2E1PA 4Y2MA 5KT7A 3PW4A 1GEHA 1LWEB 4M5NA 2YWKA 3BJYA 3MAHA 3MR2A 3DRRA 1SJRA 3PW5A 3BPSP 4WKYA 1D8YA 1VCTA 2LKZA 2V4JB 3KUEA 3MEGA 4W98A 4ER8A 5I3UA 1ZTTA 2RE1A 5K8NA 3DRPB 1VBKA 2V67A 2UUCF 1OY9A 1N5YB 3N9UC 4ID5A 1M0SA 2EBGA 1D1UA 2RH3A 4RUHA 4WFYA 3THPA 5E3QA 3SDEB 4YFUA 2E1CA 3CJ0A 1T03A 2UVRA 4NMLA 1GXLA 2XYGB 4LIRA 4X64J 3CD6S 4XPEA 4ECZA 3NBPB 3EZ5A 1NMEB 1S59A 1VK3A 2OMLA 2ACMA 4ZS6A 1PYSB 4NLWA 2CIMA 5CD4H 1VC0A 4ICLA 1N32F 1RZMA 1PILA 3MPVA 3QATA 2MXYA 4CH1A 2A2DA 4OHWA 3GLJA 4K4ZA 5F8MA 3M9MB 2QSWA 2C3MA 4ECWA 1N0VC 2AMCB 3CJTA 9ATCB 3GIMA 5D0GA 5IQ6A 1SKUB 4N7TA 3B4DA 1QUPA 2AEJA 2BJEA 3QIDA 5KFYA 4OHZA 1N8RT 1RACB 2IM0A 5D0HA 1KHVA 2C2RA 2HIYA 2DIUA 1TUWA 3TZYA 3TWZA 4NLXA 4ATNA 2DVIA 5H9FK 2UXBJ 3KYLA 1W2IA 4P71A 1X60A 4IFVA 1Y0HA 3TVKA 3UDCA 3R6LB 1F1BB 2L9DA 2KT2A 3GSDA 4WXWA 1S6UA 2XMMA 1IKVA 2QFJA 4B3MF 5CYMB 1VR6A 3US5A 1M5PC 3K5PA 1KOOA 3MM6B 4HTJA 5AXNA 1VQOS 2BQ3A 1U1LA 2ZDOA 1AB8A 3PTWA 4DSKA 4L74A 4UZBA 2ZM6J 3GZ7A 3QJLA 2CYYA 2Q43A 4F3QA 3QPIA 2ZC4A 3WDOA 4Q5VA 5T14A 2ADBA 1TK0A 3KDNA 4TYBA 1T8EA 1UVMA 1TAQA 1YK9A 5DG8A 2KDOA 4YR2A 2DRAA 3CF5Q 1X7VA 4MIBA 3KOAA 1FO1A 3Q8VA 3P4UB 5FJ4A 4K2JA 3P5TL 3M6WA 4FVMA 3CMQA 3NGSA 3QGGA 1HQUB 2B3TB 3KLFB 4KC5A 4JI6F 3BO2A 5DGAA 4OHYA 2W2NP 5JVGQ 2CPJA 4LF8F 4DUYF 2J7UA 1FNXH 4OX9F 3TW0A 1IM6A 4ITSA 4DV5F 4PUOA 1JLFB 1RXOB 5CZXA 2FUG9 4PR6A 4LVNP 3T41A 3W9IA 2RB7A 3LAMA 2MQOA 1CJVB 3BDPA 3LAKA 2F5GA 4HI2A 1TU0B 3BO4A 3J7Z5 3KMSA 1GMUA 2AX0A 8RUCA 4M5DB 4U95A 5J1NA 2HGLA 2ZM6F 2VIHA 2MLXA 2M5YA 2FD2A 4HTIA 4B3SF 2ZKUA 4CT8A 4ED4A 4F4KA 4X2BA 3TUPA 2V8VA 2JEJA 2HHXA 4DPTA 3MD3A 4LIWA 1YJUA 1S1VB 1WSVA 3CD7A 3NBPA 4TU7A 3JYTB 2CG4A 3T1YF 4XDCA 2MB0B 2VU5A 4RU9A 5DGBA 1SH3A 3MD1A 3MECB 3TUZC 4ED7A 1RKJA 1IBLJ 1LOUA 1NSKL 2LEAA 1NHUA 1S49A 2IYIA 3IBWA 3ISNC 1RAOA 3AY0A 3T5JA 3LH2S 1R0AB 4N76A 1M5KC 3G8TA 3AJ2A 2BW2A 3N01A 1RHQB 3TOQA 4W92B 4KTQA 1VMBA 4R25A 1HI1A 2HGMA 3MPDA 4L3NA 4BWJA 1XNRF 1IKVB 4H4KC 1F3VA 1R0BG 2EFOA 3BM7A 3I9V9 4ZLLA 1C0TB 1AT1B 5F41A 1HL6A 4HACA 1N5VA 3MUVP 1NCLA 2M52A 2XBPA 3IWXA 1Q82T 2BRKA 1REVB 3M32B 1DHMA 1KQFB 5KFQA 2RU3A 2QLJB 4Y2IA 4LF4J 1Q8LA 5J1EB 3MCSA 3MEDA 2CJQA 3I0SB 1R7IA 2MDAA 1N52B 4FPIA 4DZDA 4ZJQA 5HMWA 1RWNB 1NK7A 1L5UA 3HXMA 2E44A 5C42B 1J5OA 1RADB 1HR0J 4B9NA 4IR1A 2GJIA 2UXDJ 4K59A 2YNFB 3PDNA 5DZ6A 4ETZA 1FFWB 1RE1B 3KG1A 3V6KA 4KGKA 2UXBF 2CQ2A 1VBYA 3NLCA 3I5BA 4DU7A 4JI2J 3CW2C 1OJ4A 1Q5VA 4KY3A 2DHXA 2AJ0A 2DCUB 4Q44A 4OMFG 4WZQA 4JOUA 4TY9A 2MLYA 1U0HA 1RTHB 3I9ZA 3QO9B 3ONQA 1X4EA 3JTPA 4TQSA 1UVKA 1RU1A 2D1CA 4NEZA 3CXCR 2RDJA 2HBRB 4R5PA 3M8ZA 1NJXA 5JXSA 1Q5YA 1RT4A 1Y10A 4F0KA 1QD1A 1JLAA 5KT6A 4DQRA 2B4OA 4M5GA 5F9LA 2WZ1A 1H7XA 1C1BA 4IDKB 5F9NA 5LMUF 4EZ9A 3THVA 4WKRA 2QFIA 2RVJA 5E0OA 1MWQA 5FD1A 3D0IE 5K5MA 4JI5J 4JV5J 2K1RA 3NAHA 1R0AA 4WZMA 1YTYA 4QBUA 1NK5A 2HVDA 4LRBA 2HRYA 3FKBA 2J0SD 5ETSA 3HZGA 4YMEA 1DZ5A 3I0SA 4RW9B 4E0DA 2N7YA 2GX8A 4LRCA 2W7PA 4DS5A 1M5SA 3PW7A 1N33F 2XI3A 4ZA1A 1SKRA 3UCGA 2J8SA 2VF3A 4O0IA 4I0WA 3ZZOA 1U4BA 4DSIA 3QSIA 3CCWA 5DRKA 4DX6A 5KFNA 1S76D 1KVKA 1V9OA 2J6UA 1QY7A 1IJEB 2EFGA 2MZQA 5IT0A 3D6TB 3CCES 3JB9k 1T05A 5D3GA 1P9YA 1H7WA 5KFTA 1U25A 2W1BA 4KFBA 5D4OA 5ETKA 3AT1B 4NYOA 4RW6A 4ZCLA 4YY3J 4YB1P 4A8QA 4WP3A 5A76A 5L1KA 2PI4A 4X4VA 2EFPA 2OD4A 3MFHA 4FYDA 5HBMA 3C6TA 4CH0S 2OFHX 2OPQA 2ALZA 2OEMA 1KSPA 4QU6A 3P5BP 3QMQA 5HI7A 2VOOA 1T9TA 3DGPA 2E5LJ 2JEFA 3NNHA 3MPYA 3EM1A 2DKOB 3S1TA 1RAHB 2OH2A 1X4FA 2DNLA 3TYTA 1BGXT 2H5EA 4DR5F 3I55S 1OSDA 3QGHA 1NO8A 1RA7A 3Q86A 2MZTA 3KUGA 3MM9B 4X66J 2A18A 2DR8A 3HHLD 2K8GA 1JKHA 2MLZA 4OYWA 1V3SA 2IIHA 4NA1A 4JUZA 3PX6A 5IV3A 3ZO7A 1QAJA 2XS2A 1IQTA 3FBEA 4Y0FA 1IR0A 3MEKA 4JI2F 3DMJA 4U8VA 2V2ZA 9RUBA 5A0YA 2NXUA 3CT9A 5B0EA 3G6VA 3K5NA 1HW9A 2RS2A 2RAQA 1C1BB 2AKWB 3EZOA 3R5JB 4IDKA 3VGVA 1LW0A 5E41A 2H3EB 2KXNB 4K4TA 1XNQF 1LW2B 4K50A 2HBQB 1UFLA 2CPZA 3CIZA 4KIAA 3SFUA 4R5PB 5EGYA 4FS1A 4ELTA 3JQJA 3RB6A 2L9NA 1R31A 1S1XB 1F60B 3MUTP 1N34J 2NYHA 4MKAA 5GAEI 1KOHA 2RQCA 4NYZA 4CLSA 1K1QA 3R7BB 4GC7A 3MUMP 2BABA 1SIWB 2UU9F 4CO3A 2OPRA 1YZ7A 4MKVA 3X3UA 3J81Y 4URQU 3TVZA 2KM8B 1K8AT 2E9ZA 1BQNA 3PEHA 2GHVC 2KKHA 2CPDA 3K8WA 2KRRA 3DOMB 3MCOA 1K1SA 3UO0A 4MFBA 3BBBA 2I2YA 3SCIE 2DCLA 1RDRA 1PG5B 3W60A 3EDQB 1R89A 1FD8A 2P2CB 4DV3J 1NHKL 1UAWA 1TTHB 1RTJB 5ETLA 2X1GA 3R5CA 1T9VA 1OS5A 3OTOJ 1N5YA 1VJWA 2QLWA 1VDHA 2LDYA 1CC7A 3KJFB 4R0EA 5D8HB 2Y3YA 3CVKA 3SDEA 4ZKAA 2QL5B 1S12A 2RS8A 3D1OA 2DNYA 3GCWP 3NGUA 2O5DA 2GIFA 3GTYX 2Z8QA 4ZP7A 1ITPA 1RWPB 2HNDA 1NJWA 2HSEB 2ZH2A 2Z2MA 2DIVA 4LRFA 1HHSA 5HAOA 5KFEA 3D1HA 4PPDA 2XM3A 2Y0BB 2OSQA 1WG5A 2YKAA 4FKYA 1QE1A 2XG8A 3TUJC 4F02A 3OSNA 1TKZA 1RUSA 3D6HB 3TZZA 4F4ZA 1WC1A 4L76A 2DHGA 4OYPA 4KQZA 4OX9J 3OVBA 2VB6A 1UVLA 4I6AA 1FT8A 1JLGB 5B08A 5DQGA 1VIXA 1HHQA 1ZM3A 2FZCB 2LQBA 1KD1T 2QRRA 3M8WA 5FDLB 3PR5B 1YBTA 2QT7A 4BLGA 7FDRA 5JJBA 1GTHA 2XS5A 5HQMA 4J9VA 3R1LA 2MKCA 2OSRA 3MM7A 3GFXA 4PG4A 2M7SA 2CNOB 4DHVA 3DCAA 2W4PA 3K5MA 3FBBA 1RB0A 2VG7B 3BKFA 2JH3A 3CIMA 3DMJB 2ZH8A 4MMOA 2FHKA 3W2VA 2XO6A 4URGA 2Y1JA 2GHWA 1IWAA 1VK8A 1DARA 5B09A 2RMLA 2F8HA 2RJZA 2GGPA 3HHNB 3DOKB 2CVIA 1KFDA 1RAIB 2ZBIA 3N4WA 1L3VA 1VRTB 2PIIA 5CQGA 3LANA 3I31A 1W2BR 4LF7F 4WP8A 1WOSA 3R5DA 4KT0C 1Q4RA 3LO3A 5M2UA 3CPWR 1MSWD 3LTOA 2Z2YB 4G1IA 1LV5A 3N79A 3P45B 2F65A 2KHDA 1RHJB 2ZVSA 3I6PA 3JTNA 3BEGB 3KNGA 4XAKA 6FD1A 4DZ6A 4O44A 2GMJA 2NXNA 2ZZTA 4HLBA 2V68A 1KQSR 1ZAVA 3NEKA 5J2PB 1L3KA 4LFCJ 2H5JB 3FQLA 1Z2LA 1DQAA 2HQCA 2HZVA 3GCXP 1VQ9S 3IR7B 2XY6A 3KNAA 1SH0A 3DLJA 1WKLA 1RAGB 1SVDA 2J7WA 3ETOA 2RD5C 4G65A 4RWWA 1QLNA 2KTQA 3AJ1A 2V9WA 5KFVA 2IC3A 1S9EA 2HQ3A 4B9SA 1FJCA 3EVOA 5D4NA 1R6VA 2OP5A 3W1YC 1H72C 3M30A 5KG7A 2C2EA 4PQUB 2PT0A 3HMJG 5CXTA 3TA0A 2IJFA 1R8BA 1VI7A 4IH5A 5ETQA 3HULA 4USMA 2PD1A 5DJBA 4WTOB 2QEXS 3GPAA 1S6OA 3TAQA 2F9JA 3UD3P 1FKOA 1YGYA 4Z7YA 2HPUA 4TYAA 2D3O1 2DEJA 4OYXA 4PXDA 5L38A 2YNIA 2G1HA 1U8WA 3GJTB 4DR2F 4WFAQ 2VDIA 2BOPA 3FNNA 1VFJA 4NLTA 3M8RA 3G82B 3QT8A 1QSYA 3CJRA 2VG7A 1F9EB 2DNGA 2E66A 3OW2R 1I5OB 2AZ3A 1VQ4S 5U47A 5GADU 3VAHA 1RTDA 1LWEA 4OZ0A 3AA8A 4ID5B 4F4AA 5HMXA 3GIKA 3ILOA 4CTAB 1ROFA 2IPOB 2YNGA 1RT6B 4BDPA 5HK4A 5A8RA 3EXCX 4I6WA 2OPPA 5HO4A 4YY3F 4URSA 3RB0A 3R5AA 1S6PB 1AXQA 2V8DA 3W8PA 4E98A 4NCAA 2B5JB 4FXWA 4WF9Q 1NKBA 1U2FA 2DPIA 3OTDA 3MCNA 1WHXA 3R5GA 5DQHA 3MOZA 3PACA 5KG4A 3Q2TC 1U1NA 4O3RA 1UPPA 5EN1A 3Q24A 4I69A 1LK7A 2B43A 1DQ8A 2DGXA 2MZ1A 2QV6A 2C2ZB 2Q6BA 4NASA 5K8MA 5SUHA 3RBEA 1TVRB 4C8MA 5CZVA 3V6JA 3ITHA 2DNPA 1F9FA 1LXNA 4RW4B 1VRTA 1R0CB 1C1CB 4MYUA 3I0RA 2ZH6A 4NZ0A 1UWBB 2GW8A 4J7CA 3TZWA 1OYDA 2C42A 2C3YA 3U7JA 2FJXA 2KYZA 2KXFA 5HATA 4GKJF 5C2CA 1JMTA 4ZPAA 2CQDA 1X4DA 1A7GE 3CMAS 2UZAA 4JI0F 1VQSA 2F4FA 4X84A 3M2RA 3GG0A 5A0YB 4O3SA 1SJ3P 1U8SA 2JVOA 2MKKA 4LFBJ 5GMDA 4CLZA 3B8HA 1AFIA 1NPPA 2R9LA 1NAQA 2BDPA 2IVMA 2AGOA 1X4AA 1T9WA 1I51B 1W7WA 2OUGA 2WW4A 4FZVA 5J2MA 2DK2A 2IHR1 2Q6CA 4LF5J 2H51B 3QNWB 4B17A 5AE2A 1J27A 2B4PA 1U1RA 4M8LA 2PFFB 4FVCA 3CDUA 3CCRS 2UUAJ 2WK4A 1SI9A 2R7QA 3PRVA 5F8LA 2FHMA 4I67A 3CCUS 4ZITA 2XGQA 2HWIA 5HANA 2LA6A 4GKKJ 3U1NA 3ENQA 2VHGA 1VQMS 5HJXA 1QVFR 3BGRA 2DGOA 3KMQA 4ED5A 4J9SA 1S1TB 4EFAC 2W2QP 2WVEA 5KOWA 3J7AN 1FX2A 1LW2A 2XY7A 2YWEA 2M2BA 3ILJA 1XR6A 1XR5A 1BHNA 1TUVA 2FVPA 4YDXA 1GFWB 4KR0B 1MN9A 4WBFA 4Y28C 3LA0A 1YG0A 3ZZ0A 1EARA 5HVHA 3V81B 2UVUA 4B9TA 4JI3J 1DTQA 2GO9A 5F0UA 2AD9A 2FY1A 2XMUA 3NGKA 3KTQA 3MMAB 2C2OB 2G0IA 4LQ9A 1HLWA 4KFBB 4X4QA 1EQMA 2DJWA 1FEHA 3M2RB 1NB2A 3ZZYA 3DI6B 1CPZA 1CBKA 4RPFA 1FDAA 4I2QB 5LSOA 2D3ZA 4PXEA 4CLTA 4OYZA 4GO7X 1X0PA 2QLFB 3CO9A 4DL0C 4DFPA 3NS7B 2W9CB 3PRDA 1EHWA 1GX6A 1WWHA 4DX7A 4F3OA 3JSMA 3R7SB 3SI8A 1F2HA 2B56A 4K4WA 2AW0A 2XLKA 2HMIA 1JLQB 4DR6F 5BJRA 4IO9Q 2AYBA 2VA3A 3RTVA 4Q8FA 1KKHA 1BQNB 2JFDA 3MDFA 5LT5A 5C5JA 3A8KA 3HVRA 4JI3F 3M6VA 2V5HG 3M32A 1RTIB 3K57A 2MKJA 1LEOA 2I8EA 2K3KA 3PNIA 3KJNB 3FK4A 3OXFA 5T7LA 1SXLA 2D41A 1P9QC 4EYIB 4A8WA 4RUAA 2VFUA 1B4SA 3I87A 4S0MA 2HQFA 1VBZA 3TA2A 2FGCA 3W9HA 5LJ5Y 2B0GA 1FRHA 3NNAA 2E5IA 3NCRA 1TUGB 1W26A 2JRSA 4UZCA 3F73A 4A8FA 2GQ2A 2QL9B 4GMKA 5F8NA 4DV7F 2ZD1B 1KTVA 3A4TA 3TVYA 1OPZA 1MNEA 3K5LA 4V19J 3G9CA 1UFWA 3C14A 5AXMA 1GMWA 3TX0A 4DUZF 4USKA 4USTA 4M5HA 1FWLA 2IRUA 4WK1A 1XMOF 2RF2B 1SPBP 2K7JA 4D3HA 2IYGA 4DCOB 4K0KJ 1HNZJ 3CCVS 2R8JA 3C46A 1HQ2A 1SC3B 5KG6A 5KFPA 4N5SA 3SV4A 5KFBA 5LM7E 3SBMA 3H90A 4CLKA 4J9UE 2J76E 3DXSX 4ZVTB 3SYZA 2GJ2A 3QT5A 4FF4A 4U8YA 3S01A 1VRQC 4OYIA 3ZZPA 3MXHP 2Y1IA 3H0PA 4NLPA 4ES1A 1DRZA 4UY8T 1FXLA 1XNRJ 4KH0B 1LWCB 3I32A 1R6YA 2DNMA 3POTA 1WOOA 3MAQA 3D0HE 3TEHB 2BYCA 5AE1A 2V4JA 4ZJLA 3SMZA 1ZM2A 4DPXA 2ZH7A 5LXRA 4Q45A 1B0VA 3QFHA 3I5CA 2HLTA 3PJ9A 1RGVA 2ROEA 3F0NA 1DTTB 1AZSA 2VPWB 3BN7A 3D68A 3I5AA 1X9MA 2JEIA 2HFOA 4H4KA 4EBCA 2R2RA 3QGPA 1LXJA 1RLDA 2XMJA 1YRTA 2L3MA 4NA3A 1R8HA 4KPYA 1LFWA 3FZBA 2FZGB 4OJ1A 4C8NA 2HMIB 4WPAA 2L9WA 4CI0B 5J2NB 1S97A 1BC6A 2K1RB 1SV5A 1IBCB 2CJBA 2B8PA 2XCAA 3NS6A 2VH7A 2XZTB 3K2YA 2JFKA 4OFZA 3E8OA 1TL3B 2AGPA 1OY6A 2WVFA 2ERRA 4I7FA 2JLEA 2ZWOA 5KFSA 4A4JA 1TR0A 5HLFB 4F0MA 1NEEA 2AEFA 3GIRA 3M8QA 3C3LA 1N32J 3C6TB 3JQKA 2W25A 4CCHA 1UVJA 4M5JA 3PR4A 4JI4J 3V4IB 2HNZA 4OYMA 5HJYA 5AE3A 6FDRA 1HNIA 2E1MC 5KFCA 4K4YA 2AP6A 2VG6B 2WB4A 4XDDA 1JX4A 3BGLA 4WWSA 1JLFA 3IFEA 3R6GB 4EEYA 2WRMA 5B0GA 2PMZD 4DSJA 5IC4B 2BANB 4CLWA 4MT1A 4RUBA 3H2VE 2E1RA 3VGUA 2LVWA 1ZAWA 3HHLA 3KWMA 3H5YA 1X5TA 3RRKA 3SXLA 1U49A 3L95X 4DR1F 2G4BA 1GX5A 4KGZB 1OQ6A 3DRSA 4RKUC 2CJKA 2JHEA 3UWTA 2CNKB 3TANA 4OI3A 4BC7A 3NGRA 1RWMB 2YKMB 1T9XA 2ZFHA 3ZZTA 1T02A 3W7BA 5LMNF 2OIHA 4LF9F 2AX1A 1O0PA 2F3JA 4C48A 4OZ1A 3PW0A 2Z2LA 2CFXA 1QTNB 1A6LA 1CG2A 3W5YA 1JLEA 1G4CA 4NXNJ 2CPFA 4H4OA 2MQ8A 3AD9C 4NLVA 2XGPA 1K73T 3CEDA 2BA9A 1PGZA 3DYAA 1Q1KA 3PFOA 3EWGA 1QAXA 2A1BA 1I94J 4PWUA 3M9NB 1IBMF 2IA0A 1GXTA 3AODA 1P1LA 2D3UA 1LWCA 1TQLA 2M88A 3B6BA 3CE8A 3FEYB 1WOPA 3H98A 4RNFA 5DG9A 1UA1A 4EI2A 1NJIT 2MZJA 3QFWA 1DLOA 2NYIA 1WD6A 1FESA 3QIPB 2R7VA 2KO1A 3O1LA 4NOHA 3D3BJ 1TVRA 2RHSB 3TJAA 2MEWA 4NI2A 2J9CA 1RHUB 1FX4A 2LMIA 2OPRB 3FBCA 1U45A 1S77D 2WCXA 3Q8UA 3PXGa 2DH8A 4X4SA 4MFBB 2N82B 3HHLB 4Y3CA 1SC4B 3CTRA 4USWA 4DL6A 3CB4A 4W90B 2BV3A 2G2YA 2NPFA 4CWBA 1KTQA 4CLFA 3MEDB 5ETOA 5GAEU 1WHVA 3HSGA 2N7CA 4DFKA 1BY9A 3PO4A 2HVHA 1NDKA 3GJSB 1BQMA 1J5EJ 2R2UA 4FYXB 4TLQA 3MI7X 4O4GB 1KR4A 2D74B 3CJSA 3N5BA 5HQLA 1ZH5A 4AE5A 2R8KA 5H9EJ 2C3PA 1B99A 5KFRA 5LSRA 1X5SA 1PJ5A 3D6MB 2BJDA 3C15B 3DLKB 1S0MA 1UPMB 5A8KA 2W8LA 3AOAA 1JLAB 2WHOA 4KGXB 4C8LA 5AJ3F 4AUKA 3OQ2A 5B0BA 2IFXA 3BR8A 1HBOB 2LA4A 2XI2A 1O8BA 1SJQA 3MMCB 3W3SA 1ACMB 2RQ4A 5KFFA 2ZZMA 3MM5A 4HDGA 3O6QA 3T9ZA 3OL6A 2IVFB 2V8PA 4JI6J 1MN7A 1TFWA 4B3TF 3UQSA 4KHPJ 2R7RA 2U2FA 3TI0A 2QN6B 1G1XA 1H6KX 1VYAA 3N0VA 1RHMB 1RT7A 3BB5A 4ALZA 3DLEB 4YB7A 1T03B 1S1WB 2MKYA 2ZH5A 4PYAA 4QWBA 4EU0A 4WU2A 1U48A 1BMQB 1HWLA 2VG5A 3C16A 3A3OB 1IR2A 3KLIB 1CJKA 4H54A 3W5XA 2Q66A 2JJ4D 4UY85 1M90T 3OFFA 4M5IA 3BYRA 4C98A 3Q0AA 1OSCA 2NSCA 4H4OB 2UP1A 1FKPB 3U02A 4RNOA 4XO0A 4A8MP 3DU5A 3PO5A 3IXQA 1F9HA 1IN0A 1C4CA 2BBEA 4B02A 2X3GA 2KM8C 2KH9A 1S1TA 2LEBA 1DY3A 2J9EA 4PCQA 1FXDA 1RHRB 1FXRA 2CG8A 1YJVA 3MPUB 4U7UD 3J81j 2WVCA 1HR0F 3FQKA 3AHPA 4OHVA 1IWGA 4PWWA 1SQEA 4AXIA 1BQMB 2MQPA 1RJJA 1RI7A 3BKUA 3TJ9A 1RYRA 3H5UA 3UI3A 1B7YB 1NH7A 1S79A 2DISA 4FXDA 2Y1RI 1RT1B 2DGUA 1VRUA 1V3ZA 3DOKA 2ZH9A 5L1LA 2MY7A 1ZZNA 5FLXU 4LF2A 2LFVA 1Q79A 1J5EF 2NXEA 5HL7Q 3DI6A 3PHEA 4FF2A 4C3MA 2J7KA 3WC2A 2G9OA 4ECVA 2PFDA 1I1GA 2ZKTA 1RWOB 2ACYA 1U1KA 1RCXB 2O3DA 3C14B 2MKIA 1WEZA 3IBCB 3G6XA 2IBKA 4ZOSA 3M2UB 2CQ0A 4CO1A 4FS2A 2V50A 1XMQF 4CO5A 2BM0A 1IR1A 1FRKA 2FLPA 1VQYA 3A1YG 4M5KA 2E9RX 5FIIA 4CLLA 2R2TA 3VCDA 2IM3A 2LXFA 3PY8A 1GH8A 3GIIA 4Y2AA 5AJ3J 1XBWA 2XULA 3V2UC 4NLGA 5T7LB 2QJ3A 2YQ3A 1RWWB 1F2GA 2H65B 3CD5A 2AZ1A 3CMES 1C0UA 5IM0A 2YX4A 1NKCA 2GIRA 3H5SA 4RBUA 2VA2A 1HW8A 1M1GA 2V94A 3IR6B 4V1Ak 2XQCA 3DHWC 4A46A 5DDRC 5ETRA 4DV2F 4F36A 4JI0J 1KHWA 5HSPA 1TKDA 1JLQA 1A0OB 3ENAA 3PJXA 5KG0A 2GFFA 2YY3A 3MGJA 3RAMA 2DRBA 4F50A 1RT6A 2IC3B 2FC9A 1ZOTA 1C4AA 2P9GA 2EXUA 2ROPA 2BJ7A 2DGQA 5I42B 4LBHA 1K9MT 2I0XA 4JYAJ 1FVSA 4EO8A 3S7RA 1X4HA 4IFVB 3DC2A 2NSBA 1VGYA 1HNXJ 5FLXY 3BSNA 3D2WA 3P6YC 1GQEA 1PC5A 3JSBA 1CSJA 4UUXA 2CNLB 2OEKA 3TQ1A 1FD2A 2OGUA 4LF4F 2YBVA 4GC6A 4A8SA 1VQKS 3PYEA 2XC9A 2H4YB 2DR7A 3Q2SC 1NK6A 4F8RA 4K7QA 1N34F 5B0FA 2OFGX 3TEGA 4ANDA 1HQUA 3R2CJ 3GILA 2MZRA 1NSAA 1HBMA 3HX9A 2PC6A 4C8KA 1AA1B 4DPOA 4EBEA 2MMYA 4OI1A 3KHRA 2VV5A 4QCLA 4Q7AA 4ELVA 3UD5A 1APSA 2B9YA 1F6TA 2Z0GA 1HBNB 2O1PA 2VKRA 4UOHA 3T6BA 5CA5A 4B3RJ 3CD0A 2DO0A 2OPPB 3NKYA 3VVUA 3GB0A 4F7VA 3MURP 1ZAXA 4TVAB 3IWLA 2DHSA 2BEFA 4QWDA 3N6NA 1MMLA 1N54B 2HRTA 5E33A 2QGFB 5AT1B 4EYHB 2EK1A 5DQIA 3UPFA 2F40A 4QW9A 4KYZA 3T6JA 2KJWA 4BHQA 5HROB 1YRUA 3IMQJ 2QA4S 3R2DJ 1DFDA 3AD8C 2HS4A 3VWSA 2ROGA 2QL7B 3CDEA 1FVQA 1S0OA 3RB3A 2BJ8A 3VAKA 3EXYA 2KG0A 4NCBA 5C7PA 2JVRA 1TKTA 2WSEC 5IS2A 1NPRA 3W64A 4LBPA 1QDUB 3RW6A 2E9TA 4WIIA 3UN3A 2MSTA 2RRBA 5EWEA 2BACA 4RR5A 5AXLA 4C9DA 2XO7A 1FDDA 4DQIA 3TRGA 1UKUA 2NQPA 2VFVA 4DV1F 4DPUA 2FIUA 2G2ZA 2OKQA 1TAUA 1XJWB 3DDKA 5ITHA 1SV5B 5K14A 2LQ8A 2XMWA 4I68A 3ZFVA 2VBYA 4F2RA 1R3NA 5EWFA 1SUQA 3IRWP 2ZWPA 1KLMB 5HQ8A 4V19X 2FJEB 1KDNA 2UUBF 1WJ9A 1IQZA 2DNOA 3MM8A 1CVJA 5IT4A 3CJ4A 3BSOA 4ECUA 4GVBB 3KKFA 2AJ1A 5GMKa 3GV8B 3KHGA 1FRMA 1RISA 3GIJA 3B78A 3HFZB 4AL7A 1YRXA 3QGIA 4Z37A 5GAHU 2ZDPA 1X9SA 5D4PA 3VAGA 1H74A 1WF0A 4WE1B 2W9AA 2ASLA 1HNIB 3GFYA 4X65F 2E1AA 3LGMA 1FA0A 2BJ1A 1VQ7S 3ICLA 4MK9A 2X1AA 1I3OB 1RT2B 2CPYA 2QX0A 4RW7B 3TO8A 3UCZP 2NLWA 1S6QB 3QO9A 3MM7B 2A6MA 2U1AA 3MMBA 3QBCA 4KV8A 2YH1A 4QQBA 3RUBL 4ICLB 4EWTA 4USVA 3QWUA 1TKZB 3IM8A 1N36J 1SH2A 3T3FA 1YJTA 3GWCA 3HKZD 1OO0B 2R42A 2ZHBA 1CQNA 4JI7F 1U6ZA 4PG8A 1JLGA 1ZA2B 2EKYA 1A9NB 4ZJOA 1YQHA 2K7KA 5K20B 2OTLS 3IG1A 3R5BA 4JI1J 1JLBB 4TLRA 4DR4J 4IYQA 2HHVA 3R97A 1S4EA 2BVZA 3K0JA 2HZAA 2UUWA 5EDWA 2CWXA 1XQIA 2MQLA 1GMWD 3MAAB 4LSZB 2BOAA 1RT4B 5F3TA 1P8GA 4B3TJ 1O6XA 3PRBA 1WI6A 2AWZA 3FFIB 5IQQA 1QM9A 2OMOA 3OTEA 3WZ0A 2V9KA 2C22A 3DLBA 1FWKA 1YWXA 2ASYA 2MSSA 3L7PA 4IRKA 2N4DA 2HAIA 3BSAA 1UETA 1XTZA 1R8CA 2GMHA 4MIWA 2DHHA 4CRJA 3UW1A 4F04B 3PYFA 1JKHB 5HVFA 4X65J 3OJSA 4KB7A 2HIQA 1OWXA 3LF0A 3UN5A 2V8GA 2P6SA 1IJFB 1MU2B 1OMSA 3A12A 4IFYB 4RNHA 5ETMA 5J2PA 2R2SA 2XWYA 3IWNC 4OV6A 3MM8B 2DRDA 4YOEA 1QAIA 2DY9A 1XEZA 4LSLB 2F4VF 4WJBA 4LF1A 1RAEB 3D66A 3HF5A 4PAAA 5CCMA 3X1LB 4DL7A 3IA0A 2DGSA 5BR8F 2R4FA 1CULB 3MMBB 4LR8A 3VAFA 2W2MP 1HMVB 1S6PA 4QIWD 1U6BA 2VD3A 2HRUA 2PDAA 1PO6A 1KONA 2IM2A 5ETVA 1AYEA 5LSLA 5ETTA 4Z2XA 2OLWA 2RU9A 2WOMB 3MTJA 3FSYA 5DO2A 5K8PA 1TL7B 3IRXA 1TV6B 1RK8A 3P3DA 5KG2A 3QZ8A 3T5HA 1NKEA 4IRCA 3R3TA 5D0RA 5B0CA 4WFXA 3GYNA 1SL1A 1Q78A 2P5VA 1CJKB 3I4HX 4Q2LA 4ECTA 3AQPA 4XK8C 4F0HA 1FRLA 3EGWB 1D3WA 2IM1A 3CJ3A 3BBCA 4DR5J 2Z57B 1IXKA 4U7UK 2UV8A 2AU0A 3FFIA 3NAIA 1PBAA 2HNYA 4Y34A 2CUYA 1N5TA 2HHUA 3OL9A 2IY5B 2VL1A 4IOAQ 2VJVA 2QTWA 4LBIA 5B7WA 1FDBA 2R3VA 4O3OA 2CPHA 4DU8A 7FD1A 4IG0A 1ZYQA 4DQPA 4FBUA 1XN9A 2GQQA 4NCGA 2B6AA 2FJAB 3ELHA 3FEXB 3MEEB 4K4XA 1U7LA 1O5JA 1YVFA 2EVZA 3FCHA 4KV8B 5E7OB 1NLKL 2BMBA 5LMUJ 1BQXA 4U6PA 1RT1A 5H9FJ 2UUCJ 2JEGA 1SJ1A 4GKJJ 2DY1A 5IOLA 3GFZA 1QE1B 2IDLA 3EE3A 2R7UA 2VPXB 5EHHA 2XNQA 4PYDA 3Q8QB 1U26A 1MG7A 1M5VC 4YQWA 1LWXA 2EW9A 4O3NA 2EPIA 1NHVA 2ZE2A 4K4SA 3OUYA 2HNDB 1WF2A 2KT5A 2V34A 1RTJA 2WOMA 3M4XA 4YN3B 3KJVB 4OZJA 4MKYA 2EFVA 1RTHA 2LU2A 4JV1A 2KN4A 3D5MA 4RUCA 4NXMJ 4FPRA 2GJFA 1TL3A 3L7OA 1GK8A 5KTQA 1WHWA 1T9YA 3V6DA 4IG3A 3FZ2A 1VISA 5B0AA 3H5XA 3C2PA 2KFYA 1JXLA 1HHTP 4C3LA 3ZZZA 2BX6A 2YTCA 1LQ9A 1YBUA 2OAUA 3H40A 4I1TA 4QWAA 2XMTA 2IAJB 2HGNA 4FF3A 3ZNUA 5BR8J 1CS4A 4LSNA 1HYSB 3PM9A 1TKXA 4PABA 4UT4A 3HT3A 2GIQA 2HNYB 3D3CJ 1FFSB 2I5JB 1UWAA 1HWUA 1FERA 2CWKA 1I94F 1BUXA 2RILA 6AT1B 3UVJA 1XWLA 4DG1B 3RRGA 3OJUA 4TU9A 3CC2S 5E3AA 1QSLA 3MTKA 5BYRA 1U0HB 3WQPA 4DDFA 2J0XA 4LREA 4NLRA 5CYJA 1HBUA 4QWEA 3G6ES 2FVRA 1N4LA 5MAOA 1D9FA 2CQPA 2VKZG 1G3OA 2CQBA 3KG4A 2Z2ZA 3CJKA 2F63A 1WKJA 3DNCA 3PYGA 5JVHQ 4LQ3A 3EUNA 3ADAC 1JNRB 5J1PA 3AJDA 2YWHA 2AGQA 4TY8B 4J90A 3KK3B 2J9DE 2KZMA 2VPYB 1FJ7A 5IM0B 2W4DA 2XSJB 5LJ3Y 3D1QA 1YDLA 2YH0A 3W5ZA 1RT3B 1GNKA 1RBAA 2HEKA 3IAM9 4DBQA 3SSQA 3MFIA 4DPYA 3CCZA 4ZP8A 5EUHA 1DLOB 3RJMB 3HD2A 5J2QA 3B82A 3O2IA 3OV7A 3IN5A 4F4YA 3CDAA 2XNRA 3J7YI 1DURA 5DDOC 5IWAF 1URRA 2ZUGA 3C15A 3DLKA 2GHPA 2JOQA 3HP6A 4IR9A 3ULHA 3H20A 4DR6J 4B3RF 2K06A 3LP0A 1DTQB 2V2VA 2ZOGA 3EGNA 3NL0A 2YXLA 3GE9A 3AXMA 2GNKA 3OLAA 4NLDA 2C28A 3QQCD 2FGOA 2YNHB 2GO8A 2HHWA 2R8IA 2IAJA 3G82A 4XPCA 2MGZB 1S4FA 2V2QA 3OFGA 1MROA 3T1HJ 2V63A 1PIEA 3CCTA 4OYBA 4ZPWR 2HVIA 4TNOA 1U1PA 3ZNJ1 3CJ2A 2RKIA 4ECSA 2HBYB 3L9ZA 3M9OB 4X4UA 2P9CA 3I96A 4KGVB 3SCJE 3SSRA 2Y9HA 1Y3JA 2I6WA 2BKNA 5DDQC 2C2DA 2OPQB 4ZCIA 4KHMA 1VS3A 3HO1A 1RBLA 2HBZB 1CJUB 2PO4A 2HHHF 2IJNA 3EVWA 2ZJQQ 2Z4PA 4MTPA 2DGVA 1LFPA 4FYYB 4ZPBA 5CYQA 4PG6A 1X31C 1WSRA 5L1JA 4DL4A 3SZ2A 3KK2A 4DI6A 3VQTA 2YKOA 5IWAJ 1G2EA 4RNMA 1HQEA 1TKTB 2DNKA 3HVAA 3LUYA 3R7NB 3QWPA 3V4IA 3BPDA 3LW5C 5T41A 3WHIA 4CLYA 3R1HA 4JI8J 4QPTA 1WC6A 2LCWA 2OI2A 4L73A 4R8UB 3I56S 4LJMA 3RW7A 1IUJA 3ISZA 2ZOMA 5DDPC 2B4UA 2H54B 4PG7A 1S0VA 1GMVA 1OQ3A 3DLEA 3TR5A 1S72S 4M1KA 2O67A 1FTCA 4LRAA 5KFGA 3EPGA 4DCPB 4J9LA 1M1KT 2X1FA 2E7WA 3D4JA 1EX8A 3UE2A 4CP5A 2LYVA 2N3LA 2Y0SD 3Q89A 3JYTA 1REGX 1SL2A 2CRLA 5E2QA 4OZ2A 5HLFA 3BQ1A 2QA2A 2VFSA 3OPKA 1TL1B 4L6V3 2GVZA 1VBXA 3M05A 3GV5B 3FCWA 2DT9A 1MROB 3HSZA 2M8DB 1ICEB 5KAKA 1CJTB 5A8WB 1T9UA 3UR0A 1Y11A 2FHJD 4EK2A 2YNFA 4G3IA 3J7ZT 4EO6A 3MWBA 3SSSA 5LXYA 2VBZA 4QIFA 5IZHA 2H48B 3GONA 3JQMA 1IKYA 4USJC 4XTTA 5IXUA 2BKOA 4P10A 4M5LA 5H1SV 4KKOA 2LP4A 3DYAB 3HPOA 1JWWA 2I1RA 2QYGA 4CTAA 4YEAA 1BLUA 4JI1F 3CJ5A 5KT4A 5IT9Y 1Y5LB 3VV2B 3M8YA 3H2LA 3KK2B 4ELUA 2KFZA 4B9VA 3G87A 1V3RA 4P2XA 2DXFA 3M2UA 3PJWA 2QLBB 4ZMMA 4I7FB 3LP2B 2HFZA 3BO3A 4DLEA 4O0NA 1C1CA 3PV8A 2BQRA 2FLLA 3MR3A 3RR8A 4WXOA 1NB7A 3ZTRA 1HWKA 1WI8A 4QJVA 4MH8A 4WTYA 2FVCA 1WTBA 1FRXA 3IAS9 3N6MA 5FDLA 3RAXA 5L9NA 2XSFA 4DV0J 1NJZA 3RU0A 3DLHA 1FI4A 3OR1A 3NXZA 4YS2A 1RYSA 2ZBQA 1NBEB 4IQXA 2YKMA 4QWCA 1Q7YT 1UA0A 2FY8A 3R9LA 1GT8A 5LMNJ 4K4UA 2BR0A 2VOPA 2WSCC 1TL1A 1RA6A 2EFQA 2HFUA 2KVIA 2RDIA 4RW8B 2R7XA 3DKDA 3HZEA 3UD4P 5KFJA 3V6HA 2KT3A 5F3ZA 3DRRB 3FC9A 4HT5A 4ED6A 4PWDB 3M8PA 2E5LF 5M2PA 3AOCA 5F8JA 1X0FA 3BGUA 1NSQA 3F41A 1PKUA 2CPIA 3UR3C 1XMBA 1ZS6A 1Z1ZA 2NXCA 2XHCA 1WC3A 4ILMA 4J9QA 2G0CA 3O3LA 1FK9A 4JV5F 3F56A 4OV1A 4OI4A 1DAXA 4N8NA 5A2QU 2LDIA 2WAQD 4ZHRB 4HH0A 4OL8A 1TL4A 1TMMA 1G7CB 1YI2S 3U1MA 2QA1A 4WIQA 4B3OB 5KG3A 3CCQS 1UJ5A 3DLGB 2WB1D 4U9RA 1ZTWA 2OTJS 1KBRA 1JK9B 2DH9A 4ZN1A 4X4PA 1VLYA 2CA9A 2Z58B 3GYXB 5CCLA 2KYXA 4CM2A 4DQSA 1YX2A 4TKTA 4WFZA 3IS9B 3B54A 3SEOA 3K59A 2PSZA 3QAUA 3G4SS 1RBOB 2P8IA 2IMOA 3SV3A 2YVSA 3DN9A 4CT9A 3WC0A 5GAGI 4NL5A 4A8KA 3H59A 5A8KB 4DSFA 3TNVA 1IBKJ 5KFZA 4RBVA 1QUVA 3OUYB 1R27B 3FRYA 1GTEA 2SXLA 2FDNA 3BS9A 4FYWB 1WACA 2PEHA 4ZP6A 3W8GA 3WX8A 4YUDA 4GRSA 3KLIA 1HNVB 1YJRA 3L4BC 1FJGJ 3UNYA 4G1QA 3O44A 5I3PA 2ZEJA 2XZDB 4Z7CA 4C11A 4DX5A 3I82A 1VRUB 2CJYB 3W61A 3TZXA 4LMZA 4MKBA 3OL7A 3AD7C 3K5OA 3TJ8A 3IBFB 3ENVA 4B3OA 2DITA 4A8YA 3QRRA 1X5OA 4U7CA 3BH6B 2LU1A 3E2EA 3MM5B 4RL1A 2L41A 2BZ2A 2RF2A 3M8PB 1M5HA 1SJFA 1Z2ZA 4WCEQ 4K0KF 3VZIA 3HFKA 2FVQA 2A2CA 1YJ7A 2R7SA 4BS2A 4L75A 1X4CA 1URNA 1RLCL 1JNZB 4RW8A 1FKPA 3H2UB 4DV0F 4KSEB 4O3QA 3GFHA 1S7IA 3I4PA 3KLFA 1QJHA 1UWBA 3D7SB 1S1UA 1NZ8A 4PUOB 2KZZA 3FJ2A 3AXKA 4UOCA 4DPWA 1S7HA 2KXHA 1WC0A 1IKWA 1T0TV 5EX0A 4ZVEA 3VAIA 1EB0A 4C4WA 3IG1B 4IO1A 1RSCA 4KH1B 1C2PA 2C2NA 3OTCA 4C6AA 1LWFA 3T5KA 5GMEA 1RT5B 2D9OA 3H42A 3LWMA 4JV2A 2XLJA 4FNIA 4DL5A 4AL6A 3HSJA 4DF4A 2UV8G 2X51A 2HURA 2AF6A 1PCAA 2EFNA 2DNQA 4HHUA 2UXCJ 4DUYJ 3K7RA 2Q79A 2ZVIA 2B5JA 3AB4B 4DJBA 5L1IA 1D09B 2XSJA 3HJVA 2J0QD 3SCLE 3TX8A 1P6TA 2CQIA 3OTOF 1RAAB 3QT6A 2LEPA 1Y4ZB 2CDQA 2ZC3A 1HNXF 5KFXA 1C0TA 2JL9A 3S8SA 4P74A 2HHHJ 4ILRA 1PSDA 1S1XA 2A3JA 1TL5A 4RLEA 4F67A 1YJWS 2JX2A 2J6SA 1RAFB 3OD2A 2PA3A 3T1YJ 4I4BA 3M2VA 4P2SA 3RB4A 2XS7A 4QYZK 1NPKA 1UVIA 1AUSL 3J7A1 2DGWA 3TP2A 3KXDA 3H4BA 1Q16B 2HQIA 3Q8RB 3CNQP 3IP0A 2KVQE 3NMRA 7AT1B 1HFEL 3LP0B 4KAIA 2HZCA 5L9XA 3VGSA 5I42A 1YHQS 2L48A 3QYYA 4E8UA 5KFUA 5KFOA 3BYPA 1F5CA 4K2XA 1JJHA 3RBDA 1ZPVA 2CZ4A 4G6VB 4DR3J 2RUSA 2KRBA 4Q8EA 4LF8J 1FEEA 1E6YA 2VICA 3ETMA 3W63A 3DDNA 5KFKA 2R8HA 3QT7A 4QIEA 2XEXA 2IRYA 4DV7J 4K8RA 4I2QA 4ZVOB 1PJ7A 5ETPA 4M95A 4GKKF 5C42A 4DR2J 3ET6A 4UW2A 4IUFA 2BE2B 2GVDA 3LALA 4O4RA 5C25B 3J81U 1F5AA 1YJ9S 2UXDF 1VQ5S 2B7CB 2AJ2A 1HI8A 3H25A 3V81A 3MR7A 4OJHA 4X4NA 1TL7A 3IRXB 4AFFA 2FLOA 4NWBA 3VAJA 4CM0A 2ZBPA 4ED1A 3PZPA 4DQQA 4LR7A 3DRPA 5BXIA 3GQCA 4ANEA 5DM6Q 1CJUA 2JC1A 4DSEA 4JI5F 5BYQA 3VZHA 1U47A 5IT9U 2ZITA 4Q43A 1U09A 3BR9A 1IVZA 2CQ3A 4Y65A 3M8SA 1U1OA 2E5HA 4OX7A 3JSYA 4BBYA 3J80Y 3MZIA 2Y1LB 3WIUA 2MPUA 3EGVA 4XIUA 1HBMB 1SC1B 3K58A 2DO4A 3H8YA 4ENOA 1IKXA 2J5AA 3GR0A 4EGLA 4DV4F 3HK2A 1FNMA 2LQ5A 4OI2A 3W2WB 2GVZB 3JS9A 4J9MA 4ED8A 4I64A 4MIAA 4NCGB 4J9RA 1SB6A 2DXDA 2X7IA 3CC4S 2VONA 3CULA 4USUA 2VQFF 1JJ4A 4B9LA 1U2CA 3M1VB 2UUTA 2DNNA 2J0WA 3C66A 5DS7A 4MK8A 5KT5A 5E3CA 1Y9OA 2BE9B 3O5TB 1YBAA 2DPJA 3NCQA 2W4CA 4L3KA 2UVVA 2RQKA 2RHQB 3MCMA 2IVYA 1D9AA 1HPZA 2CPEA 2HHSA 2GA7A 3D6FB 1RWKB 2RSQA 2V4RA 3KDOA 2NXJA 5KT2A 3NCPA 3SQOP 2XB2D 3S6EA 3GU0A 3B4MA 5C25A 1VQ8S 1S9GA 4P2MA 2FJDB 2PGCA 2DHAA 2ZE2B 3H4DA 1FKAF 4EZ6A 1Q8IA 1BE4A 2WBMA 3KLEA 3AFGA 1SCJB 5GADI 5K14B 1KQKA 3BSCA 2FLNA 1Q53A 1O51A 1FKOB 3NGTA 5MLCV 3TAPA 1TKXB 2VBWA 2K2PA 4NLOA 1UEVA 2DTJA 2DYAA 2J8AA 4ZCKA 5M2RA 4N8OA 2VFTA 1WC5A 4HR2A 3KK1A 3TAMA 2W9BA 4PQAA 1WNEA 4AL5A 4I2PB 3VR1A 3HSDA 3LPYA 4NEYA 2MHNA 3HKWA 3PEJA 5RUBA 5F8HA 3VAMA 2BJ9A 1M1HA 1EIYB 1HBUB 1HBOA 2CADA 3FMBA 3CUNA 2L08A 3MM6A 2D69A 1AFJA 3VGTA 2CPXA 2M8HA 3DRXA 3MF5A 4LF7J 3L7UA 4RW7A 5DETA 3LP2A 3DGVA 1KRPA 3QZ7A 5D6GA 2GAGC 1YITS 3OVSA 3QJJA 5KFHA 1CQMA 3P8BB 3GJQB 4A48A 4CDIA 3DM2B 3I0RB 1SUQB 2RQMA 4B08A 2PI5A 1OIAA 1UP1A 1WUUA 1PYOB 1H73A 2CQGA 2YX7A 4PPZA 3U27A 4X4TA 1WDTA 2B4VA 3A3PB 3FMWA 3MAAA 4WK3A 1NK9A 2WVBA 5IV4A 3CC7S 2HHPA 5KG5A 4ECXA 2EC0A 2MYFA 4KHRA 3NGDA 5L46A 1SIZA 4IOCQ 1S0NA 4KBIA 1VIOA 2E29A 2YNIB 3HVTA 3TARA 1NH8A 1P1TA 1RT3A 5B0DA 2CAJA 3D28A 1R8AA 5AXKA 3QRPA 2HHTA 5A6WA 1CULA 1U24A 3DOMA 2HFVA 2FZKB 2MKSA 3HHKA 3V5RA 3C6UA 1YLXA 5L39A 2UUBJ 1Y7PA 3R8YA 1XNQJ 3CCSS 4JYAF 2G13A 3SIPB 4F25A 2X1BA 3HJFA 4R0JA 3TUIC 3P96A 2CJAA 5C24A 1DQ9A 2IDEA 2CJ9A 1RTDB 2RRAA 3OFHA 5F0WA 1KNZA 1K0VA 4NX9A 3FCVA 1HI0P 5A8RB 5EX3A 4ZVGA 2HWTA 2ATLA 1SC6A 2EI5A 2YWGA 1JLCB 3QLHA 4AD6A 3LGHA 4OLOA 1T11A 5F8GA 1JLBA 2N4CA 3G8QA 3HCXA 2ZOFA 3NWGA 3JAMU 3OSPA 3VTIA 2DR6A 2MKHA 4OZNA 5D0EA 5LL6d 1I6JA 2RNEA 3G6YA 1NU4A 2YQ1A 3E01B 3D0GE 4ED2A 1B64A 3DRSB 2R7WA 1CEZA 3EGZA 1FWPA 5KFIA 2FJBB 3DU6A 1N0UA 3HI9A 1VLOA 2YKQA 1L3TA 3OTBA 4FKXA 1ULRA 1NDPA 4HH1A 5KFDA 2OPSA 1S5ZA 2DR5A 1UW9A 1IBLF 1HNWF 2V2KA 4C0HA 4IFYA 1S1UB 4ZK7M 2CNNB 4QR2A 2MGZA 4LVOP 2DNZA 5D4LA 2OHDA 3EX7B 1WF1A 2LLZA 3DM2A 1YIJS 4G1PA 3RR7A 1KVJA 4HT7A 2JSXA 5C24B 4WFBQ 1WORA 3LOUA 4RNNA 3OXLA 2I38A 2X3DA 4GO5X 3PG9A 1NK4A 4YHHJ 1N5SA 3DFEA 2VQEF 2CQ1A 1CLFA 2LECA 1TV6A 2POKA 4RW9A 1WC4A 4Y6IA 1UZHA 4NLSA 4PKDB 4O3PA 4DMZA 3CGIA 1YJNS 1Y3KA 1F0XA 2ASJA 2KJVA 1JXVA 1U1MA 2GC8A 1TELA 3HLUA 3CJ8A 3C6UB 2WTFA 4OYAA 3DGPB 3OVAA 2VBXA 2I9SA 3RYLA 5JMNA 4ANCA 4Y2KA 4RJVA 5HVGA 2VFRA 3ZTPA 4CLUA 2XLIA 3DXBA 1NUEA 4K5RA 1KWMA 1UW4A 5CYMA 1V5IB 3W2VB 3W65A 1W25A 2MQQA 1ZM9A 1Y5IB 3L3CA 4ECYA 4BWMA 2MZSA 4RW6B 1U1QA 2HAFA 3IR5B 4ZPVR 2M0GB 1H2VZ 4AYBD 4C8ZA 1ZZFA 2KB2A 2ZD1A 4QR0A 3K8VA 3J80U 2B9XA 4IQMA 2W01A 2HS0A 3POTB 4WYWA 4DG1A 2B51A 2FHOB 3AQOA 4ES2A 5BYSA 2JDJA 2QMWA 1QAYA 4OI6A 3G2XA 4Y2CA 2H5IB 2AIRB 5IFMA 1B3TA 1HBNA 1HKAA 2DXEA 2AEMA 2JLGA 2O66A 3KLGA 3WIVA 3RAQA 4GVBA 2V69A 2OELA 1RTIA 2KI2A 2WONA 1F3FA 2BE2A 2GVDB 3PYDA 4DN0A 4DOZA 4AT1B 1K47A 2FQQB 1EP4A 2BM1A 4PZVA 1U02A 4PQUA 4X66F 3LP1B 5E3PA 4JB8B 3NP5A 3OL8A 5KG1A 3OR1B 1PBUA 2HFSA 3RGIA 5CHCB 2VASA 4FYVB 4MYTA 2CZ9A 4OX8A 3V6DB 2AQ4A 3ZTSA 3UNGC 4RZRA 4DWIA 4FF1A 4C8OA 1PC4A 2RDDA 3VVTA 1HNWJ 4PWDA 5A2QY 4WU3A 1FJGF 2ZH1A 2DGTA 5A6PA 2HKEA 4DUTA 5CD4A 1TK5A 4DV2J 2NUHA 4C7QA 4Q0BB 4HACB 4DX8H 1XERA 5ADZA 3ENWA 5D77A 5GAHI 2N3OA 4TXSA 4P73A 2BRLA 3E3XA 4LFAF 2WBRA 3GP9A 3MM9A 4WFNQ 1WDDA 3W2WA 4WP9A 4F4WA 3CCLS 5KOXA 3KG0A 4AQYF 1M5OC 4KRWA 2UU9J 1FNOA 3OR2B 1EQ0A 5HP1A 2D9PA 3M1VA 4J37A 4J9NA 3M7VA 3WBZA 2ZH3A 1UVNA 4HHHA 4I6YA 5CABA 1VQLS 4QR1A 2HW3A 2FJVA 1IKXB 3ZZRA 1FK9B 4F2SA 4ZVFA 1REVA 4JBCA 1UJ6A 1C0UB 1WG4A 3A3NB 1H98A 2JNJA 2YWWA 1S6QA 3CDWA 1MWZA 3SFGA 1HNVA 3BN4A 2EG1A 3U1LA 2WVDA 4ZLJA 2QE5A 5D15A 3NOGA 1XR7A 2M9KA 4F3MA 2HVZA 1NDCA 5THWA 3T9NA 4CZCA 4LFCF 3CSKA 4C8YA 2FHJA 2J6TA 2DR9A 3IM9A 1Q95G 2XZWA 2QSFA 5HMYA 4DEZA 4YDDB 2AJFE 3FSXA 4O23A 4CIOA 3KHHA 3MECA 3BZQA 3HT0A 1FE4A 2FJWA 3PX4A 1Q8BA 1FFGB 1OY8A 2GQCA 3LQVA 1EP4B 2PMHA 3M8QB 2ZHOA 3IGVA 4KPCA 4UTGA 2RKIB 2DH7A 2M3DA 5CYQB 2AHOB 2QMUB 4H4MB 4LUBA 3KK3A 1KN6A 3OHBA 1Y5NB 4NI2B 4G1QB 4ID8A 1T7PA 2WONB 3BGFA 4QOTA 5J1EA 4MK7A 1XMQJ 1QTMA 4NXNF 2HWHA 4C3KA 2YNHA 2K3IA 3M6XA 3MR5A 1VC6A 2BANA 1D8ZA 1Q86T 1J5OB 4LF9J 2QA4G 2DNRA 2V8HA 4OJ3A 3G86A 5CAAA 4Q0BA 5D3GB 4ZPTR 1MMDA 4NRUA 3ZZUA 4QU7A 2AT1B 4KKOB 4PRFA 2COLA 4KO0A 2WSFC 2OD6A 3CCMS 4N41A 3UDLA 2W7AA 3NS5A 4NXMF 1JIHA 2A0FB 4CO0A 3OLBA 3RBZA 4ETXA 3GV7B 1KEKA 3LWLA 1R8PA 1T3OA 4ZLPA 2PE8A 2QO3A 1EETB 1Q0NA 3D54A 3HHEA 5F8IA 4N56A 1X4GA 2F8EX 5KFWA 3A8JA 1RHKB 4JI8F 1TP7A 1BWEA 5JUMA 3NRBA 1MLAA 1EKSA 5K8OA 4DFMA 3JSMB 4CH7A 1S9FA 4UOGA 1RQ0A 1RT5A 1PJ6A 3PKMA 2JC0A 4ZPCA 3OR2A 1JXEA 2NREA 1YZ6A 3TAMB 2W9BB 2HHQA 3MMCA 1T94A 1RP5A 3VQSA 1SKSA 3VF0B 2EG2A 4IOBA 4H4MA 5DLFA 3DOLA 2Z30B 2LQ9A 4LR9A 3THTA 2ZBRA 1NK8A 1Q7LB 4DR7F 3M30B 4HHJA 3MR6A 2GZOA 3DDIA 4J9OA 1LWFB 2FYXA 4OX6A 4F4XA 2F7VA 3CJQA 2P9EA 4Q2MA 4DS4A 3L09A 2AJQA 3Q8SB 2GS8A 4NA2A 3ZC4A 5LOQA 3KFWX 2H1YA 2C3UA 2DNHA 3NG8A 3JTOA 4ZLNA 3EYZA 4BC9A 3G8SA 1ZBTA 2HLUA 1CS4B 4LSNB 4JV0A 2CVEA 4ZN3A 3C19A 2P6TA 4P75A 4UUWA 5I4MA 4DV5J 1XMOJ 1B70B 1FTRA 2PMWA 4TN2A 1HNZF 3JXOA 2E7XA 4ZVHA 4LFAJ 4O44B 4DR3F 2C2KB 2ABYA 4O4GA 4ZCMA 2H9ZA 3T5LA 1RWXB 1RKIA 1E6VB 4I56A 4M5MA 1UCNA 4FXVA 1VC5A 5CH7B 1X5PA 1KC8T 4AXJA 2HVEA 1TMJA 3AH6A 4OYOA 1HYSA 1FE0A 3FBFA 4LRDA 5E3RA 2EC2A 4X4RA 3A13A 2W2OP 2AJ4A 3FUYA 3H7HB 2ZJRQ 4ERDA 3PHTA 2CQ4A 2O01C 2ZBCA 8AT1B 4DCJB 4DR7J 3OT9A 4IG3B 4QYRA 2F4VJ 4PXCA 1EETA 5HBMB 1N36F 1BD6A 1B0PA 4QZVB 3UVJB 1N88A 4OLPA 1T05B 3RRHA 1AROP 1CJVA 4HDHA 1U2RA 1MW7A 4USHA 4WYLA 1ZPWX 3Q8PB 3G96A 4FP9A 2VG5B 1LW0B 4W4MA 3VHQA 4HL9A 4ZVPB 3K17A 4ED0A 4B9UA 1SJ4P 2AYGA 1HD1A 2XY5A 4GVLA 4IKAA 4OJGA 2VC1A 3ZXWA 2OPSB 1X9WA 2QLXA 1SKWA 1XC9A 3AB2B 4DV6J 4HEA9 2KFNA 2A10A 2MJUA 2W2PP 2ILYA 2Z56B 4C97A 5I3QA 1KS2A 3UFCX 2YWFA 2LXIA 1F5BA 3IS9A 4P2FA 4DL3A 4B3SJ 1X8DA 5G0RB 1BWVA 3E01A 1B0TA 3RBXA 1RT7B 4J9PA 3PW2A 3FEZA 3T19A 3SCKE 4QIGA 3CJKB 2AYEA 3ZTQA 4F26A 4QYZJ 4LF6F 1S1VA 1TZ0A 1BXNA 3PFEA
chains in the Genus database with same CATH topology
3KHLA 1TK8A 5J2MB 2YX1A 5GAGU 1S99A 2EBEA 4Y00A 2B7BB 2B9WA 2R7OA 4ZHRA 2IRXA 1WHYA 2V0NA 3JSRA 5I3UB 2QYCA 3MPWA 4NLUA 4NPOA 3KLGB 2KU7A 3LGNA 4OI0A 1K0TA 3AA9A 2ADCA 3PIOQ 3EPIA 2FTRA 4USIA 4M94A 2VG6A 3C8YA 4YR0A 4HI1A 3ITHB 5J2QB 2HNZB 1FHTA 4OQJA 4K5SA 2IMWP 4B9MA 4PG5A 4YR3A 4ZP9A 3IO1A 4X4OA 2VUGA 3KK1B 2GCFA 3T1HF 2HYIB 4FBTA 1P27B 3N6LA 1FRIA 1IM4A 3Q22A 1HMVA 2NZ4A 1J2VA 2GMLA 3VALA 1VQ6S 1L3UA 1HWJA 4LSLA 1OPIA 1HWIA 2FVSA 2FPHX 3HHLC 3V4MA 3A8EA 2LXUA 1YSJA 3NNCA 2ZH4A 3BDEA 3PKYA 4NZ6A 4IRDA 4OIXA 1N48A 1TFYA 1CC8A 1JLEB 2BUNA 3BREA 1D0EA 2CZVC 2JZ5A 1HQEB 2CQCA 1QSSA 3BGRB 4N47A 1X4BA 2ILZA 2EWHA 1VQNS 2KG1A 4D3GA 2CQHA 3DRYA 3HVTB 5D78A 4JI4F 2YKNB 1Y00A 1UJ4A 5A8WA 1RAJA 4NRTA 1H0HB 4A8XA 5G0RA 3IGNA 4C0OC 2FB0A 2Q1LA 4IG0B 4J5OA 3KLVA 1DJ0A 2CKWA 4C0BA 4DLGA 2NPIA 1N56A 3JAMY 1H2TZ 1WG1A 3R27A 2JWNA 2ZZNA 2ASDA 3O8WA 4NYPA 1Q81T 3KJVA 4HKQA 4ZPDA 1JJ2R 4DN9A 2KHCA 1KLMA 2HS3A 2OO4A 3HVWA 2RT3A 2DD8S 1FF2A 1N5QA 3DHXA 5HMZA 4TQRA 2E5GA 4CQ1A 2JLFA 4FNHA 4LFBF 4KGMA 3QJPA 3BQ2A 2PN6A 3HDSA 5DLGA 4J9KA 5HP1B 4M63A 2C3OA 2MQMA 4LT6A 3N28A 4MJKA 1NK0A 1GAOA 1VOMA 2MJNA 1KD1T 4PXBA 1RT2A 1DTTA 2F8MA 1XK8A 4KE5A 1H38A 1AW0A 4A8OA 4QW8A 2XMKA 2G1DA 3OHAA 4M5DA 1V6HA 4WE1A 4KHPF 3P49B 4CO4A 5KFMA 3GMGA 2XCPA 2W24A 1NRKA 4X62F 2XWXA 2WW8A 3QAEA 2R7TA 3CWJA 4DFJA 2IBOA 2HFNA 5DG7A 4DSLA 4ECRA 2GV1A 3GR1A 5KT3A 4BCAA 3PX0A 2I5JA 4RW4A 2ZNZA 5KFLA 3UCUP 1S10A 4RBTA 1NNDA 4CNZA 1GXUA 2W8KA 3DLGA 1MMNA 2F9DA 3BF4A 3MMJA 2V4QA 4P6QA 5DM7Q 2UVWA 3OXGA 3OBIA 1HD0A 4DR4F 3HHDA 2NS1B 3Q23A 1RWUA 3KLEB 2QIFA 4DL2A 1KVIA 3M6UA 2AV5A 3NMAA 3CDBA 3FGVA 4TY8A 2R8GA 1G6BA 2YNGB 1U6FA 1Z4UA 1H2UX 1KFSA 4L72B 1QVGR 3BQ0A 4DV3F 2QMXA 3WX4A 5G4DA 3FDSA 2MY8A 3PVXA 1FDNA 4QIVA 4YB6A 2UUAF 1T95A 1S9GB 1FCAA 4KO0B 2DB1A 4YB5A 1N6QA 1S48A 3OFEA 3DOLB 4OZ5A 5EWGA 3DLLQ 4LF5F 1WEYA 1UMJA 2F1FA 4ZDNA 3KLHB 2YKNA 1ZM4A 4C2MA 4ECQA 4NLYA 2ZHAA 3EZUA 4OZLA 2J6TA 1R43A 2RUGA 1MWYA 5SZTA 2BXJA 1AUDA 2E5JA 1DBDA 3LP1A 1MU2A 2VZ9A 4I2PA 2ZNYA 3RZAA 2RRNA 3SQGB 2B6AB 3MEEA 2DBBA 4A47A 3QIPA 4CO2A 2XMVA 1SL0A 4IH7A 2PA8D 2YKPA 1WEXA 1L3SA 5L8RC 3TA1A 2BQUA 4DF8A 2AYMA 1HPZB 3T1AA 4R8UA 1UL3A 3J7YU 3MMAA 1SBRA 4N77A 5GVQA 3FSIA 4NZ7A 2ZJPQ 2J9DA 3GG1A 1IKYB 2M4MA 3MEGB 2MQNA 4ES3A 4KJIA 2EK6A 5K9FA 3FVYA 2NUUG 5E5NA 4K4VA 4MAKA 4C11B 4HVZA 2W7OA 1KLNA 2OJ3A 2NR0A 1NJYA 1WELA 2MHEA 2RIJA 1E6VA 3G71S 4DV6F 4RU2A 4OHXA 2HG4A 2IA6A 1S9EB 3MOJB 2LQJA 3AAWB 1IKWB 5HN0A 2KZMA 2W9CA 1JLCA 3QLHB 4ILLA 4EBDA 2GGPB 3ISND 2Q3PA 1T3NA 5KFAA 4CNYA 4HYKA 3KLHA 3IC1A 1VHFA 4TU8A 1ELOA 4RWXA 5HROA 1FJEB 1VQPS 4YP3A 1N6QB 2UXCF 1JB0C 4YHHF 2VODA 1HARA 1HA1A 1LKZA 3E51A 2D3OR 2FC8A 1NZAA 3M2VB 1D9DA 3SQGA 1FRJA 2APOA 4P7TA 2VC0A 4UQTA 1H3DA 4FN5A 4X64F 1LK5A 1WTFA 1B7FA 1E6YB 5J2NA 4UQGA 2D7SA 3F44A 1S1WA 3N5FA 4EUVA 2QZ8A 4ED3A 1KQGB 3MHYA 2XHWA 1IBKF 4U67Q 3PIPQ 4RX6A 1ZETA 4P7VA 3FRZA 2M70A 2VPZB 3CCJS 3HM9A 4QPXA 4IH6A 1UEUA 4NLQA 4Y2MA 5KT7A 3PW4A 1LWEB 2YWKA 3BJYA 3MAHA 3MR2A 3DRRA 1SJRA 3PW5A 4WKYA 1D8YA 2LKZA 2V4JB 5I3UA 3MEGA 1ZTTA 2RE1A 5K8NA 3DRPB 2UUCF 1N5YB 3N9UC 4ID5A 1M0SA 2EBGA 1D1UA 2RH3A 4RUHA 4WFYA 3THPA 5E3QA 3SDEB 4YFUA 2E1CA 3CJ0A 1T03A 2UVRA 4NMLA 1GXLA 4LIRA 3CD6S 4XPEA 4ECZA 3NBPB 3EZ5A 1VK3A 4ZS6A 2OMLA 4NLWA 2CIMA 5CD4H 1VC0A 4ICLA 1N32F 4CH1A 1PILA 3MPVA 2MXYA 2A2DA 4OHWA 4K4ZA 5F8MA 3M9MB 2QSWA 2C3MA 4ECWA 1N0VC 3GIMA 5IQ6A 3B4DA 1QUPA 2BJEA 3QIDA 5KFYA 4OHZA 1N8RT 2IM0A 1KHVA 2C2RA 2DIUA 2DVIA 4NLXA 4ATNA 3KYLA 1W2IA 4IFVA 1Y0HA 3TVKA 3UDCA 2L9DA 2KT2A 3GSDA 4WXWA 1S6UA 2XMMA 1IKVA 2QFJA 4B3MF 5CYMB 3US5A 1M5PC 3K5PA 1KOOA 3MM6B 4HTJA 5AXNA 1VQOS 2BQ3A 1U1LA 2ZDOA 4DSKA 3GZ7A 3QJLA 2CYYA 2Q43A 4F3QA 3QPIA 2ZC4A 3WDOA 4Q5VA 5T14A 2ADBA 1TK0A 4TYBA 1T8EA 1UVMA 1TAQA 5DG8A 2KDOA 4YR2A 2DRAA 3CF5Q 1X7VA 4MIBA 3KOAA 1FO1A 5FJ4A 3P5TL 3M6WA 4FVMA 3KLFB 3QGGA 5DGAA 1HQUB 2B3TB 3BO2A 4KC5A 4JI6F 4OHYA 5JVGQ 2CPJA 4LF8F 4DUYF 2J7UA 1FNXH 4OX9F 3TW0A 4DV5F 4ITSA 4PUOA 1JLFB 5CZXA 2FUG9 4PR6A 4LVNP 2RB7A 3LAMA 2MQOA 3BDPA 3LAKA 4HI2A 3BO4A 3KMSA 2AX0A 2ZM6F 4M5DB 5J1NA 2HGLA 4B3SF 2M5YA 2FD2A 4HTIA 2ZKUA 4CT8A 4F4KA 4X2BA 2V8VA 2JEJA 2HHXA 3MD3A 4LIWA 1YJUA 1S1VB 2MB0B 3CD7A 3NBPA 4TU7A 3JYTB 2CG4A 3T1YF 4XDCA 4RU9A 4ED7A 5DGBA 1SH3A 3MD1A 3MECB 3TUZC 1RKJA 1LOUA 2LEAA 3ISNC 1NHUA 1S49A 2IYIA 3IBWA 3AY0A 3T5JA 1R0AB 3LH2S 4N76A 1M5KC 3G8TA 3AJ2A 2BW2A 3N01A 3TOQA 4W92B 4KTQA 1VMBA 4R25A 1HI1A 2HGMA 1XNRF 4L3NA 4BWJA 1IKVB 4H4KC 3BM7A 2EFOA 3I9V9 1C0TB 5F41A 1HL6A 3MUVP 1N5VA 1Q82T 2M52A 3IWXA 2XBPA 2BRKA 1REVB 3M32B 1DHMA 1KQFB 5KFQA 2RU3A 4Y2IA 1Q8LA 5J1EB 3MCSA 3MEDA 2CJQA 3I0SB 1R7IA 2MDAA 1N52B 1L5UA 5HMWA 3HXMA 2E44