2AZ5A

Crystal structure of tnf-alpha with a small molecule inhibitor
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
148
structure length
132
Chain Sequence
DKPVAHVVANPQAEGQLQWLNLLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tumor necrosis factor (TNF-alpha) (Tumor necrosis factor lig
publication title Small-molecule inhibition of TNF-alpha.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine
total genus 22
structure length 132
sequence length 148
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00229 TNF TNF(Tumour Necrosis Factor) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.40 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2az5A00
2WNVA 2R30A 3AB0A 4OULA 5KC6A 1A8MA 2KA3A 1JH5A 5HBAA 2RJKA 2JG8A 4G4FA 2JG9B 1TNRA 5CIRA 4GIQA 1GR3A 2X29A 2OIIA 1PK6C 1XU2A 1I9RA 2AZ5A 4OUMA 4TSVA 2R6QA 1DU3D 5KWRA 2HEWF 2Z5WA 3V56A 2QDNA 4E4SA 1OSGA 4MXWA 4RSUA 4D7YA 1JTZX 2WNVB 4F3JA 4MXWB 1KXGA 4TWTA 4J6GA 3URFA 2JG8B 1U5XA 3B9IA 2TNFA 3WD5A 2WNUC 3LKJA 1TNFA 1D2QA 2WNUA 1O91A 1RJ8A 1PK6A 1C3HA 4DB5A 4QQHA 2RE9A 4MXVA 4MSVA 5TSWA 4EN0A 3TYJA 5BNQA 4QQLA 2E7AA 1S55A 2JG9C 2O0OA 4QQPA 1D4VB 1C28A 3MI8A 4NN0A 3K51A 4KGQA 1WCKA 4G3YC 3QD6A 2Q1MA 4HT1T 3B93A 3ME2A 3TWIA 4KGGA 3QBQA 3L9JT 2WNUB 1RJ7A 1PK6B 2QE3A 1D0GA 3FC0A 1OQEA 2RJLA 3K48A 2WNVC 1KD7A 1ALYA 2ZJCA 1OQDA 3IT8A 4QQ2A 5L19A 2HEYF 2JG8C 1DG6A 3ALQA 5KC5A 2HEVF 2JG9A 4N90A 2R32A 4QQOA 2Q8OA 2ZPXA 4KG8A 3B94A 5L36A 4QPYA 1U5YA 4E4DX 1XU1A 1U5ZA 4OUSA 1IQAA 2TUNA 4DOUA
chains in the Genus database with same CATH superfamily
3DGTA 2WAAA 5LBFA 1KRIA 5CFCA 3RMYA 2WKKA 3SH5A 1CIWA 4NRPA 3T0AA 4IE4A 2RM23 4OMDA 4CEYC 5JSPA 5C71A 3NO8A 1DQ2A 3AMNA 5KHJA 5A6QA 4AEKA 1F15A 2OPKA 3DPRC 3FHAA 3KHCA 4NRMA 1ONAA 3DV8A 4QB6A 3MO4A 5B4XA 1W0PA 2OVUA 1BKZA 2OT7A 3HN3A 3J9SA 5J7MA 5FV3A 4P9GA 3POSA 2GP5A 2PHFA 4IEOA 2R6QA 4PI2A 5J3UA 5KWRA 5ACA1 1H8TB 1O6UA 1RGSA 1GNHA 2DVDA 4V2VA 1ZRFA 2CWMA 1NA1A 4PT6A 4UF0A 1JYCA 1T6BX 3EBRA 1SDWA 1SFNA 1RUE2 5CKQA 3MIGA 2I07B 4D69A 1GKBA 1AR63 2Y64A 3D0SA 4Q2FA 4XZUG 5C8CA 3H3LA 1NCQA 4IV1B 3WNXA 5JZGB 2DWRA 1NOVA 3FUQA 1SMVA 3P3PA 4LBNA 4UWDA 3TRSB 3RZKA 1POV0 2JG8B 2VY0A 3WY6A 4XFAA 1XJAA 4FFFA 3MIEA 3U75A 2DVAA 2EVXA 1HRI3 3ON7A 2A1XA 4IGQA 2B45X 5FPVA 5FZLA 4DB5A 4A2UA 3JUUA 1YRZA 2XB6C 4ZZ5A 1FX5A 1DGRA 4XUOA 4ZZ8A 3AZWA 1CJDA 1JI6A 4YFWA 2VTXJ 5IYYA 1OT5A 4L2NA 3MW4A 1CZSA 4BQXA 4CDUC 5C70A 2FMDA 1N1VA 2HWE1 4DIQA 2VCBA 1W8UA 2JE9A 5JOYA 4GH4A 1JHJA 1PGW1 1JHNA 1XOYA 1XSQA 2JIJA 3AP4A 3PTRB 2EIBA 5JXJA 2V5DA 1H1AA 2WWJA 4EN8B 1ZM1A 3NAPB 3V0AA 2JE8A 2XBO2 1Q8OA 2QFEA 1QXPA 4YZ2A 2YYOA 4HN0A 1OLMA 4FQZA 5JPMB 4LO4B 1QJEA 2UWAA 3LAGA 4HSJA 1H1MA 4LHKA 5CEHA 2VMEA 1JZ5A 5LEKA 2DCZA 4BOWA 3LDBA 1CWPA 1DYKA 4IEWA 5GJ6A 2IXCA 3IT8A 3NNGA 3MLLA 2BVBA 3RVHA 5C7GA 4CDQB 4K3UA 1AUYA 3J8F3 5A7NA 5IK5A 2WA3A 4AI1A 4C8DA 5KHKA 2FCTA 2XVGA 5LK5A 3OUIA 1F35A 1PVC3 4XFIA 4JGZC 3JBG2 5I8YA 3S0MA 2F4PA 2QQJA 4HVOA 1F5JA 2EAAA 1JS9A 3AZXA 2R0FA 2WUHA 4OLLA 3ZO0B 4OQ8A 1NKGA 2ORZA 4CP9A 1PM4A 3WW3A 3EO6A 5FR3A 4TYSA 3WW4A 1O3SA 4XABA 1RUC3 3VBOA 4Q4W1 3ZSKA 4HKOA 4HVRA 5IVCA 5FXWA 2ARBA 4Q0QA 5LA0A 4GB31 4IEVA 3G7DA 1J83A 1O59A 4MGSA 4UAPA 3T1MA 4D0QA 4WM7A 1G9AA 2VUDA 4MLOA 3FHIB 3WT3A 3CDZB 2D5HA 5AC91 3VL8A 1S0FA 3ORJA 3AKPA 4IUGA 1DCSA 4N53C 5LRRA 2P34A 2ZTNA 4DRRA 4I2OA 2RJKA 4FOYA 2RDSA 4BCUA 2PN5A 2RR13 2XJRA 3OB8A 4QKDA 5FY4A 1AVBA 1LEMA 2A6WA 2YG0A 1N1SA 1R092 4XHXA 2X05A 1PK6C 2JE7A 1H2MA 3IWZA 4LKDA 5C9AC 4WZCA 1DQ5A 2X5IB 1NLQA 1SG3A 2Z42A 4AGRA 4CDWB 1OD3A 1AXYA 3IMMA 4KWJA 5DN2A 4FI9A 1S2EA 1UMZA 1AYN2 3WEZA 1JZ7A 3I49A 2XJUA 1YNAA 3E6BA 4AFMA 1UOBA 4F83A 4AR2A 3CJIC 4YARA 3ST7A 3IZOA 5DG2A 3SNMA 3JD72 4AAXA 4D3WA 1JTZX 3WNNA 4YW4A 2A73B 1I5PA 3HVDA 2ZKNA 5IAVA 1PGSA 3URFA 1BHGA 3AJZA 2LW8A 1LECA 3BODA 3CU7A 3KM5A 4QU1A 4AVBA 3O1UA 4QWNA 5IT6A 5JR7B 1RMU2 1HV1A 2CY6A 2ZCWA 3D82A 4QX1A 3U78A 1UKGA 3VBHB 1CAUB 3VBFC 1JZ8A 1QOSA 4R9DA 3RZMA 2EAKA 4COYA 4UFJA 2GN3A 1NE4A 1F31A 1SDDB 2E26A 2J1AA 4QQHA 2CL2A 2K46A 1OVSA 4ISQA 5AVAA 4IETA 4OCTA 3NRUA 1WA6X 4GZ9A 4Y3OA 1UCXA 1GZWA 2VQUA 1HKDA 1G9CA 4M00A 1TME3 1L7RA 1MZEA 1VLNA 2H6CA 4AVSA 4BQWA 5A1FA 2XQRA 4LBJA 5E1RA 1RUD3 4K6BA 4NVPA 4Y1VA 5FY9A 4AEDB 1ENQA 1MQTC 2DVFA 1ZX5A 2EICA 2PHWA 2J7MA 3OYWA 4HKLA 1VBC1 4JAAA 4QX5A 4HKWA 3QD6A 4Y20B 2Q1MA 1LGBA 1S0CA 3O1RA 5FZOA 1XNBA 4IESA 5SV5A 4XJWA 4GD4A 4FOWA 2OZ6A 5BNNC 4LHNA 5J09A 1D4M2 1GLHA 2WDBA 4S2DA 1GOHA 1W28A 1AYM1 1D0GA 4M3CB 4AK3A 4Z82A 1OQEA 1ASJ2 1XSRA 4P02B 2ZJCA 3AVRA 1QJZA 3H7JA 1W6PB 5JIUA 4TZDA 2F17A 4K1ZA 2VXRA 4PI0A 3VLBB 1VAMA 3ZR6A 4F7ZA 5DXDA 3SKVA 1UZYA 5FJKA 4ZU5A 1JYNA 4JV4A 3KV9A 2P3YA 4CDUB 1G7YA 3N36A 2C26A 3SCHA 3DL3A 2RJ2A 1VPHA 3T1LA 3MUY1 4JDOA 2WNEA 4N43A 4QQOA 5F6LB 5LRSA 1VALA 2B42B 2V73A 4AI2A 1AR71 1TEIA 2P1BA 2YBSA 2OZJA 4QM9A 1N3OA 4Q0UA 3VKFC 3BKZA 1PO11 3BIEA 2PQSA 5LASA 5CYYA 4BDVB 4ZXEA 1V6NA 2VNOA 5FXVA 4DQAA 4AWDA 5HCFA 2LS6A 2P6HA 3KT7A 1LOEA 5FZ8A 1J3QA 3KQ4B 4QHZA 4A7KA 1G86A 2WWSA 3AB0A 4RA0A 3ZFEB 5C3SA 1EYBA 1OLRA 2J1VA 1W8TA 3POEA 2D97A 3BIWE 1DP0A 3AM2A 1OUSA 2BTVC 2PQQA 1RUJ3 3K3NA 1GZ9A 2P37A 3AX4A 1AJOA 3NQHA 5LY1A 4EZ4A 5FOBB 2DFBA 1B09A 3PVNA 2B46X 4XXPA 4JGZB 3FUOA 1UF2C 3TNQA 3WNLA 4DZGA 2VZSA 5C6CA 1SLCA 4FTSA 1W04A 3RZGA 1KFUL 2JDUA 3I7DA 4AGGA 1DU3D 1Y4WA 1NA1C 2YMZA 5SV8A 3VD9A 2Y6KA 2W39A 4QKFA 3ZFFC 4AQ6A 4PQQA 3VZOA 2DU0A 5BNOC 2NM1A 2Q4SA 3RS6A 4E4SA 1UU6A 5C8CC 1NCQC 1NG0A 2QCSB 2UY9A 5GZFA 5LEJA 5I0RA 3ZSEA 3JQXA 1Z7S3 1BEV3 5EJ3A 3RPQA 1D2QA 2GH2A 3WF0A 1V6LA 1W3VA 4J1WA 4UFHA 5FTTC 2VBBA 4ARYA 1ULDA 2Q30A 2Z79A 3WNPA 2YDEA 2DTWA 1L3JA 2XLGA 3NL1A 1Y9QA 2DCYA 2E7AA 1OKOA 3GALA 1GFF2 4ISRA 4CXWA 3BTXA 1AR81 5LB6A 2BNMA 2ID4A 4IEQA 5FO7B 3T09A 5LA1A 2QQMA 2ZXQA 3LF7A 5ANQA 3ZM8A 1ZRDA 4EWEA 3WUCA 2BOIA 2YC4A 4MG2A 4XW3A 3CZJA 1MS0A 1NE6A 3NJXA 2WFF1 2GNTA 1YI7A 3VD5A 2JIGA 1RUE1 2LROA 4Z2AA 5K9YA 2YZ4A 3EQEA 4HBNA 1TMF1 4XQWA 5I0TA 1MEC2 4KQ7A 4Z07A 5FP7A 2Q8DA 2PLV1 4PBPA 2E7TA 3L9JT 5JI7A 4B4RA 3AJYA 4XDPA 4OFGA 1VBB3 1DQ4A 2JDYA 3VBFB 4HPKA 3K48A 1IGOA 3P6BA 2VMGA 3W20A 4LKEA 1OQDA 4NWVA 1LU2A 3NNMA 4FXKB 4J25A 2KD7A 4IXLA 4MH0E 2YC0A 5BY5A 1FMD3 1ULCA 4YVWB 3OTFA 4DXZA 4ASLA 4QPGA 1WW4A 1HRV2 1NUKA 5KR7A 4Y4RA 3HIFA 5F5QA 4OHWA 1MQTB 1G9DA 1QJX3 4JQRA 4XJ9A 4CEWA 3VN4A 1W03A 1B35A 3Q8EA 2Z2SB 1ZZ8A 4LA3A 4ARXA 2RM22 2ADEA 2P6CA 2ZACA 2EA7A 1RTVA 1BK1A 1JBCA 4WM7C 2VOKA 4AL9A 5BNNB 3ZKYA 2XR4A 3VB9A 1UY4A 3AZVA 4B4QA 2XL7A 2E51A 3GCWA 1CN1A 1ZBE3 2WNVA 5FZEA 5I0UA 5L7OA 3WDWA 1BBT3 2PAKA 1K5MB 4I02A 2YHJA 4AI9A 5ISLA 2VUAA 1XQNA 4IDZA 3VDBA 1UMIA 2G9GA 2ORXA 3HBKA 1N1YA 4IEZA 3WVJA 4C1XA 1ND2C 1W6MA 4DRVA 2EXKA 4XBQA 3WUDA 5K0UA 2IXKA 2IXIA 1OOPA 2XUMA 2X5IA 3LOIA 2A7AA 4LO7A 5LWBA 1Y7BA 5GALA 3NKTA 3CLPA 1PO21 4Y33A 4QX3A 3JBG1 2Y6FA 1AR62 1EV11 4QXHA 5BNPB 4YNIA 3LEKA 2R073 1K3IA 1RC6A 3MLKA 4CCMA 1QNYA 2PMWB 1OF3A 1RB8G 3HOBA 1NCRA 2VZ3A 5A7WB 2B9VA 1GWMA 4LXLA 3H0OA 2H0VA 1HRI2 3O5SA 2GC1A 1YQ5A 3PMSA 4MXWB 3R0RA 4YRDA 4A3XA 1JYTA 4X6RB 5E89A 3TN93 4PIXA 2D6OX 4KWUA 1PZ7A 5LBCA 2Z69A 4B4PA 2ZEYA 4OUEA 2BWAA 4CEYA 3N35A 3VD4A 1HB1A 3MW3A 5FY1A 3O1OA 3BI3A 1CAUA 3FLTA 4KWKA 2OUJA 1K12A 4ZU4A 4OHXA 1O91A 4P5HA 3DPRA 3VHPA 1DFQA 4NOTA 4MXVA 3T4VA 4DPNA 1R091 1BVP1 2XG3A 4EN0A 2JD9A 3LOBA 4E2SA 2GC2A 1APNA 4QGMA 2C24A 1JUHA 4BQ5A 1NA1B 4UF0B 4AFAA 1UQXA 2IXHA 5IW0A 3ZPOA 5LW9A 2P4EA 4GAZA 2HLEA 1LHWA 4NN0A 1ZRCA 3IPVA 4UYBA 4YGDA 1ENXA 4EN7B 1HW5A 2RMU3 1UZVA 1NCQB 3JD71 1MS1A 3PU8A 5C8CB 2IFWA 3M4FA 4GALA 1J1LA 1PIV3 1VBA3 4GKYA 4QKBA 5DABA 1RUF3 2FDGA 1VBE1 5FPZA 1RMU1 1JYWA 2R49A 2UU8A 1PVC2 1V6KA 2D93A 5A3WA 1DHKB 1HJFA 3ZN6A 3RJ2X 4FP3A 2LUWA 3WW1A 1W9YA 2HYKA 5L19A 3LWCA 2HWD1 3H1WA 4CCKA 4AVTA 1H2LA 1QJFA 3OBZA 3TB0A 1NYWA 1OLQA 1FPN1 5CKMA 5HI0A 3FHQA 3E6DA 2HWC1 4L92A 1OKQA 2XVLA 4Y4YA 2WYSA 4AHYA 3K2OA 3SC7X 1BJQA 1ENSA 1UX6A 2UYAA 1AX2A 1YQCA 2WZR3 3V0AB 1VMJA 3VBUC 3RZLA 1UU5A 4RGGA 1HIXA 1QDCA 4D7SA 1RXGA 1DLLA 2NYYA 3KZ4C 1BYHA 3MDPA 3THTA 5EFUA 5T5OA 1UNBA 2RR12 2AEYA 4B3NA 4RGAA 1R1A3 3WNKA 3C7GA 3I3MA 1VR3A 2QQKA 1R083 4OHZA 1GQGA 1X8MA 2O1QA 3E5QA 3OY8A 3BCWA 1IS3A 1VAVA 3ZVXA 4MHRA 2R7EB 5HBAA 5HV0A 2JDAA 5DUVA 1OC1A 2Y60A 1QNWA 1VIWB 2MPFA 5F3IA 3OG2A 1GNZA 1HLCA 1A78A 3ES1A 4JGZA 2J1UA 1U5IA 3ZYHA 1JUIA 1H6YA 4E27A 4TSVA 3O14A 5F5AA 3DYOA 2L9LA 4CCLA 4A6OA 1QOTA 4Q4V3 1UN1A 5FZBA 1RUH3 3BPZA 2E6VA 4FP2A 2HEWF 3D4KA 3U07A 4P9IA 3IDBB 4WM7B 4BMBA 3ZYIB 4JCKA 5CNAA 2PTMA 3T2QA 2G1MA 1V00A 4N53A 4L11A 2YV8A 2Q8CA 2R041 4CTEA 1OBNA 2B5HA 4NAOA 3C3VA 3LD8A 2TNFA 2JJ6A 3M3EA 1QQP1 1TME2 1QWRA 3LDKA 3GJAA 1TNFA 4I09A 2JWPA 4PDWA 4I3PA 1AR93 4R4XA 1PK6A 2QQVA 1RUD2 2P17A 3GNEA 3MF6A 3OGJA 3OSDA 1RXFA 3DN7A 4XF1A 5FIXA 1IZ3A 4MSVA 4NHLA 4I3GA 5TSWA 1JYXA 1A8DA 3WG4A 4BB3A 5A3UA 5C5UA 3LEGA 3I2JA 3CF6E 4XDQA 3WDUA 4BYYA 1ULEA 4ET7A 1V0AA 3LA7A 1REEA 2UWCA 3CJIA 4QXBA 5FYTA 3RSJA 1LESA 1PNGA 2A3XA 2DVGA 2E63A 1W8NA 3Q8FA 3RWKX 3K51A 4FPEA 1XYNA 3TOJA 4RS5C 3WINE 3ZXEA 1V6JA 2NQYA 2ZGRA 3KQRA 4HT1T 4Y24A 3NJYA 3VBSA 3L2YA 3MEPA 2QNKA 3ZXFA 1POQA 4LQRA 4UFMA 2OQ6A 1Y9GA 5DAVA 1FOD1 2D6LX 1OH3A 2RHPA 2GMPA 3MUZ1 1DGWX 2QE3A 3OCPA 5DZGA 1RVF3 2RJLA 2YFZA 1WWYA 1UYPA 3ZXGA 1W0OA 4FAGA 1XE8A 1PNFA 1YQ8A 1VRH3 2C9AA 3EMRA 3H1MA 1W9SA 4W4ZA 5EQUA 4DXSA 1S0DA 2RVAA 2V72A 3ZXJA 1GUIA 1RUNA 1SACA 4CCNA 1U0AA 3FX3A 4Q0VA 3W59A 1C8M3 4GWJA 1VBD3 2R32A 2D6KA 5DUUA 1RUG1 5GZEA 2W08A 3OYWB 5F3CA 4WVWA 4LBOA 3VGIA 1D0HA 1STMA 2X8KA 4KG8A 4YW5A 4CEWC 1YFUA 4CXXA 1EAH1 1SCSA 2D44A 5FY8A 3GGLA 4B1LA 1KEXA 1GZTA 1I5ZA 2WS91 4M3CE 2AH2A 4MGQA 1U5YA 3GM8A 5FZOB 4CDXC 4E4DX 1RUJ2 4FPCA 3K3OA 4QDRA 1XYOA 1MEC1 1OURA 2WINB 4QX7A 5LBEA 5BNNA 1U5ZA 1ULFA 4L0PA 1GWKA 3ZYGA 4M4RA 4DOUA 1S4CA 2GNDA 1WCDJ 1FV2A 3IIIA 3PVOA 1UOFA 1LB2A 4Q29A 1W2TA 3VV1A 1KS5A 4Q27A 2IXJA 2DV9A 4FO9A 1UY1A 2YFUA 4LBMA 1SEFA 1LU1A 4OZOA 1DZTA 4IW3A 5GLTA 3GXUA 5FWJA 3POYA 1W6QA 2JICA 5T5LA 3M3OA 4N43B 2OKXA 1HRV1 3P5BA 3ACHA 1F2NA 1QH6A 4UBHA 4XUPA 2FCUA 1CPMA 3HT2A 2ZHNA 4WM8A 1YFXA 4QAWA 2DDUA 2ZS6B 2Z5WA 2X53S 1Z7S2 4XIOA 5AFEA 5I91A 1BEV2 3AMHA 4CUCA 3NV2A 4LHSA 2BNOA 2RM21 5FZ6A 4HFSA 4MXWA 3M1HA 4RSUA 5B4NA 4E4HA 3I3QA 2Y6HA 5GZCA 4Q5OA 3AKTA 4ORFA 1IOAA 2AENA 2RS53 4NIGA 3TEZA 3GBWA 2IXLA 4HN1A 2WWUA 3ILRA 2EXJA 3Q8AA 1YC61 4Y22A 3H1YA 4AFDA 5FYVA 4DY5A 2HKXA 1ZBA3 2HWB1 1BK0A 3CEWA 3R4DB 4JVAA 1W3XA 4Q4X2 4XYXA 4YPJA 4OQ9A 2A6YA 3PU3A 3A0NA 1ENRA 3C7EA 3DUIA 2VW0A 1MZ5A 2RS13 4AAPA 4FQ4A 4MV2A 5HCAA 1AR61 3W5NA 1O5UA 4RYDA 5CG8A 1DGWA 5AVPA 1MZFA 4AVAA 3C7OA 1D4VB 3WF1A 3ZFFA 3BTYA 2R16A 5BNOA 2QQOA 5FJHA 1VBB2 4HOOA 5IJRA 2XLFA 3I59A 1GP5A 1O8SA 1WCKA 1YWKA 1UZWA 2XJTA 3ZDVA 2GN7A 2XHNA 4RR3A 3TNPB 4EV0A 5FWEA 2NN8A 2SBAA 3AP6A 3KF3A 1GYKA 4MX3A 4QPIC 1FMD2 3O1TA 2R063 4QT6A 1FI2A 2WL1A 1UPIA 3T30A 2B4KA 4E9KA 3R05A 3FC0A 4LBKA 3WF2A 2FDIA 5JMCA 4Q4Y1 1ST8A 4RHV3 4AQTA 1ULGA 3NWKA 1DBNA 1QJX2 1IPSA 4FPOB 1I3HA 5BXXA 2B9UA 4FPJA 1JOPA 4IERA 2HEVF 1XYPA 5FZKA 2NMOA 2VOWA 5T55A 4CP0A 4A7YA 1GMMA 1ZZ6A 1S0JA 4L9BA 1UOGA 1EP0A 2JXAA 1ZBE2 2VXJA 3IIAA 3MLJA 1BBT2 5H9PA 3ZMOA 3D3AA 1QJU3 1CGPA 5KHIA 2PHLA 3BPSA 1OMIA 3TEWA 3T2OA 1UY3A 1WCSA 1XU1A 2WQ4A 3J8F1 4HPKB 4LE4A 1YO8A 2XQXA 3K4ZA 4OULA 3ECQA 3LQCA 4LO8A 1W9FA 4JX0A 4COZA 1CZTA 1W90A 4Y5SA 3I2IA 1CPNA 3J7MA 2R072 1QMJA 5LY2A 1F9KA 1MPXA 4LITA 4QPGB 4YW2A 1O4TA 1RUC1 4JGYC 1OQ1A 4IGPA 1GSLA 4YM3A 2ZHKA 2QTWB 3OD4A 4XUQA 4OUMA 3VD3A 5D1IA 1ND3C 2KXLA 3ETQA 3ILNA 1JYIA 4BQ3A 4CEWB 2JB8A 3TN92 1BQPA 1B35B 4FXGB 1XNKA 4PQ9A 4WV8A 3UV9A 2JB4A 3KS7A 1UO9A 4LTAA 1S0IA 4W65A 4E8CA 2PA7A 4XJAA 4XETA 2MHFA 2W2IA 4GQ7A 1D7PM 5EYXA 5HCHA 2RR11 3CL1A 4KU8A 4D7YA 3M2MA 2WNVB 4XC9A 5L7OB 3OBAA 3KT1A 4EZHA 1H8VA 3VUOA 4QKNA 3KGLA 4WBBA 5IAXA 3VHNA 5GLUA 1RINA 5T3NA 2QUOA 2VUJA 1W6MB 2ZGOA 1ND2A 1E5IA 2B39A 3WQ7A 4PDWC 3NNLA 2XVKA 3WQ1A 3RYRA 3NMBA 5A32A 1WMFA 5K0UB 4FPGA 2BERA 1MVEA 1OOPB 1XNAA 5CISA 2VMIA 4YG0A 2I74A 3H50A 1V6IA 4COVA 2HBUA 2J1RA 1W8ZA 2RMU2 2BYVE 3POBA 5FZ4A 2A3YA 2ZX3A 4GB33 2BEOA 3Q9OA 1S1AA 2GALA 1WLDA 1PIV2 1VBA2 1NCRB 2XDVA 3FJSA 1RUF2 2YBPA 4QXKA 3SEEA 4S2FA 2VMCA 3WP6A 4BQ1A 4CXYA 4JHZA 4IE7A 2WRAA 4V1PA 5EWSA 4FTEA 3ILFA 2DCJA 4ZY9A 1GBGA 3VBSC 4S2GA 4MGZE 4LHLA 2B8MA 1QXJA 4LUKA 1ZRRA 4YGBA 4CEYB 5F1RA 5JLVA 1XE0A 4QMAA 5KXEA 2VCMA 5FK7A 3I2DA 3QBQA 4LORA 2ZGMA 2ZX4A 3S7IA 3DPRB 2UWBA 3M7AA 3ACLA 3JB8A 2H6BA 2WJSA 1AHSA 2BGCA 3PNAA 5T52A 1KJLA 5IVBA 3FMGA 2VO5A 2VBDA 1RUD1 3PUHA 4L97A 4QQ2A 2WZR2 4WVMA 4Y1UA 5CU1A 2Y8KA 1AL23 4JDMA 5KC5A 1NQDA 2VE1A 5L9BA 1R1A2 1OI6A 3H9AA 4RD7A 3IPVB 2VZ1A 1R082 4CE8A 2P3KA 3MIBA 3VBRC 5KBFA 5A3LA 2VTFA 1C1LA 3BUCA 1OF4A 4BXFA 3PUIA 4AE2A 1AZDA 2BU9A 3MICA 3NV3A 3VDAA 5LBBA 1SZBA 4RFT0 4YG6A 1HB4A 3WF3A 5A70A 3ZYBA 2P2KA 1JU4A 1UD1A 3BVCA 4UW6A 4Y5TA 3UETA 3UGFA 1HDKA 1RUI3 2RV9A 4OUSA 4QHOA 4UXAA 1IHMA 2J42A 3WZ1A 3ZN6B 1HX6A 1Q3EA 3B00A 4C1WA 5KC6A 4UT5A 2HYXA 4FOQA 3VL9A 2QDRA 5GZDA 2WAOA 1LCLA 1WKYA 2JDMA 4HETA 4EN9B 4AVVA 5K8SA 4Q4V2 1SBFA 1RUH2 3CMGA 2VZTA 1X33A 4MGYE 1VBC3 3IMNA 4COUA 4DNYA 2IUWA 2VAUA 4PIZA 3U37A 1Q8VA 1XU2A 4COWA 2VC9A 1I9RA 2VZUA 1SHWB 2XGXA 3DCQA 4AEMA 4HONA 4WM8C 2FBEA 3VBUA 4GA9A 5FXXA 3V64A 1OLME 5F37A 1LOFC 2ZOEB 4XXAA 2FDFA 1X82A 1AYM3 2A6XA 3UJQA 5JPNB 1W8WA 4LO5B 3WHTA 5CZKA 5T5JA 1F8VA 1AR92 4QDQA 3OY8B 4K7JA 3IN9A 4ZS2A 1CAVA 4BMEA 3SH3A 3QACA 4QPWA 2ZAHA 3B9IA 4XFFA 4CCCA 1MS3A 2C6SA 2ZKLA 4EWDA 5D21A 2VZPA 1RJ8A 4PCRA 3I3EA 1RL3A 2R0HA 3HJRA 4LBLA 2VUCA 1YHFA 3GBGA 2VQAA 5FYZA 5LATA 1ND3B 4KBZA 5L73A 4MUVA 3HNBM 4R9BA 4PLMA 3ASIA 2WO2A 2WN2A 1S55A 4GWNA 5LA2A 2JG9C 2O0OA 1A6CA 4ZXKA 2D7FA 4ATEA 4OMCA 2PYTA 4Q8LA 3S30A 3POGA 4DO0A 1Y3TA 1RITA 1Z7S1 2VTXA 3T2PA 1UYZA 1BEV1 4FFHA 1CD3G 4CCEA 1RVF2 3N9MA 4N53B 1LHNA 2ZABA 1ZZ9A 2XKPA 2D3PA 4RR3C 5F8PA 5FMBA 1SLAA 1URXA 2UYBA 3N4MA 3JQWA 1VRH2 3PUQA 1OA2A 4AHZA 1RHI3 4ES8A 2LALA 1O7FA 4AHXA 3U4XA 2ZGPA 3OEAA 4PDWB 4UFIA 4XAAA 1C8M2 1X8EA 1VBD2 3CO2A 1PK6B 2ZGSA 1LKNA 4XFHA 4Z1VA 5C9AB 1ZREA 2WFPA 2DCKA 5C9AA 1CAWB 3FLRA 5A7OA 5G05L 1QJY3 4D6QA 2ZMLA 4XJUA 3B7MA 1SLTA 3O7OA 4R8HA 4AOCA 5DDJ3 4BQ4A 1WBFA 4X6QB 5I0SA 3NVCA 1OFNA 4Q4X3 2HWF3 3CJIB 1DYOA 2QKDA 5F9TA 1KDKA 3RI8A 4GMP3 1E5SA 1WD3A 4A4AA 4UW3A 5J36A 2CDPA 5J1XA 4AZZA 3VZMA 2DUOA 4RS5A 5IVVA 3VBSB 2GC0A 5C8WA 4NPMA 4PLNA 4K40A 3FFQA 4QPYA 4PF1A 4OHVA 3RZHA 4MVTA 3ZIXA 2ZGUA 4U2AA 1V6MA 5HCBA 4NIIA 3MIFA 5JXGA 2JKXA 3DEMA 1VB4A 3D6EA 3LA3A 3RYKA 2R30A 3AKRA 3EB7A 4IEPA 5A33A 1A8MA 5T50A 2ZGLA 1FNZA 1AR83 1E5HA 1NZCA 3NW4A 4LBQA 3ZKUA 4BK5A 1P8JA 4G4FA 1G9FA 4QD2A 1QJX1 1NLSA 2CAVA 2E31A 3ITQA 3NV1A 4GULA 3USUA 3WG2A 3SXWA 2WFF3 2X29A 3KV4A 2C1FA 4AQ2A 4DFSA 2BW8A 2VNRA 5F5IA 1TMF3 2NMNA 4KMQA 5FZHA 2TBVA 4BZ4A 4MOAA 3U4SA 4CRQA 1F5FA 3LCPA 4IE6A 4Y1XA 2RS52 1H2KA 2XBO1 3AC0A 4CDXA 3E97A 1G8WA 1BBT1 1A3KA 2VH9A 3MW2A 1LRHA 2FD8A 3I4IA 4HK8A 1HXS3 2IWGB 1CAXA 1Y43B 1TQ5A 1ZBA2 3MV01 3AXEA 3ES4A 3N3HA 4LKFA 3OPWA 5FP8A 5IHRA 5IK7A 3AYAA 2XJPA 2YB7A 4MHUA 5EIYB 3LDRA 1LEDA 2R1DA 4ITCA 1WBLA 5F7UA 4AXOA 4YLZA 1E5RA 5FZ0A 1Z0HA 2RS12 4PJYA 5J48A 2EIGA 3BTZA 2ZMNA 4XILA 2AUYA 5FKCA 5ABJA 2R071 1D2SA 5LA9A 5F32A 1UZ0A 1W6QB 1C3HA 4XZPA 5FZ3A 1W2OA 2K0GA 2A70A 5JDBA 4Q1PA 3N7LA 3PL0A 2PHTA 5FZAA 1UZZA 4BIOA 4H7MA 4TN7A 4WM8B 5H9SA 5C3OA 4BWOA 4CUAA 5CVRA 2PAMA 3ZLIA 1LNSA 2BV4A 5DZFA 4QQPA 4BQYA 1FYUA 1GWLA 4K1YA 3RFRA 1NXD1 2R062 3RRDA 2BPA2 2VNGA 4XMAA 4TLGA 1Q56A 4G3YC 1NAEA 3KB5A 4RHV2 5EP9A 1UY2A 1QGLA 5EV7A 3UGHA 5GKAC 1J59A 5A1LA 1OH4A 3WXPA 4Y22B 2UY8A 2O8QA 4P00B 3THCA 3A22A 4LBQD 4UOJA 1XE7A 4Q0SA 1MS8A 1GOFA 5BYNA 4XEZA 1Q8QA 1PO23 3H3UA 4AI3A 1H0BA 2A3WA 2WSUA 1EV13 4NE9A 2XOMA 3T0DA 1U12A 2I45A 2A71A 4DINB 3FL7A 4B8EA 3B02A 4AEJA 2JDPA 4CPBA 1H6XA 3NV4A 3JCIA 4H55A 3H3ZA 1C5IA 3HNMA 3LB9A 1AYN1 1QJU2 4B7EA 2XH6A 4EN6B 5FXZA 1IQDC 5FFOC 4BIFA 3MFCA 4LK6A 4UFKA 3ZFFB 2GNMA 1UYYA 5BNOB 3N9LA 3R4UA 4J1XA 4LK7A 1N3PA 1PIV1 1VBA1 3I59B 1RUF1 5F39A 1PZ8A 2VMHA 2DUPA 2BGOA 3CHXA 3QCWA 4RR3B 1UL9A 1YIPA 3IB3A 1HJGA 4RN5A 5DG1A 1H9WA 4QPIA 1KS4A 1EPWA 3LSDA 1LGCA 4ASMB 3HBZA 3OBTA 2AYHA 3VHOA 1DZRA 2BOJA 4E2QA 5EJ1B 3M3QA 2VGDA 4MADA 1H2NA 3D0JA 4XF0A 2W1WA 1BCXA 4UW5A 4H7LA 4DUXA 2WZR1 4DUVA 3I97A 5C4WC 1ZYBA 3UKVA 3PJYA 1W8HA 5FY7A 2Y6LA 5J96B 3O1VA 2OIIA 5CFDA 3OOXA 4LLFA 5FKBA 4LULA 3W58A 3PUSA 4RL7A 4UFLA 4ZPIA 5J37A 1W6OA 2CWSA 1VBE3 1PHMA 3MPBA 4Y5Z0 5JXIA 1I6XA 3H8XA 3KD4A 3SHRA 2NPIA 3AFGA 1Q8PA 4W50A 2Y6JA 2QZ3A 1T6GC 1D4M1 1Q43A 2GU9A 4HL0A 1J84A 3ZYFA 3NNJA 2W46A 1ASJ1 2HWD3 4JDNA 4TWTA 3VDDC 3ZXDA 5HPOA 1CX4A 4JHTA 2VZOA 1WLCA 5IFPA 4UW4A 2VPVA 1FPN3 3BALA 1GZCA 1WCQA 3TEYA 3MIHA 5HXVA 2HWC3 2ZX2A 3F95A 4FVVA 4GB32 4KU7A 4OZXA 4D8MA 4CPBD 5DAPA 3VZKA 3WQBA 4Q4V1 2YBKA 1RYYA 2WT1A 3LIGA 1RUH1 4JGYA 4FPLA 4IGOA 5AC92 1SPPA 1G6NA 1VP6A 3POIA 2Y26A 2LRPA 2OUHA 1ND3A 2BNNA 5BNQA 5A7PA 5DZEA 4AW7A 4ZONA 5FP4A 2GDFA 4O7XA 2QQWA 2HBTA 1ODMA 2ZGKA 1UWWA 3CBNA 1G9BA 1OA3A 4R9CA 5JI9A 1H30A 4R52A 3WV6A 3ABZA 3K4DA 3G6JB 2MEV3 3ACIA 4GWIA 2VOXA 2WZPP 2VECA 5FRAA 5FO8B 3O1SA 3OD0A 2Q5TA 4NHMA 1ND2B 3T08A 3BB6A 1AL22 2R1BA 3ROUA 2J1SA 1H8TC 1NY72 1PMIA 5A32B 4WVVA 5CBLA 4BA6A 4A42A 3C7HA 3CZUA 3MYXA 4P9WA 1CAWA 4LUMA 2WO7A 3N9OA 5FY0A 1KDMA 5JZGC 4IV1C 5FLHA 4XIKA 1V9U3 3JXSA 5FCCA 3VZLA 4EE2A 2JG8C 3MPPG 2XHKA 5IUQA 3ALQA 4YM2A 1JMUB 3JZVA 4M0NA 1COV3 4XUNA 1JOJA 1RUI2 1GNYA 1SFYA 1ULOA 2O8OA 2Y38A 3WDXA 3V0BA 5BPXA 1JW6A 2R043 2VVFA 4QB1A 3D8CA 4K20A 4AF9A 1C8NA 4H14A 4C0BA 1RVF1 4GWMA 1YCIA 2W0XA 2JKBA 2TEPA 4D6RA 2FDKA 4OHYA 2BP6A 2DURA 3HQXA 2AREA 3ENRA 3RGBA 1VRH1 3FFZA 1UYXA 1NX9A 2Y33A 3GHMA 5G04L 3OBRA 1VBC2 1SLLA 3BOPA 1O5LA 3EYPA 1PMJX 2JDKA 1C8M1 3GZTB 4O65A 4QB2A 3J4UH 4XFBA 4CP1A 4EWAA 5FOJB 1FAYA 2PHUA 4OI4A 5FMOL 4WVMB 3NAPC 5DAQA 1J58A 1WLWA 3UKTA 4CU6A 1W05A 3WF4A 2WO3A 4QDSA 2BVVA 2WLQA 2OPWA 4NPLA 3O0XA 4K21A 1EPZA 2DBNA 1GV9A 2K9ZA 1AYM2 3SITA 3QH6A 4ES9A 4D94A 2Q0AA 1BZWA 4I0WB 3SCGA 5FZFA 2P3IA 1PZ9A 5GLWA 3LA2A 3VBRA 4R4ZA 1FOD3 2G4IA 5IK4A 4INDA 3ZFGA 2YPJA 1YUDA 3WG1A 4MO3M 5K4LA 4CDQC 4K9SA 1LHVA 2CTVA 4XTPA 3B01A 2Q8EA 1C57A 4ATFA 1J1TA 4KWLA 4YWAA 4KL1A 1Q8SA 5FYCA 4B7KA 1S2BA 3HQUA 4A7ZA 4AI8A 1FV3A 3J7NA 2C9KA 4DMIA 5HXMA 5JMOA 2D3RA 2VJXA 4JQTA 4XPVA 2BFUL 5F6KA 2JDZA 5A7SA 2ZX1A 4J6GA 1JYVA 2RG4A 4KG0A 4YGEA 3AYDA 1U5XA 1XB9A 5F2SA 1REDA 1RUG3 3AYCA 3AVSA 3WNMA 1LAJA 4OI0A 5ABJC 4G9SB 3KCCA 5EZWA 3KVAA 2BQPA 4HK9A 4Q0PA 1X9PA 3UGGA 4P9YA 3RG0A 4BH9A 2XXZA 1YLLA 2CGOA 2VQ0A 2NP0A 4N7IA 4A41A 1EAH3 1HQLA 1MS9A 1FXZA 3UKNA 2RS33 5D8AC 1L7QA 3EXUA 2VD7A 2WS93 3LPFA 1CZVA 4XCBA 3VBUB 3VD7A 3EJKA 4HZFA 5FY5A 4JTNA 2D98A 1M06G 3AL5A 1LOFA 3ZN5A 2PFWA 3ZXKA 3RMXA 3GYDA 2OX0A 1LULA 1GP4A 1RHI2 1PX4A 2A6VA 4GKXA 2RS51 2VU9A 2WN3A 3A4UA 3DYPA 4PBOA 1VRBA 3H8RA 2AC1A 2ZGNA 4SBVA 4BXSV 5IVEA 4MGTA 4YYOA 4CDWC 4EQVA 2LM3A 1QJY2 1CAVB 1ZBA1 2WT0A 1UX7A 2GP3A 1C1FA 1F4AA 2VR4A 3OF1A 4N8MA 4RFRB 3B93A 5DDJ2 2GAUA 2GMEA 3ZOIA 3HPNA 4KI5M 1X7NA 4KGGA 2XUEA 4M0HA 3VHRA 2FZ1A 4AVCA 1POV3 4I0AA 2PHXA 4RQPC 2HWF2 1JZ4A 2W1SA 1UIJA 3QH7A 3CIHA 2VCAA 3MHZA 2D43A 1XNDA 1CVNA 2VCCA 1O4YA 3J7LA 1HV0A 1OXCA 1UKRA 2XMLA 5FYSA 2W1QA 5DPNA 5F3GA 4YVSA 5FYIA 1QXRA 3S5AA 4NMIA 3I2GA 5FZDA 1OA4A 2JG9A 1SLBA 2EXIA 3PUAA 4FPYA 3VBHC 3WHUA 2J22A 2G9FA 2Y6GA 4YW7A 1C4RA 4CU8A 4DEQA 1UXXX 1HRI1 5F5CA 3H42B 2R061 3WSOA 3MIDA 4GXLA 4IQPA 5ERLA 1AR82 1GANA 1WUVA 5L36A 4LR4A 4RHV1 2HH9A 1S0EA 3I3BA 2HWB3 4HANA 2ES3A 4IEYA 5IVYA 4I30A 3TBDA 1J3RA 2K2SA 1S2KA 5IVFA 4YW1A 1O3TA 3GHNA 2J1EA 2WFF2 5E8AA 4AEDC 5JOZA 4LIUA 2D6MA 5BUVA 5ACA3 2XKOA 4ZS3A 1TMF2 4W6YA 3RYPA 1HN1A 2ERFA 5EPAA 1GQHA 1YJKA 2PLV2 4TLFA 2WR9A 2JDHA 4XBLA 3UL2A 1JZ6A 4GIQA 5CFDC 3FZ3A 1W9TA 2DBIA 1QJU1 1GR3A 4LO6B 3OGSA 3C7FA 4C91A 1PGL2 1HXS2 4NRQA 4DXRA 1O3QA 2UURA 3I2KA 2CNAA 2JENA 4IL7A 4RS5B 3RNSA 2OS2A 5FUNA 1FT9A 5FMCA 5GLVA 4CUBA 2D6PA 3WCRA 2ADDA 3I3DA 1MZ6A 4QX2A 4OVEA 3DXUA 3H7YA 2VMDA 3SQOA 1BXHA 3I2FA 5FZCA 2Y0OA 4JKKA 1MR5A 4P5YA 3V56A 1DF0A 2E33A 2QDNA 2ZZQA 3AMQA 4Q4Y3 5A6XA 3ZN4A 3QOPA 4AI0A 1ZZ7A 2WIIB 3PLQA 1QF3A 2VOVA 4WVZA 4H2AA 3ZXAC 4FSJA 1PVC1 2WO1A 5FZMA 5A33B 1KXGA 1UIKA 4DS0A 1AF9A 3HD8B 4LBQB 2HWE3 1E57A 1W2NA 5CAZA 4FFGA 1CESA 3MV11 3USUB 2QQLA 4HXCA 5FQ0A 2WNUA 1RIRA 2WLPA 5FPUA 5FDBA 4CCOA 2XWJB 5C3PA 1QU0A 5DAXA 3LZZA 3DF0A 4ZHNA 3KT4A 2QQIA 3ZFEC 5JOXA 3A23A 4I01A 3K75B 3U10A 4QXCA 5JSRA 1ZVFA 4CDXB 1L7LA 3LIHA 3GDBA 1XRUA 3K46A 3CKHA 3CQOA 3ZSMA 3N9QA 3X29B 1UXZA 1XXNA 5FP9A 2F6BA 1CAXB 5T5PA 2XJVA 3FWEA 1MACA 1PO22 1KQRA 4O9EA 3A21A 1EV12 2GZWA 4ONUA 3ZDSA 4HG6B 2IFRA 1NQJA 4XDOA 5T54A 4S2HA 4XJZA 4DUWA 4NPRA 4BJ0A 5IK8A 3B3QE 5APAA 3IDEA 4XACA 4XTMA 2JECA 3P1IA 4MYEA 1H9PA 2XWBB 3WOGA 5ABJB 4URTA 3I2OA 4QX0A 1RJ7A 4IV3A 3WX5A 2ZGQA 2C0ZA 3EHKA 3M70A 3WP5A 5FZIA 5FPXA 5FZ7A 3DXTA 1KD7A 1HN0A 1VE0A 4Q4W3 4IE5A 1DQ0A 5D8AB 2YPDA 2FZ2A 3IBMA 1EUUA 4CU7A 5AC93 4XUTA 2DVBA 1LOBA 1UPSA 3PDQA 4LA2A 5FO9B 1JODA 4PIYA 5KXDA 2BRTA 1ZRIA 3MF9A 5FMDA 4FPKA 5JVVA 1NZIA 2JDNA 5K7PA 3ZSJA 4TXWA 1K42A 3PTYA 3PVEA 2CGNA 4H3WA 2VOTA 3O12A 2CU5A 4EYUA 5A3NA 3UYJA 4NIHA 4HVQA 1TME1 1JZ3A 1IQAA 1AL21 4RQPB 2CHHA 5JCTA 5LK7B 4BLJA 1CX1A 1NY71 2X10A 4FPFA 4CVUA 3BU0A 2VQTA 1SFPA 2YUEA 4PHZA 4P9LA 1JH5A 5FYHA 2BWCA 3MFAA 1VBE2 4KNCA 1KGYA 2A5ZA 2WQ8A 2VW2A 2ZHLA 3DKWA 4HSLA 4C90A 5CG9A 1KJRA 3CNAA 4P9JA 3QLQA 2O14A 1XC6A 4N9IA 3RDIA 2VMFA 3POWA 4GJZA 2W52A 1YYNA 3GZEA 1T2XA 2YU1A 3ZFGC 1RUI1 4XF3A 4YSFA 4XURA 2HWD2 5C5TA 4QPIB 1TVGA 4YW3A 1FPN2 2AEZA 4NHXA 3A0KA 4YVWC 3T3YA 3AP5A 2HWC2 5A3TA 4Y1ZA 4XHBA 4HMZA 3PIJA 2JD4A 1HB3A 3AL6A 5M0TA 4O9GA 4LLOA 4OI2A 1VMFA 1N3QA 3J7HA 2BJSA 2I2SA 4GJYA 3HN1A 3I54A 2A6ZA 1S0BA 5FUIA 5JOWA 3THPA 5C4WA 1LODA 2EIDA 2GC3A 2WC2A 4NHYA 3HWJA 5C3QA 3HAGA 5CFDB 1H1IA 2RE9A 4LEJA 4EROA 4EJRA 2MEV2 3SKJE 3VKOA 1DZQA 1W6OB 1W8FA 2XL9A 3CJXA 5KHGA 5FREA 4IEXA 1K5MC 1V6OA 4IEUA 4F8AA 1W6NA 3BYWA 4QQLA 2DFCA 2AR6A 2YU2A 5EJZB 3ZIWA 3ZSLA 4BLIA 5FBJA 1Q5OA 1WLTA 4Y1YA 1JN2P 1JZ2A 1DQ6A 1RUJ1 1BMV2 3H8OA 1YIFA 3C2UA 3MI8A 4KH9A 4M3CF 2VNVA 1N1TA 3AP9A 5A3MA 1LENA 3VDDA 1O8PA 4XFCA 3WDVA 5FLJA 5BNPC 1SCRA 1V9U2 3N9PA 2ZZJA 4AQSA 2ZMKA 1SBDA 2FDJA 4AFCA 1KITA 3V65A 3ZYPA 5FYMA 1AR73 4JGYB 2ET7A 5FPLA 4AFBA 4CU9A 4YZ5A 1SPPB 5I0DA 1COV2 4TTGA 1PO13 5A3OA 5CFCC 4YG3A 4XF9A 4YVSC 2P3JA 2EXHA 2R042 3OEBA 4Z8BA 1QOOA 2W87A 1M4WA 3AZYA 1NLRA 1QQP2 3PIGA 1LHOA 5FPAA 1WW7A 1MVQA 3JB4C 5GM0A 2QQPA 4BHPA 2QJVA 4WZFA 4P14A 4MGIE 1RHI1 4CUGA 4FPHA 3POJA 1UAIA 5KXCA 5H9QA 1TZOA 2OQ7A 1AL0G 1CIYA 5DAWA 4A45A 2VULA 3APBA 1AX1A 1NXMA 2CV6A 4XVHA 2QZ2A 4I0BA 1J3PA 2FQPA 4AGVA 2ZGTA 1DGRN 1QJY1 4BISA 1O3RA 2VL4A 2IC1A 1H8TA 2YC2A 2RDRA 5EHDA 1W8OA 5DDJ1 1DDLA 4MGKE 2E7QA 1VB2A 4L99A 2Y0IA 3SCFA 2RDQA 3WG3A 4Q4X1 5FYYA 2HWF1 2ZEXA 4W6WA 1MS5A 2DU1A 5JZGA 4IV1A 4NUBA 4GMP1 2YXSA 1FOD2 2JG8A 5B2GB 3RWNA 4B1MA 1V70A 2JEMA 4Z92B 2IVIB 1TNRA 1IG0A 3OPTA 2G9ZA 4Y26A 3KVBA 2W47A 4RGKA 3U11A 4CYDA 3V0BB 1VBB1 3SISA 2AZ5A 1A34A 1SLIA 5HV4A 5EYYA 4UBGA 4XF4A 1XPWA 2GSYA 4BQ2A 5LCWL 2MNGA 3F2ZA 1RUG2 2WZ8A 5KHHA 2N7GA 4YZ4A 1KFXL 3AP7A 1FMD1 2VM9A 2NLRA 4NWWA 5H9RA 1OHFA 5DUWA 1OSGA 1XNCA 2WNOA 3AYEA 4GH4C 3WCSA 4DXTA 5IVJA 3O1PA 1ZZBA 1EAH2 1O4ZA 5JIAA 1YJLA 2RS32 2WSVA 3NAPA 2W91A 3AZZA 2WS92 3MBWA 2EF6A 5JXHA 4IE0A 3S6PA 4PLOA 2W1UA 2V4AA 4E2GA 5AFBA 3WD5A 2WNUC 5L9VA 1N47A 4NHKA 4U36A 1RUE3 5A6YA 5E6HA 2XJQA 4ASKA 3S5QA 5FBZA 1GQPA 4XQDA 5J98B 3VBRB 5KXBA 3U0ZA 1PGL1 1FATA 1QHDA 2PLV3 1HXS1 3ZFGB 1OVPA 1XNTA 1Y9MA 1ZBE1 2KM2A 2WBKA 5FK8A 3W9AA 4ZU7A 1GP6A 4CDQA 2WZEA 3GZUC 4GMP0 1ODNA 3J26N 1RUOA 3N7JA 1HB2A 2BZDA 5BV6A 3T2TA 3WDTA 4LMFA 4SLIA 5IFTA 3AMMA 1PMHX 4KGQA 2XLAA 4CP2A 4XAEA 1EUTA 1QY4A 2V5YA 2VZQA 4LNVA 3INAA 3ME2A 3VBOC 4LPLA 3K4AA 5CA6A 3WW2A 4IV3C 5DMYA 5JSOA 2KR2A 3THDA 1R64A 4A6SA 1IS5A 2C5DA 1ALYA 3N7KA 5D8AA 1IKQA 3SEPA 2AACA 2XBO3 3RJRA 2W94A 2EIEA 1UMHA 5E16A 4LT5A 3FE5A 3KF5A 5FYBA 3VDCA 3ZYRA 5JAXA 3TN91 3KSCA 1HQWA 2JX9A 4FT8A 1DIWA 1NT0A 4FTBA 3IDCB 2HWB2 1GICA 5A3PA 3LPGA 4YW6A 3M3IA 4URAA 4O61A 1YXWA 2IZWA 4CDWA 1VAKA 4NJ4A 1F4HA 1C5HA 1X50A 2ZX0A 5I8SA 4CZSA 5ACA2 5IWFA 1PX3A 2PXJA 3D5OA 5E88A 3GBFA 3BU7A 1Z78A 4JRLA 1LR5A 2AGSA 3GJBA 5FAXA 3T0BA 3IAQA 4RQPA 3U1XA 3JBG3 5I8TA 4R9AA 5FZ9A 1SQ4A 2CAUA 2J1TA 2A75A 2TUNA 4YM0A 1LTEA 3E5XA 3OGGA 1DQ1A 1X36A 2WABA 5CFCB 4YVSB 1CJPA 3LEIA 2RDNA 2RMU1 3KLSA 3AMPA 3AKSA 3H8UA 1AXZA 2JG9B 3A7QA 2ILMA 5CIRA 4W6XA 3WLUA 2DF7A 3VBHA 2YROA 3B5LB 1CONA 2W3JA 3DKQA 3VKNA 3WR0A 4C0HA 1ZZCA 4Q4Y2 3BTAA 2OXBA 4M01A 2BBVA 1OUXA 4CCJA 5C3RA 4LOSA 3IDAA 1DYPA 2VZVA 3UESA 3BN6A 5JR2A 1R1ZA 2ARAA 4W8JA 3ZYJB 2HWE2 3HQRA 5CB7A 3O1MA 1QKQA 2CGPA 2XJSA 5F2WA 3M8LA 4XE9A 4XJ8A 1R093 2IVJA 2D40A 2YGLA 1PGW2 3MGUA 2ENRA 2GMMA 2VVEA 3FBYA 4LJHA 3KMHA 1JOBA 1OPMA 4QGLA 3TEXA 4AEDA 1VJ2A 1ULPA 2G19A 2OA2A 4Y20A 2W68A 1WZXA 3RQ0A 3RZZA 1AYN3 2FMYA 4X8PA 2ZHMA 1CR7A 2ZEWA 4Z2WA 3TAYA 4OI1A 4FAHA 2OW4A 1H4HA 2HJIA 1OPOA 3JU9A 3LKJA 5A1AA 3JD73 3LFMA 5C33A 3J8F2 3OGRA 3VKLA 4M3CA 4QHBA 5I93A 1R1A1 4XQ4A 3VZNA 3HEIA 3O0WA 2W9XA 3DYMA 2CSGA 4QU2A 1R081 1MS4A 3TYJA 3UNPA 3AKQA 2GNBA 3USSA 2ZEZA 4FOVA 1W6PA 4YGCA 1RMU3 3B9CA 3OUHA 3WP4A 2CDOA 2VVDA 2LTNA 4LE3A 4AHWA 4FBFA 3UK9A 4XMIA 2VZRA 1IG3A 3AFKA 1RUC2 3IM0A 4CDUA 2XONA 3ACFA 3NNFA 4XBNA 2V4VA 3ACGA 3FLPA 2BBAA 2GH8A 4GH4B 1QEXA 4N43C 3ELNA 1BLZA 3AXDA 5D2AA 4K8RB 5CADA 4Q4W2 3WDYA 1AX0A 1WW6A 2V09A 4QM8A 3BOWA 3TWIA 2ATFA 3LEMA 5FPBA 3ETPA 1DGLA 1X9TA 4NROA 5FQ0B 2WNUB 3W5MA 1PVXA 2H0BA 1WMDA 1YI9A 4Q26A 1GOGA 1JU3A 1K5JA 3HNYM 3PVBB 4NIAA 4BU2A 2CYFA 2DYCA 3E1F1 3OUJA 4A3ZA 5FP3A 3ZFEA 3ZXLA 3K77A 3KV5A 2MEV1 4B29A 4BE3A 1DG6A 4QX8A 5A6ZA 5FYUA 4HLTA 1WD4A 1YFYA 2B7YA 1D4M3 3I2HA 2BUKA 2QQNA 4YFZA 4FFIA 5IATA 2NZ9A 3IAPA 2PELA 3KWVA 1ACCA 1ASJ3 1JXNA 1US3A 3LSEA 3Q8BA 3ATGA 3WP3A 4CCDA 1AR91 5FMOS 1W99A 2Q8OA 4A44A 4D6SA 2ZPXA 1BMV1 3RI9A 3FN9A 1OFSA 3UJOA 4CP9B 1LJ7A 1QH7A 4BPZA 3NJVA 5FUPA 1IS4A 3HR9A 3VBOB 2FCVA 2E53A 1V9U1 4IV3B 4XOGA 4M4PA 4META 4CSWA 2FDHA 1XBFA 5DQ0A 5FZ1A 4YZ3A 3NKGA 2Q1ZB 2Y34A 1HQNA 2D3SA 3HT1A 1K45A 5CKNA 3Q8CA 2KA3A 4YZ1A 1COV1 3LE0A 2PHDA 2OYZA 2ZA9A 2P5BA 4UI9L 1WMEA 5L9RA 3VKMA 4QGNA 2ARXA 5F3EA 2QVSB 2PHRA 2BFUS 3OJBA 4PF5A 3GCXA 2BGPA 4AYUA 3OGVA 1QQP3 2E9QA 3T4HB 3OPZA 5EXOA 2VBPA 4JZRA 2BDRA 2SLIA 3P3NA 1UU4A 1YEWA 2W5FA 1US2A 5FZGA 4MZUA 4JRAA 4NR1A 4BM8A 3PURA 1I1EA 4N9HA 3RZJA 2YGMA 3NJZA 1GU3A 1WGPA 1WW5A 4K8FA 1AJKA 1IPJA 1VBD1 4FCAA 1S0GA 1W2UA 4F3JA 5LZ6A 4DEVA 1W39A 4DY3A 3SMHA 2YY1A 4D7TA 1H4GA 1FNYA 3LGRA 3NSTA 3R4SA 4JTOA 2D6NA 3KCXA 5ANNA 1CQ9A 2ETEA 2C4XA 3MZHA 4P9XA 2W92A 3ZMNA 1W2AX 3VBFA 1QIQA 3KGZA 2VG9A 3SLIA 5A80A 4XFGA 2PAEA 5GLZA 3PHMA 1ZA4A 1IKPA 4KBBA 3O0VA 1WMXA 3PMEA 4YM1A 2FHRA 1QDOA 1GZWB 3AK0A 4YVWA 4NO4A 3DECA 4V2WA 1W9WA 1UOJA 2QQUA 2WA4A 1AXKA 1C28A 4LIVA 4QPGC 1LGNA 2F4LA 1IS6A 4JKMA 5JWPA 1W0NA 1ZNPA 1IPKA 4LOTA 4OYUA 1AR72 1WA4A 1BVVA 1MQTA 1PO12 2ZAAA 3BGAA 3KCYA 4Q8KA 2DCTA 2Z4FA 3IKWA 4NAMA 1B35C 2ARCA 2RS31 3L2HA 4P08A 5C4WB 3WNOA 4E4ZA 3SH4A 1W06A 2ZBJA 3U14A 4X8NA 4BK4A 3ZR5A 3KV6A 4L8QA 2XPJA 3I8TA 4JKLA 3HMYA 3M3CA 2DUQA 3KHBA 2E32A 2WNVC 3GZAA 3ZPYA 4CA9A 1UY0A 2DTYA 1EY2A 1LOAA 3VZJA 5L7OC 2WYFA 1MEC3 1K5MA 2EALA 4N7UA 1W6NB 3POFA 1SBEA 2ET1A 2Q1FA 4Q1RA 2HEYF 3W21A 4AG4A 2D5FA 2VW1A 1DLCA 3S57A 2X09A 1TE1B 2QBXA 4N90A 3WQ0A 5FLIA 2WQZC 5JUVA 3N7MA 3E6CC 3N9NA 3ZX7A 3PJQA 4NIDA 5K0UC 1REFA 1OOPC 2X5IC 3GF6A 1LOCA 4ZKTB 3C8XA 1LHUA 1OD5A 2WT2A 3E5UA 1POV1 3FBMA 3B69A 4JC1A 3UT0A 3VDDB 4E8DA 1VMHA 3R6SA 1UW8A 3S7EA 5BNPA 1TG7A 3B94A 1YQ6A 2W95A 2RS11 5GZGA 1WCUA 3LFIA 4LKSA 1PM7A 5DUXA 1HRV3 1NCRC 1YFWA 1ZA7A 5A7QA 5A7WA 1YQ2A 1LOGA 4XCAA
chains in the Genus database with same CATH topology
3DGTA 1KRIA 5CFCA 3RMYA 2WKKA 3SH5A 1CIWA 4CEYC 2RM23 5JSPA 3NO8A 1DQ2A 3AMNA 5KHJA 4AEKA 3DPRC 2OPKA 1ONAA 3DV8A 1W0PA 2OVUA 1BKZA 3J9SA 5J7MA 4P9GA 3POSA 2PHFA 4IEOA 2R6QA 5J3UA 5KWRA 5ACA1 1H8TB 1RGSA 1GNHA 2DVDA 1ZRFA 2CWMA 1NA1A 1JYCA 3EBRA 1SDWA 1SFNA 1RUE2 3MIGA 2I07B 4D69A 1GKBA 1AR63 3D0SA 4Q2FA 5C8CA 3WNXA 1NCQA 4IV1B 5JZGB 2DWRA 1NOVA 3FUQA 1SMVA 3P3PA 4LBNA 3TRSB 1POV0 2JG8B 2VY0A 3WY6A 4XFAA 3MIEA 2DVAA 2EVXA 1HRI3 2B45X 4DB5A 4A2UA 3JUUA 1YRZA 2XB6C 1FX5A 1DGRA 3AZWA 1CJDA 4YFWA 4L2NA 3MW4A 4CDUC 2FMDA 1N1VA 2HWE1 2JE9A 5JOYA 4GH4A 3AP4A 1PGW1 1JHNA 1H1AA 4EN8B 1ZM1A 3NAPB 3V0AA 2XBO2 1Q8OA 2QFEA 1QXPA 4YZ2A 2YYOA 4HN0A 4FQZA 5JPMB 4LO4B 2UWAA 3LAGA 4HSJA 1H1MA 4LHKA 5LEKA 2DCZA 4BOWA 1DYKA 4IEWA 5GJ6A 2IXCA 3IT8A 3MLLA 2BVBA 4CDQB 4K3UA 1AUYA 3J8F3 5IK5A 2WA3A 4AI1A 5KHKA 2XVGA 5LK5A 1PVC3 3S0MA 4XFIA 4JGZC 3JBG2 5I8YA 2F4PA 4HVOA 1F5JA 2EAAA 3AZXA 2R0FA 4OLLA 3ZO0B 3WW3A 3EO6A 4TYSA 3WW4A 1O3SA 1RUC3 3VBOA 4Q4W1 3ZSKA 4HKOA 4HVRA 2ARBA 4Q0QA 4GB31 4IEVA 3G7DA 3T1MA 4WM7A 1G9AA 4MLOA 3FHIB 3WT3A 2D5HA 5AC91 3VL8A 1S0FA 4N53C 3AKPA 5LRRA 2P34A 2ZTNA 4DRRA 4I2OA 2RJKA 4FOYA 4BCUA 2PN5A 2RR13 2XJRA 1AVBA 1LEMA 2A6WA 1N1SA 1R092 4XHXA 1PK6C 2JE7A 1H2MA 3IWZA 5C9AC 4WZCA 1DQ5A 2X5IB 2Z42A 4AGRA 4CDWB 4KWJA 1AXYA 1UMZA 1AYN2 2XJUA 1YNAA 3E6BA 4AFMA 4F83A 3CJIC 4YARA 3ST7A 5DG2A 3SNMA 3JD72 4D3WA 1JTZX 4YW4A 2A73B 2ZKNA 1PGSA 3URFA 3AJZA 1LECA 3BODA 3CU7A 3KM5A 4AVBA 5IT6A 5JR7B 1RMU2 1HV1A 2CY6A 2ZCWA 3D82A 3VBHB 1UKGA 1CAUB 3VBFC 1QOSA 4R9DA 2EAKA 4COYA 1NE4A 1F31A 2GN3A 4QQHA 2CL2A 4ISQA 5AVAA 4IETA 1UCXA 1GZWA 1HKDA 1G9CA 4M00A 1TME3 1MZEA 1VLNA 2H6CA 4AVSA 4LBJA 5E1RA 1RUD3 4K6BA 4NVPA 4Y1VA 4AEDB 1ENQA 1MQTC 2DVFA 1ZX5A 2PHWA 3OYWA 4QX5A 4HKLA 4Y20B 1VBC1 4JAAA 4HKWA 3QD6A 2Q1MA 1LGBA 1S0CA 1XNBA 4IESA 5SV5A 4XJWA 4FOWA 2OZ6A 5BNNC 4LHNA 5J09A 1D4M2 1GLHA 4S2DA 1AYM1 1D0GA 4M3CB 4AK3A 4Z82A 1OQEA 1ASJ2 2ZJCA 1QJZA 3H7JA 1W6PB 5JIUA 4TZDA 4K1ZA 4F7ZA 2VXRA 3VLBB 1VAMA 5DXDA 1UZYA 4ZU5A 4JV4A 4CDUB 1G7YA 3N36A 3SCHA 3DL3A 3T1LA 4JDOA 2WNEA 4N43A 4QQOA 5F6LB 5LRSA 1VALA 2B42B 2V73A 4AI2A 1AR71 1TEIA 2OZJA 4QM9A 1N3OA 4Q0UA 3VKFC 1PO11 1V6NA 2VNOA 4DQAA 4AWDA 5HCFA 3KT7A 1LOEA 1J3QA 4A7KA 1G86A 2WWSA 3AB0A 4RA0A 3ZFEB 1EYBA 1OLRA 2D97A 3BIWE 3AM2A 2BTVC 2PQQA 1RUJ3 1GZ9A 2P37A 3AX4A 1AJOA 5FOBB 2DFBA 1B09A 3PVNA 2B46X 4XXPA 4JGZB 3FUOA 1UF2C 3TNQA 4DZGA 5C6CA 4FTSA 1SLCA 1KFUL 3I7DA 4AGGA 1DU3D 1NA1C 2YMZA 5SV8A 2W39A 3ZFFC 4AQ6A 3VZOA 2DU0A 5BNOC 2NM1A 2Q4SA 3RS6A 4E4SA 1UU6A 5C8CC 1NCQC 1NG0A 2QCSB 2UY9A 5GZFA 5LEJA 5I0RA 3ZSEA 3JQXA 1Z7S3 1BEV3 5EJ3A 3RPQA 1D2QA 2GH2A 1V6LA 4J1WA 5FTTC 1ULDA 2Q30A 2Z79A 2YDEA 2DTWA 1L3JA 2XLGA 3NL1A 1Y9QA 2DCYA 2E7AA 3GALA 1GFF2 4ISRA 1AR81 2BNMA 4IEQA 5FO7B 1ZRDA 4EWEA 3WUCA 4XW3A 1MS0A 1NE6A 2WFF1 2GNTA 1YI7A 1RUE1 5K9YA 2YZ4A 3EQEA 4HBNA 1TMF1 4XQWA 5I0TA 1MEC2 4KQ7A 4Z07A 2PLV1 4PBPA 2E7TA 3L9JT 5JI7A 4B4RA 3AJYA 4OFGA 1VBB3 1DQ4A 3VBFB 4HPKA 3K48A 1IGOA 2VMGA 1OQDA 4NWVA 1LU2A 5BY5A 4FXKB 4MH0E 4IXLA 2YC0A 1FMD3 1ULCA 4YVWB 3OTFA 4DXZA 4ASLA 4QPGA 1WW4A 1HRV2 3HIFA 5F5QA 4OHWA 1MQTB 1G9DA 1QJX3 4JQRA 4XJ9A 4CEWA 3VN4A 1B35A 2Z2SB 1ZZ8A 4LA3A 2RM22 2ZACA 2EA7A 1RTVA 1BK1A 1JBCA 4WM7C 2VOKA 5BNNB 3AZVA 4B4QA 2XL7A 2E51A 1CN1A 1ZBE3 2WNVA 5I0UA 5L7OA 1BBT3 2PAKA 1K5MB 4I02A 2YHJA 2VUAA 1XQNA 4IEZA 2G9GA 4C1XA 1N1YA 3WVJA 1ND2C 1W6MA 4DRVA 2EXKA 4XBQA 3WUDA 5K0UA 2IXKA 2XUMA 2IXIA 1OOPA 2X5IA 3LOIA 2A7AA 4LO7A 1Y7BA 5GALA 3NKTA 3CLPA 1PO21 1AR62 3JBG1 1EV11 5BNPB 4YNIA 2R073 1RC6A 3MLKA 1QNYA 1RB8G 1NCRA 3H0OA 2H0VA 1HRI2 3O5SA 2GC1A 3PMSA 4MXWB 3R0RA 4YRDA 4A3XA 4X6RB 5E89A 3TN93 4PIXA 2D6OX 4B4PA 1PZ7A 2Z69A 4CEYA 2BWAA 3N35A 3MW3A 1CAUA 3FLTA 4KWKA 2OUJA 4ZU4A 4OHXA 1O91A 4P5HA 3DPRA 3VHPA 1DFQA 4NOTA 4MXVA 4DPNA 1R091 1BVP1 2XG3A 4EN0A 3LOBA 4E2SA 2GC2A 1APNA 4QGMA 1JUHA 1NA1B 4AFAA 2IXHA 1LHWA 4NN0A 1ZRCA 3IPVA 4YGDA 1ENXA 4EN7B 1HW5A 2RMU3 5C8CB 1NCQB 3JD71 1MS1A 2IFWA 3M4FA 4GALA 1J1LA 1PIV3 1VBA3 4GKYA 1RUF3 1VBE1 5FPZA 1RMU1 2R49A 2UU8A 1PVC2 1V6KA 2D93A 1DHKB 3ZN6A 3RJ2X 4FP3A 2LUWA 3WW1A 2HYKA 5L19A 3LWCA 2HWD1 3H1WA 4AVTA 1H2LA 3TB0A 1NYWA 1OLQA 1FPN1 5HI0A 3E6DA 2HWC1 4L92A 1OKQA 2XVLA 4Y4YA 4AHYA 1BJQA 1ENSA 1UX6A 2UYAA 1AX2A 2WZR3 3V0AB 3VBUC 1UU5A 4RGGA 1HIXA 1QDCA 4D7SA 1DLLA 2NYYA 3KZ4C 1BYHA 3MDPA 3THTA 5EFUA 5T5OA 2RR12 4B3NA 4RGAA 1R1A3 1VR3A 1R083 4OHZA 1GQGA 1X8MA 2O1QA 3E5QA 3OY8A 3BCWA 1IS3A 1VAVA 3ZVXA 5HBAA 5DUVA 1QNWA 1VIWB 2MPFA 1GNZA 1HLCA 1A78A 3ES1A 4JGZA 1U5IA 1JUIA 4E27A 4TSVA 3O14A 1QOTA 4Q4V3 1UN1A 1RUH3 3BPZA 2E6VA 4FP2A 2HEWF 3D4KA 3U07A 4P9IA 3IDBB 4WM7B 4BMBA 3ZYIB 4JCKA 5CNAA 2PTMA 1V00A 4N53A 4L11A 2YV8A 2R041 4CTEA 2B5HA 3C3VA 2TNFA 2JJ6A 3M3EA 1QQP1 1TME2 1QWRA 4I09A 1M06G 1TNFA 4PDWA 4I3PA 1AR93 4R4XA 1PK6A 1RUD2 2P17A 3GNEA 3MF6A 3OGJA 5C9AA 3DN7A 4XF1A 1IZ3A 4MSVA 4NHLA 4I3GA 5TSWA 1A8DA 3WG4A 3CF6E 4XDQA 3WDUA 4BYYA 1ULEA 3LA7A 1REEA 2UWCA 3CJIA 3RSJA 1LESA 1PNGA 2A3XA 2DVGA 2E63A 3K51A 4FPEA 1XYNA 3TOJA 4RS5C 3WINE 3ZXEA 1V6JA 2NQYA 2ZGRA 3KQRA 4HT1T 4Y24A 3VBSA 3ZXFA 3L2YA 3MEPA 2QNKA 1FOD1 2D6LX 2RHPA 2GMPA 3OCPA 1DGWX 2QE3A 5DZGA 1RVF3 2RJLA 3ZXGA 1W0OA 4FAGA 1XE8A 1PNFA 2C9AA 1VRH3 3H1MA 1S0DA 3ZXJA 1RUNA 1SACA 1U0AA 3FX3A 4Q0VA 3W59A 1C8M3 1VBD3 2R32A 2D6KA 5DUUA 1RUG1 5GZEA 2W08A 3OYWB 4WVWA 4LBOA 3VGIA 1D0HA 2X8KA 4KG8A 4YW5A 4CEWC 1YFUA 1EAH1 1SCSA 2D44A 1I5ZA 2WS91 4M3CE 2AH2A 4CDXC 1U5YA 4E4DX 1RUJ2 4FPCA 5BNNA 1XYOA 1MEC1 2WINB 1U5ZA 1ULFA 3ZYGA 4DOUA 2GNDA 1WCDJ 1FV2A 3PVOA 1LB2A 4Q29A 3VV1A 1KS5A 4Q27A 2IXJA 2DV9A 4FO9A 4LBMA 1SEFA 1LU1A 1DZTA 5GLTA 3POYA 1W6QA 2JICA 5T5LA 3M3OA 4N43B 1HRV1 1F2NA 1QH6A 4UBHA 1CPMA 3HT2A 2ZHNA 4WM8A 1YFXA 2ZS6B 2Z5WA 2X53S 1Z7S2 4XIOA 5AFEA 5I91A 1BEV2 3AMHA 3NV2A 2BNOA 2RM21 4HFSA 4MXWA 3M1HA 4RSUA 5GZCA 3AKTA 4ORFA 1IOAA 2AENA 2RS53 3GBWA 2IXLA 4HN1A 3ILRA 2EXJA 4Y22A 3H1YA 4AFDA 4DY5A 2HKXA 1ZBA3 2HWB1 3R4DB 3CEWA 4Q4X2 4JVAA 4XYXA 2A6YA 3A0NA 1ENRA 3DUIA 2VW0A 1MZ5A 2RS13 4FQ4A 4MV2A 5HCAA 1AR61 1O5UA 5CG8A 1DGWA 5AVPA 1MZFA 4AVAA 1D4VB 3ZFFA 2R16A 5BNOA 1VBB2 2XLFA 3I59A 1WCKA 1YWKA 2XJTA 2GN7A 4RR3A 3TNPB 4EV0A 2NN8A 2SBAA 3AP6A 4MX3A 1GYKA 4QPIC 1FMD2 2R063 4QT6A 1FI2A 2WL1A 1UPIA 4E9KA 3R05A 3FC0A 4LBKA 5JMCA 4Q4Y1 4RHV3 4AQTA 1ULGA 3NWKA 1DBNA 1QJX2 4FPOB 1I3HA 5BXXA 2B9UA 4FPJA 4IERA 2HEVF 1XYPA 5T55A 2NMOA 2VOWA 4CP0A 4A7YA 1ZZ6A 1S0JA 4L9BA 1EP0A 2JXAA 1ZBE2 3IIAA 3MLJA 1BBT2 5H9PA 3ZMOA 1CGPA 1QJU3 5KHIA 2PHLA 1OMIA 1WCSA 1XU1A 2WQ4A 3J8F1 4HPKB 4LE4A 1YO8A 4OULA 3ECQA 4LO8A 4COZA 1CPNA 2R072 1QMJA 1F9KA 4QPGB 4YW2A 1O4TA 1RUC1 4JGYC 1OQ1A 1GSLA 4YM3A 2ZHKA 3OD4A 4OUMA 5D1IA 1ND3C 2KXLA 3ETQA 3ILNA 1JYIA 4CEWB 3TN92 1BQPA 1B35B 4FXGB 1XNKA 4PQ9A 4WV8A 3UV9A 3KS7A 4LTAA 4W65A 1S0IA 2PA7A 4XJAA 4XETA 2MHFA 4GQ7A 5EYXA 2RR11 3CL1A 4KU8A 4D7YA 3M2MA 2WNVB 5L7OB 3KT1A 1H8VA 3VUOA 4WBBA 3KGLA 3VHNA 5GLUA 1RINA 5T3NA 2QUOA 2VUJA 1W6MB 2ZGOA 1ND2A 2B39A 3WQ7A 4PDWC 2XVKA 3WQ1A 3RYRA 5A32A 1WMFA 5K0UB 4FPGA 1MVEA 1OOPB 2VMIA 4YG0A 2I74A 3H50A 1V6IA 4COVA 2RMU2 2BYVE 2A3YA 2ZX3A 4GB33 2BEOA 3Q9OA 1S1AA 2GALA 1WLDA 1PIV2 1VBA2 1NCRB 3FJSA 3WP6A 1RUF2 4QXKA 4S2FA 4BQ1A 5EWSA 4V1PA 4FTEA 3ILFA 2DCJA 3VBSC 1GBGA 4S2GA 4MGZE 4LHLA 2B8MA 1QXJA 4LUKA 1ZRRA 4YGBA 4CEYB 5F1RA 5JLVA 4QMAA 5KXEA 3I2DA 3QBQA 2ZGMA 2ZX4A 3S7IA 3DPRB 2UWBA 3M7AA 3ACLA 3JB8A 2H6BA 2WJSA 1AHSA 2BGCA 3PNAA 5T52A 1KJLA 3FMGA 1RUD1 4L97A 4QQ2A 2WZR2 4WVMA 4Y1UA 5CU1A 1AL23 4JDMA 5KC5A 1NQDA 1R1A2 1OI6A 3H9AA 4RD7A 3IPVB 1R082 2P3KA 3MIBA 3VBRC 5KBFA 5A3LA 1C1LA 4AE2A 1AZDA 3MICA 3NV3A 4RFT0 4YG6A 2P2KA 1UD1A 4UW6A 1HDKA 1RUI3 4OUSA 4UXAA 1IHMA 4C1WA 3WZ1A 3ZN6B 1HX6A 1Q3EA 3B00A 5KC6A 4FOQA 3VL9A 2QDRA 5GZDA 1LCLA 4HETA 4EN9B 4AVVA 5K8SA 4Q4V2 1SBFA 1RUH2 1X33A 4MGYE 1VBC3 3IMNA 4COUA 4DNYA 4PIZA 1Q8VA 1XU2A 4COWA 1I9RA 2XGXA 4AEMA 4WM8C 3VBUA 2FBEA 4GA9A 3V64A 1LOFC 2ZOEB 4XXAA 1X82A 1AYM3 2A6XA 3UJQA 5JPNB 4LO5B 3WHTA 5T5JA 1F8VA 1AR92 3OY8B 4K7JA 3IN9A 1CAVA 4BMEA 3SH3A 3QACA 2ZAHA 3B9IA 4XFFA 1MS3A 2ZKLA 4EWDA 1RJ8A 4PCRA 1RL3A 2R0HA 4LBLA 1YHFA 3GBGA 2VQAA 1ND3B 5L73A 4MUVA 4R9BA 4PLMA 3ASIA 1S55A 4GWNA 2JG9C 2O0OA 1A6CA 4ZXKA 2D7FA 4ATEA 2PYTA 4Q8LA 3S30A 1Y3TA 1RITA 1Z7S1 1BEV1 1CD3G 1RVF2 4N53B 1LHNA 2ZABA 1ZZ9A 2XKPA 2D3PA 4RR3C 1SLAA 1URXA 2UYBA 3N4MA 3JQWA 1VRH2 1OA2A 4AHZA 1RHI3 4ES8A 2LALA 1O7FA 4AHXA 3U4XA 2ZGPA 4PDWB 1C8M2 1X8EA 1VBD2 3CO2A 1PK6B 2ZGSA 1LKNA 4XFHA 4Z1VA 5C9AB 1ZREA 2WFPA 2DCKA 1CAWB 3FLRA 1QJY3 2ZMLA 4XJUA 3B7MA 1SLTA 3O7OA 4R8HA 5DDJ3 1WBFA 4X6QB 5I0SA 3NVCA 1OFNA 4Q4X3 2HWF3 3CJIB 2QKDA 5F9TA 1KDKA 3RI8A 4GMP3 1WD3A 4UW3A 5J36A 3VZMA 2DUOA 4RS5A 3VBSB 2GC0A 5C8WA 4PLNA 4K40A 3FFQA 4QPYA 4OHVA 4MVTA 3ZIXA 2ZGUA 4U2AA 1V6MA 5HCBA 3MIFA 3LA3A 1VB4A 3D6EA 3RYKA 2R30A 3AKRA 4IEPA 5A33A 1A8MA 5T50A 2ZGLA 1FNZA 1AR83 4LBQA 1NZCA 3NW4A 4G4FA 1G9FA 4QD2A 1QJX1 1NLSA 2CAVA 3NV1A 3USUA 4GULA 3WG2A 3SXWA 2WFF3 2X29A 2C1FA 4AQ2A 4DFSA 2BW8A 2VNRA 1TMF3 2NMNA 2TBVA 4BZ4A 4CRQA 1F5FA 3LCPA 4Y1XA 2RS52 1H2KA 2XBO1 4CDXA 3E97A 1G8WA 1BBT1 1A3KA 2VH9A 3MW2A 1LRHA 3I4IA 4HK8A 1HXS3 2IWGB 1CAXA 1Y43B 1TQ5A 1ZBA2 3AXEA 3ES4A 3N3HA 5IK7A 3AYAA 2XJPA 1LEDA 2R1DA 4ITCA 1WBLA 4AXOA 4YLZA 1Z0HA 2RS12 4PJYA 5J48A 2EIGA 2ZMNA 4XILA 2AUYA 5ABJA 2R071 1D2SA 1W6QB 1C3HA 4XZPA 2K0GA 5JDBA 2A70A 4Q1PA 3N7LA 2PHTA 1UZZA 4BIOA 4H7MA 5H9SA 4WM8B 4BWOA 5CVRA 2PAMA 5DZFA 4QQPA 1FYUA 4K1YA 3RRDA 1NXD1 2R062 2BPA2 2VNGA 4XMAA 1Q56A 4G3YC 3KB5A 4RHV2 1QGLA 5EV7A 5GKAC 1J59A 3WXPA 4Y22B 2UY8A 2O8QA 4LBQD 1XE7A 4Q0SA 1MS8A 5BYNA 4XEZA 1Q8QA 1PO23 3H3UA 4AI3A 1H0BA 2A3WA 2WSUA 1EV13 1U12A 2I45A 2A71A 4DINB 4B8EA 3B02A 4AEJA 3NV4A 3JCIA 4H55A 3H3ZA 1C5IA 3LB9A 4B7EA 1AYN1 1QJU2 4EN6B 2XH6A 5FFOC 4BIFA 3MFCA 3ZFFB 2GNMA 5BNOB 3R4UA 4J1XA 1N3PA 1PIV1 1VBA1 3I59B 1RUF1 1PZ8A 2VMHA 2DUPA 3QCWA 4RR3B 1UL9A 1YIPA 5DG1A 1H9WA 4QPIA 1KS4A 1EPWA 3LSDA 1LGCA 4ASMB 3HBZA 3OBTA 2AYHA 3VHOA 1DZRA 4E2QA 3M3QA 2VGDA 1H2NA 3D0JA 4XF0A 1BCXA 4UW5A 4H7LA 2WZR1 5C4WC 1ZYBA 3UKVA 3PJYA 5J96B 2OIIA 5CFDA 3W58A 4LLFA 4LULA 4RL7A 5J37A 1W6OA 2CWSA 1VBE3 1PHMA 3MPBA 4Y5Z0 1I6XA 3KD4A 3SHRA 2NPIA 3AFGA 1Q8PA 2QZ3A 1T6GC 1D4M1 1Q43A 2GU9A 4HL0A 1ASJ1 2HWD3 4JDNA 4TWTA 3VDDC 3ZXDA 1CX4A 1WLCA 4UW4A 2VPVA 1FPN3 3BALA 1GZCA 3MIHA 5HXVA 2HWC3 2ZX2A 4FVVA 4GB32 4KU7A 4OZXA 3VZKA 4Q4V1 2WT1A 4JGYA 5AC92 1RUH1 4FPLA 1G6NA 1VP6A 2Y26A 2OUHA 1ND3A 2BNNA 5BNQA 4AW7A 5DZEA 2GDFA 2ZGKA 1G9BA 1OA3A 4R9CA 5JI9A 1H30A 4R52A 3WV6A 3G6JB 2MEV3 2WZPP 2VOXA 2VECA 5FRAA 5FO8B 3OD0A 2Q5TA 4NHMA 1ND2B 3BB6A 1AL22 2R1BA 3ROUA 1H8TC 1NY72 1PMIA 5A32B 4WVVA 5CBLA 4BA6A 3MYXA 4P9WA 1CAWA 4LUMA 1KDMA 5JZGC 4IV1C 5FLHA 4XIKA 1V9U3 5FCCA 3VZLA 2JG8C 3MPPG 2XHKA 5IUQA 3ALQA 4YM2A 3JZVA 4M0NA 1COV3 1JOJA 1RUI2 1SFYA 2O8OA 2Y38A 3WDXA 3V0BA 5BPXA 1JW6A 2R043 2VVFA 3D8CA 4K20A 4AF9A 1C8NA 4H14A 4C0BA 1RVF1 4GWMA 1YCIA 2W0XA 2JKBA 2TEPA 4OHYA 2DURA 3HQXA 2AREA 3ENRA 1VRH1 3FFZA 3GHMA 3OBRA 1VBC2 1SLLA 3BOPA 1O5LA 3GZTB 1C8M1 4XFBA 4CP1A 4EWAA 3J4UH 5FOJB 1FAYA 2PHUA 4OI4A 5FMOL 4WVMB 3NAPC 3UKTA 1J58A 1WLWA 2BVVA 2WLQA 3O0XA 4K21A 1EPZA 1GV9A 2K9ZA 1AYM2 3SITA 3QH6A 4ES9A 4D94A 2Q0AA 1BZWA 4I0WB 3SCGA 2P3IA 1PZ9A 5GLWA 3LA2A 3VBRA 4R4ZA 1FOD3 2G4IA 5IK4A 4INDA 3ZFGA 2YPJA 1YUDA 3WG1A 4CDQC 4K9SA 1LHVA 2CTVA 4XTPA 3B01A 1C57A 4ATFA 1J1TA 4KWLA 4KL1A 1Q8SA 4B7KA 1S2BA 4A7ZA 4AI8A 1FV3A 4DMIA 2D3RA 4XPVA 2BFUL 5F6KA 2JDZA 2ZX1A 4J6GA 4KG0A 4YGEA 3AYDA 1U5XA 1REDA 1RUG3 3AYCA 4OI0A 5ABJC 4G9SB 3KCCA 5EZWA 2BQPA 4HK9A 4Q0PA 4P9YA 3RG0A 4BH9A 1YLLA 2CGOA 2VQ0A 2NP0A 4N7IA 1EAH3 1HQLA 1MS9A 1FXZA 3UKNA 2RS33 5D8AC 3EXUA 2WS93 3VBUB 3EJKA 4HZFA 4JTNA 2D98A 3ZN5A 1LOFA 2PFWA 3ZXKA 3RMXA 3GYDA 4GKXA 1LULA 1RHI2 2A6VA 4PBOA 2RS51 2VU9A 3A4UA 2ZGNA 4SBVA 4YYOA 4CDWC 2LM3A 1QJY2 1CAVB 1ZBA1 2WT0A 1C1FA 3OF1A 3B93A 5DDJ2 2GAUA 2GMEA 1X7NA 4KGGA 4M0HA 3VHRA 2FZ1A 4AVCA 1POV3 4I0AA 2PHXA 4RQPC 2HWF2 1UIJA 3QH7A 2D43A 1XNDA 1CVNA 1O4YA 1HV0A 1UKRA 4YVSA 1QXRA 1OA4A 2JG9A 1SLBA 2EXIA 4FPYA 3VBHC 3WHUA 2G9FA 1C4RA 1HRI1 2R061 3MIDA 4GXLA 4IQPA 1AR82 1GANA 1WUVA 5L36A 4LR4A 4RHV1 1S0EA 4IEYA 2HWB3 4HANA 2ES3A 3TBDA 3WDWA 4I30A 1J3RA 2K2SA 1S2KA 1O3TA 4YW1A 3GHNA 5E8AA 2WFF2 4AEDC 5JOZA 2D6MA 5BUVA 5ACA3 2XKOA 1TMF2 4W6YA 3RYPA 2ERFA 1GQHA 1YJKA 2PLV2 4TLFA 4XBLA 3UL2A 4GIQA 5CFDC 3FZ3A 4LO6B 1QJU1 1GR3A 4C91A 1PGL2 1HXS2 1O3QA 2UURA 2CNAA 2JENA 4IL7A 4RS5B 3RNSA 1FT9A 5GLVA 2D6PA 3WCRA 1MZ6A 4OVEA 3H7YA 1BXHA 2Y0OA 1MR5A 3V56A 1DF0A 2QDNA 2ZZQA 3AMQA 4Q4Y3 3ZN4A 3QOPA 4AI0A 1ZZ7A 2WIIB 3PLQA 1QF3A 2VOVA 4WVZA 4FSJA 3ZXAC 1PVC1 5A33B 1KXGA 1UIKA 4DS0A 1AF9A 3HD8B 4LBQB 2HWE3 1E57A 5CAZA 1CESA 3USUB 5FQ0A 2WNUA 1RIRA 2WLPA 5FDBA 2XWJB 1QU0A 3LZZA 3DF0A 3KT4A 3ZFEC 5JOXA 4I01A 3U10A 5JSRA 1ZVFA 4CDXB 1XRUA 3ZSMA 3X29B 1XXNA 2F6BA 1CAXB 5T5PA 2XJVA 3FWEA 1MACA 1PO22 1KQRA 4O9EA 4ONUA 1EV12 2GZWA 3ZDSA 2IFRA 1NQJA 5T54A 4S2HA 4XJZA 4NPRA 5IK8A 3B3QE 3IDEA 4XTMA 2JECA 4MYEA 1H9PA 2XWBB 3WOGA <