2AZ5A

Crystal structure of tnf-alpha with a small molecule inhibitor
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
148
structure length
132
Chain Sequence
DKPVAHVVANPQAEGQLQWLNLLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Small-molecule inhibition of TNF-alpha.
pubmed doi rcsb
molecule keywords Tumor necrosis factor (TNF-alpha) (Tumor necrosis factor lig
source organism Homo sapiens
molecule tags Cytokine
total genus 22
structure length 132
sequence length 148
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00229 TNF TNF(Tumour Necrosis Factor) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.40 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2az5A00
1U5YA 2E7AA 3WD5A 2HEYF 4QQLA 3TYJA 2JG9B 3URFA 2HEWF 2QDNA 2R6QA 5TSWA 5L19A 1GR3A 4MXVA 2QE3A 1WCKA 2WNUC 4MSVA 4OUMA 4QQOA 1PK6A 1XU1A 2JG9C 3B9IA 1C3HA 5KC5A 1OQEA 4GIQA 2WNVB 1RJ8A 4MXWB 1XU2A 3FC0A 2WNUA 1U5XA 2HEVF 4QPYA 3ALQA 2Q8OA 1D2QA 2WNVC 4RSUA 5KWRA 1O91A 2R32A 1D0GA 4KG8A 2R30A 1A8MA 4OUSA 2O0OA 3AB0A 3QBQA 1DG6A 1JTZX 3K48A 4KGGA 3L9JT 4QQPA 4NN0A 4F3JA 2OIIA 3ME2A 3V56A 2WNVA 1RJ7A 4KGQA 2JG8B 1OQDA 3IT8A 1KXGA 4MXWA 1DU3D 2AZ5A 1JH5A 2TNFA 4DB5A 2JG9A 2RJLA 2Q1MA 5KC6A 4QQ2A 2JG8C 2Z5WA 1C28A 1TNRA 1ALYA 2RJKA 2ZPXA 4E4SA 2KA3A 3B94A 1OSGA 4D7YA 1IQAA 2ZJCA 4N90A 4J6GA 2JG8A 4OULA 3B93A 3TWIA 1S55A 3MI8A 4HT1T 2X29A 4QQHA 4G4FA 1PK6B 5CIRA 3K51A 1TNFA 2TUNA 2RE9A 4DOUA 4G3YC 3QD6A 1I9RA 5HBAA 1KD7A 1U5ZA 4E4DX 4EN0A 1D4VB 5L36A 4TWTA 5BNQA 1PK6C 3LKJA 2WNUB 4TSVA
chains in the Genus database with same CATH superfamily
5FYTA 3FX3A 3A22A 1QJFA 1RXGA 3OF1A 3HQRA 3K75B 2VZVA 2ZHLA 4SBVA 3VDCA 1UZZA 3P5BA 4QQLA 1L3JA 5BXXA 3ZFEC 1BK0A 1O6UA 2YC4A 1G9AA 2J42A 2ZEXA 1RUG3 3OY8A 2P6CA 4HZFA 4DXRA 3VBOB 2VCBA 5DUWA 4ZZ8A 3UKTA 3WUCA 4CCDA 1WUVA 1SLBA 3J4UH 4QQOA 4RR3A 3F95A 1MPXA 4JRAA 4K6BA 4PLOA 1S4CA 1HV1A 1JZ7A 1J59A 3DYPA 5FR3A 2GC2A 4XMIA 5KC5A 3EJKA 5D2AA 5FKBA 3WOGA 2F6BA 4MGZE 3LB9A 3KHCA 4C90A 4EE2A 3V0BA 2IXLA 4YVWA 1ONAA 4RGAA 2FBEA 2RM21 2DU1A 1W99A 3GZAA 3IDCB 1KFXL 2WFF3 1EV11 1F15A 3ZYRA 2WNUA 4XBNA 1JYWA 4HLTA 2BGPA 2MHFA 3AZWA 5HCFA 4PBOA 2XJUA 1W6QB 3H1WA 1OPOA 5JR7B 4D6SA 1IG0A 2D5FA 2HYXA 2CWMA 2Q5TA 2RMU1 4X8PA 5EJ1B 5GLVA 4DFSA 1D2QA 4CVUA 3I8TA 1GANA 2CNAA 1SEFA 4AWDA 1HQNA 1RUNA 1NAEA 2J1UA 1W6PA 4FFHA 2CV6A 5EQUA 4ZY9A 4A41A 5C3OA 3FUQA 1XRUA 3MLLA 4BQWA 1HRV3 4FFFA 2ZMLA 5BNOB 5C5UA 3I2DA 2VW0A 3H3ZA 4JGZC 3RZHA 4QB2A 1WMFA 4UFHA 4MOAA 4DO0A 1PHMA 2XQRA 1RUI3 2JDNA 3KB5A 5EIYB 1DHKB 1RJ7A 2C0ZA 2WA4A 3JZVA 2BWCA 1RVF3 1MVEA 1GUIA 3P1IA 3OPZA 4XFIA 3WDUA 4BQ5A 4DY3A 1MZ6A 5JI9A 3WDTA 5FWJA 2HWF3 5DZGA 1ZBE1 4CDWC 2JKBA 4DY5A 1BVVA 3EBRA 3LA2A 5CISA 4QX3A 3THTA 3NV3A 3RZGA 1HLCA 1OLRA 5KBFA 5FY5A 4XIOA 2DBNA 2V09A 4JDOA 3WP3A 1BYHA 4YW4A 2A75A 1BEV3 2A70A 1V6JA 1UKRA 1PMIA 2ZGNA 3LGRA 4AZZA 4I2OA 1QH6A 3ZVXA 4E4SA 3GCWA 3PHMA 4ZU4A 1N3QA 3AXEA 2GN7A 4YZ1A 1POQA 5LATA 4NO4A 1XNDA 4NHYA 2XJTA 4FPOB 4ASMB 2HWD3 5FZ8A 2DVFA 5FYHA 2TEPA 4TTGA 2X10A 1HW5A 1OLQA 2R49A 1C8M2 3AP4A 2BJSA 4GH4A 4CPBD 3ZYGA 2VO5A 3IB3A 5FXWA 1KFUL 4AVCA 2O14A 2XG3A 4DOUA 2X05A 1QF3A 4H2AA 4HK9A 1WD4A 3ELNA 1DLCA 1GV9A 5T5JA 1XNKA 1SBEA 1SLTA 4CP9B 2SLIA 4YG0A 4Z2AA 1WLCA 2L9LA 2WZR2 1AYM1 1ZRFA 2BW8A 1MS9A 3NV1A 5IJRA 3KWVA 1NLQA 1QJY1 1GZCA 3IWZA 4QDRA 1XSRA 2IC1A 1RUH2 2PELA 1XYNA 3HPNA 1WBFA 4NRMA 3WG4A 2R16A 3W59A 1HX6A 2ERFA 2I07B 3POFA 1MZFA 1OOPB 2VVFA 4LXLA 3O1RA 4JKLA 3U4SA 3PVEA 2E31A 3CHXA 4IV1C 2ES3A 4LBQD 3N9QA 1C5IA 1XYPA 1YWKA 4XW3A 2WNEA 4QDQA 2JJ6A 4CCKA 3T2TA 2ARAA 2A3YA 1DLLA 2BEOA 3ES4A 3KD4A 4HBNA 1NY72 2NN8A 5IAXA 1O5LA 2VXRA 1LKNA 1OMIA 4LIVA 4XJ8A 3I54A 4ATFA 2WIIB 2VMHA 4BISA 1QDOA 5F37A 3SH3A 2VUDA 4AVAA 4AK3A 3ALQA 4BMBA 3IBMA 4GWNA 2G19A 4WZFA 5FPBA 2Q8OA 3WDYA 3O1UA 2YFUA 4ZONA 4UBGA 1W0OA 4CP2A 1S0GA 3WT3A 2V4AA 3VBRA 2WA3A 3ZFGB 1CGPA 3H8RA 4XFGA 1OF3A 4BIOA 4QPGB 2C5DA 1W0PA 3ATGA 3JCIA 1VBA2 4PI2A 4FXKB 4UF0B 1O4ZA 2Z79A 4YVSB 4I3GA 4OZXA 2OQ7A 3VD7A 4XEZA 1W04A 4IEWA 2H6CA 2W1QA 4FPYA 3K48A 4LO8A 2RS12 4RN5A 4MGKE 1QU0A 3WHUA 3RZLA 1C1FA 3KQ4B 3IMMA 1FI2A 1Q8VA 3O1TA 4MHUA 2WS91 1FXZA 3H8OA 1SZBA 3ZM8A 5A32B 4CUGA 3TN93 3ZLIA 4LPLA 1F2NA 3DCQA 1FPN1 2VUAA 4Y20A 4GWJA 4L8QA 5I93A 1LJ7A 4JGZB 3VKNA 2VMDA 2Z5WA 5FIXA 5C4WA 1QQP3 4JVAA 1TNRA 3QH7A 2RJKA 1PMHX 4CXYA 5F1RA 2P3YA 1JOPA 3CU7A 1GNHA 1JUHA 1Q5OA 3NNFA 4MZUA 1L7LA 3LEIA 3ZX7A 5FZHA 2VW2A 2DWRA 2Q1FA 4ITCA 4K8RB 1SPPA 4C1XA 2QQNA 4XJAA 5J96B 3TEWA 4QWNA 5A7PA 2ZOEB 2PQSA 2P1BA 2VZ1A 4EJRA 3EMRA 3GCXA 3ZXKA 3LEMA 1ODNA 2OUJA 1PVC3 2ZGKA 4YFWA 1MS8A 4AXOA 1YFYA 2VMIA 2AEZA 2XVGA 1TNFA 2R072 4N43A 5J36A 2RE9A 4NOTA 2HJIA 2NLRA 2RVAA 4OZOA 5LY2A 2ZEZA 1NUKA 5AFBA 2HWC3 1I9RA 4D0QA 4HVQA 2QCSB 4QB6A 2WZR1 1RHI3 4OCTA 4OYUA 3NSTA 4YZ3A 5T55A 1AJOA 3PIGA 4KG0A 2ZKNA 1GOHA 1CPNA 1WWYA 1IS6A 5FP3A 3ZIXA 3CLPA 3I2GA 3MUZ1 3M8LA 1E5SA 5FZIA 3BTYA 1AR82 5IVBA 1IPJA 1UU6A 3SQOA 2ZX0A 5KR7A 3KCCA 4XXAA 4CEYB 4RHV2 3Q8AA 3N4MA 2WQ8A 3BU7A 3PVNA 3IDAA 3NNLA 4XZPA 1MVQA 5JZGB 4GWMA 5FY1A 4A7YA 3D4KA 1FT9A 2IFWA 3VZLA 3USUB 1R091 3BGAA 3WF2A 3ETPA 3PU3A 4MXWB 2OA2A 5CNAA 2W87A 1OUXA 2J1SA 3FC0A 3GXUA 4M3CA 2YROA 1ZREA 1VBC3 1Z78A 3KHBA 5JMOA 1BXHA 5DDJ2 4OFGA 3W5MA 4H7LA 3OPWA 3U37A 2VNOA 1ASJ1 1W8TA 5FZFA 3OBZA 1NCRA 3K77A 3LPGA 4W50A 2R30A 4WM7C 4YGBA 2VCAA 3T2PA 4NVPA 4YFZA 1QXRA 3ZXJA 1CAWA 2RS11 1C8NA 5CAZA 3L2YA 2ZGTA 4IERA 1FATA 3AL5A 4CEWC 1LGCA 1TQ5A 2J7MA 4P5HA 1CWPA 1WLWA 1A78A 1YFWA 3ME2A 4OVEA 5BNNA 2J1VA 2WNVA 3RZJA 5BNPC 3HT1A 1HDKA 1APNA 2EVXA 2ZZJA 3D0SA 2MNGA 1S0DA 4AEDA 3W5NA 1W2AX 5T5LA 4IEXA 2E32A 3I2IA 4Y1ZA 5AFEA 4AI0A 1JH5A 2TNFA 3MIDA 4AFBA 1OI6A 5F3GA 2DTWA 2OKXA 4COWA 1ZM1A 3HOBA 4Y5TA 5C8CA 4OHXA 3VB9A 2OZJA 1K5JA 4EWDA 2BQPA 1LR5A 4N9IA 4YLZA 2WC2A 3U78A 2RR12 4LBJA 1X8EA 2P17A 3IIAA 5A1AA 5HPOA 1JXNA 1JW6A 1VBE1 3U10A 1WA4A 1QXJA 2KA3A 4NAMA 2QFEA 5A3WA 2DCZA 4JAAA 4URTA 1POV0 4CDXA 4BQXA 5GZCA 1GZTA 2YBKA 4XPVA 1VBB1 1XNCA 1H2KA 3LD8A 2H0BA 4MHRA 1A6CA 4AI9A 4Q0QA 2VQUA 5F5AA 2C24A 1QGLA 4FOYA 3VBFA 3UYJA 4LHLA 3WDXA 5I8YA 1YIPA 2JG8A 3J8F1 4R8HA 2XWJB 3FL7A 3EQEA 3C2UA 2H6BA 2CTVA 2W2IA 3JQXA 4B3NA 4Q1RA 4AFDA 2Q1ZB 4P9LA 3DF0A 2PLV1 1AR63 1PK6B 4Q4Y2 4XJUA 1EY2A 2P3JA 3B3QE 3DXUA 5FMDA 3WUDA 5T54A 1PZ9A 2BNOA 1ND3A 5FZ0A 2J1AA 5FYMA 2DUOA 5CU1A 4B1MA 2A7AA 2D93A 2GMPA 2YC2A 3T0BA 1W9WA 3CJIC 4EN0A 3PUIA 1ZBA3 2WYFA 1SLCA 3KF5A 3ZSEA 3RZKA 2UURA 2JX9A 3PUHA 5FY4A 1COV1 5FXZA 5FLIA 3WEZA 2DDUA 3OB8A 1CAUB 3MIEA 3SNMA 3V65A 1K12A 1ULEA 2PTMA 5LA2A 4CSWA 2QDNA 4NPLA 4BOWA 3Q8FA 2E33A 4RHV1 1W6MB 5T52A 1XE0A 1QHDA 5IHRA 4HG6B 4JDNA 1ZA7A 2Q8EA 4Z82A 1R1A1 5FZ7A 4FVVA 1UQXA 2VD7A 2F4PA 3OUIA 1MR5A 3V64A 1H8TC 1WCSA 4F8AA 4EZ4A 4BK4A 5M0TA 4YRDA 3H50A 3WW4A 3V0AA 1PIV3 3GDBA 3I2HA 2PAEA 3OD0A 1U5IA 1XB9A 2YMZA 1RJ8A 1VMHA 4B4QA 5FY0A 1CAVB 2AEYA 1GOFA 3VBHB 2W9XA 2V72A 1TMF3 4QX0A 4D6RA 4PCRA 5CFDC 4N43B 4W6WA 1OLMA 4PDWA 3FLRA 1AZDA 4E8CA 4N53A 2G1MA 2Y6FA 1QKQA 1PMJX 3OBAA 1AR93 1EPZA 2YC0A 3R0RA 1PO22 4GALA 4W4ZA 4RL7A 1VLNA 1H1IA 1QDCA 1ZZ9A 2NM1A 3FN9A 4AVSA 5ABJA 5J48A 3I4IA 4DXZA 3JU9A 2VOWA 3DKQA 1FNYA 1EUTA 5FYIA 3OCPA 3UESA 3GBFA 4E4ZA 2QZ3A 3WG2A 1H2LA 3R4SA 4WM7B 3WQ7A 4CDQB 4B4RA 4Y4YA 1W9FA 1UXZA 1DFQA 4XURA 4W8JA 5I0TA 5HI0A 5FK8A 3AK0A 3FFQA 3KLSA 2IXCA 4XBQA 3H1YA 1VRH1 4QKBA 5A33B 5JXHA 5JIUA 5L7OA 1GZWB 1GFF2 2ZEWA 3DPRA 2ENRA 1YO8A 2VG9A 1PGL1 1LOFC 2ZGLA 1TME3 3FHAA 2DVGA 2X5IB 2CU5A 1UMZA 1PZ8A 1Q8OA 3GHNA 4HKOA 4CDUC 1T6BX 1BLZA 1DQ0A 1T6GC 3HEIA 1WGPA 5FP7A 3WNOA 4ONUA 4NRQA 1QJX3 5G04L 4Q0SA 2TBVA 4M3CF 1V9U2 4CCEA 2JE7A 5FLHA 2Y6GA 3ZSKA 5A3PA 2ILMA 1ACCA 2WO7A 3NW4A 4QKDA 3RQ0A 3B5LB 4PF5A 3AP7A 3A7QA 5LASA 5CFCC 2E9QA 3A0KA 4HXCA 4OHYA 1KDMA 4CCCA 1T2XA 1SFPA 5CIRA 2BBVA 1W39A 4Q0UA 1N1YA 1D4M1 3B9CA 1Z7S3 3EYPA 2BZDA 2VNVA 4YW1A 3SCHA 4MG2A 1HKDA 1JOJA 4JQRA 1UPIA 2XXZA 3CZJA 4XZUG 2UWBA 4PI0A 4XUTA 4BQ1A 5A3LA 2VBPA 5I0RA 1YEWA 3ACLA 4CU9A 1RUC2 1UMIA 2XJSA 4KNCA 2P3IA 2CGNA 5K0UC 5GLWA 1NKGA 4MGTA 4S2FA 1F8VA 5ERLA 3PNAA 4TSVA 1UYXA 4YW2A 1W6NB 3I3QA 5KXCA 1E5RA 1PGSA 2LTNA 3BOPA 1RMU1 1GYKA 3C3VA 2W52A 4GKXA 1GU3A 4NHKA 1I3HA 5KHGA 2J1TA 3D6EA 5FPAA 3VBSA 1LHOA 2VECA 1PVXA 3TEYA 1CJDA 5KHIA 3DECA 3JXSA 4O9GA 2D7FA 5GZGA 3O1MA 3JD73 1DCSA 1FMD2 1HB2A 1LU1A 4OUMA 3ZXGA 5ACA3 2BNNA 2K2SA 2OW4A 2WRAA 1TZOA 3FHQA 2NZ9A 4XXPA 3MIGA 4O65A 1ND2A 1US3A 4HMZA 2XHKA 2AACA 4L2NA 3EXUA 4F7ZA 2GNBA 1GNZA 3M7AA 2IZWA 4AFAA 1W2TA 1S0JA 3AKQA 3ORJA 3VBOC 4A3XA 3I7DA 1UKGA 4EROA 4X8NA 3AXDA 2GN3A 4AYUA 4ARYA 2EF6A 4LIUA 3WF3A 5F5QA 5IVVA 1XJAA 3PLQA 3RFRA 5CEHA 4QPYA 3BTXA 4AL9A 2FDKA 3HJRA 2WQZC 3DEMA 2WO3A 2CL2A 2WFPA 3IIIA 4BU2A 5JUVA 1LENA 2JD9A 5FO7B 5BYNA 4UXAA 5FKCA 1HQWA 2AR6A 2EAAA 3TAYA 1PO21 5CYYA 5C6CA 5HV0A 1A3KA 1PX4A 4FAHA 1LEMA 1WCQA 1R081 3WQBA 2CGOA 3T2OA 4AEKA 4CP0A 1MQTA 5IK5A 2O1QA 2EALA 4NAOA 5FZKA 5CFDB 2GU9A 3UNPA 2W3JA 2BP6A 4QD2A 5D1IA 1BBT2 1FYUA 1YNAA 4Q26A 1EAH3 1CONA 1M4WA 4BA6A 3CJXA 2XJQA 5BNOC 2P5BA 3PMSA 2V4VA 1FOD3 1CZTA 1HXS1 3CKHA 3ZKUA 4HSLA 3RZMA 1FNZA 1UMHA 1PO12 4FPFA 2YBPA 4K1YA 5FZEA 3TOJA 3AVSA 4MGIE 4WM8B 4YW3A 2ZAAA 4YWAA 4QX2A 4B8EA 5KC6A 4FOQA 5F8PA 2P2KA 4FI9A 4K8FA 4JV4A 1UX7A 2D43A 2F4LA 1S2EA 1JUIA 2DVDA 2YYOA 3GBWA 1CAXA 4MGQA 4XJZA 3THCA 1HB4A 4XAAA 1O8PA 3AKSA 1WW4A 1CZSA 2DCKA 5J98B 1IQAA 2ZJCA 1F9KA 4KWJA 3UL2A 1YYNA 2EICA 3OEBA 5LBFA 3WNXA 3UKNA 5APAA 1GZ9A 5A6XA 4GULA 4Y1VA 3NRUA 1HB3A 2YHJA 2QVSB 3HNYM 1LGBA 1JOBA 1IHMA 1RUJ1 1Y43B 4I3PA 5FBZA 4G4FA 2VW1A 2GC0A 3OJBA 1DDLA 1RUG2 2AREA 2RS53 2NMNA 1B35A 3VHRA 2TUNA 3H3UA 1UY1A 4LUKA 1QEXA 1SFYA 1YFUA 1W28A 3GZEA 5FZOA 3TNPB 5D8AB 2ZS6B 3RYPA 3S6PA 3ZFFC 1KS5A 4I02A 1VJ2A 3TB0A 5JMCA 4AGRA 3GNEA 2DUQA 2XLFA 1FAYA 3WD5A 1VBD1 1NYWA 3E5XA 3OGRA 4QX7A 2RV9A 1W9TA 2WFF2 5FZLA 3RNSA 5L7OB 1GLHA 1W06A 2ET1A 4Y5Z0 5E1RA 3DGTA 1XYOA 3E5UA 2PYTA 2RS31 5A7OA 4L9BA 2XVLA 5K0UB 3JBG3 2FQPA 1ZRDA 4BJ0A 2RG4A 3MEPA 1XU1A 3AJZA 2XKPA 1LRHA 2DUPA 1AX0A 1HRV2 1RB8G 4AE2A 3PL0A 1W6OA 2EXHA 4KQ7A 3CBNA 1H9WA 3ACHA 4Q1PA 2P37A 2BUKA 5JSRA 1RUI2 1EV13 2R063 3J26N 4IE0A 1OOPC 2VTXJ 1OPMA 1H0BA 3POBA 5JCTA 3O1PA 1DGWA 1KJLA 3AFKA 3O0VA 1RVF2 5F32A 5C3SA 5L73A 1AL23 4NJ4A 5GM0A 2RMU3 4FO9A 5A7QA 1WW5A 4HVRA 3S30A 5JXIA 4RSUA 4UWDA 1O91A 2HWF2 2QKDA 2YU2A 4R9DA 4CA9A 4D7TA 4ZU7A 1IGOA 1FV2A 3J9SA 3PUAA 4QKFA 3M2MA 4BH9A 5EYYA 2HWE1 5IVEA 1ST8A 4LK6A 1U12A 3GBGA 4XHXA 1BEV2 1NA1B 1NZCA 3L9JT 4QQPA 4NN0A 1BBT1 3ZFGC 2N7GA 3R05A 2NPIA 2LM3A 4QPGC 3ZR5A 4YVSC 5GKAC 2BGOA 2RDRA 5C70A 2QTWB 2OT7A 3OUHA 4HONA 5KHJA 2W92A 3KMHA 3VUOA 1I1EA 3PTRB 1ZBE3 4CUCA 5K4LA 4LT5A 4C91A 2HWD2 3IM0A 4UAPA 2R0FA 4FOVA 4IXLA 1RUD1 5FZ3A 2VCCA 1NCQA 3LIHA 4HFSA 4TLGA 2A6XA 1CPMA 1Y9QA 4LOSA 2BRTA 1OC1A 3LEKA 3BKZA 5A80A 3U07A 3AMPA 3I59A 2LW8A 4JKMA 5AVPA 4CPBA 3D5OA 3WXPA 4UFIA 4HPKB 4LMFA 1REDA 3H42B 1QOSA 2YBSA 2AGSA 5IWFA 1NZIA 2CAVA 2W47A 1UNBA 2YGLA 4H7MA 5ANQA 4D7YA 1UAIA 1W2UA 1YI9A 2MEV3 4P9XA 1MEC3 4J6GA 4QHOA 1LULA 1RUF3 1RUG1 1US2A 1XOYA 3HAGA 4ZZ5A 4META 3T4VA 3Q8BA 1DQ4A 2Y26A 4UYBA 1C57A 3ZPOA 3AYEA 5I0UA 1VB4A 2W94A 2Y6HA 1V6NA 2XVKA 4QPIA 1Q56A 3MW4A 1ZZ6A 4ZS3A 1BQPA 4YM1A 3P6BA 1Q8QA 2KR2A 4NUBA 3OGSA 4CUAA 3H3LA 1KD7A 4E4DX 2EXKA 2EXIA 2UWCA 2G9FA 2JDHA 1UF2C 1UXXX 1VR3A 3VHOA 3LPFA 3T4HB 1LGNA 5AVAA 4RQPB 3KV6A 4LBOA 1I6XA 2WFF1 3AYCA 2ZMNA 1AYM3 2HEYF 4LBQA 1YUDA 3AX4A 2BOJA 2ZGOA 2ZEYA 4UOJA 3TYJA 1QJY3 2HWB1 1DYPA 2FMDA 2FCTA 3MLJA 1W8NA 5J09A 4GB31 2HBTA 2WQ4A 2AUYA 3MLKA 4Q29A 2RDSA 5TSWA 4P00B 1SCRA 3ZFFB 5E16A 5JIAA 4OQ9A 3I3DA 1LOEA 2DURA 4Q4X1 1D2SA 4B7KA 1QJU1 2GNDA 4E27A 5C9AB 1ULPA 4I01A 4IW3A 3O1SA 1IS5A 4LBNA 5GALA 3LQCA 1OT5A 3KV5A 3VDBA 1C3HA 1ZVFA 4TN7A 4D94A 3TEZA 1AYN3 1Q8PA 5JSPA 1RUI1 3KF3A 3VZKA 2LS6A 3AKTA 3U11A 4CEYC 2EIBA 1BMV2 4BIFA 4URAA 1WMXA 4YGEA 2JECA 1QNWA 1S0CA 4CCJA 2ZAHA 3AP6A 1K5MA 3AYDA 5JZGC 3TN92 5FZ1A 5T50A 3UGGA 2I45A 2JE9A 3UKVA 4JGYB 1B35B 4LITA 1W8HA 4IV1A 1D0GA 5GJ6A 3AL6A 4K20A 2O0OA 4HOOA 2EAKA 3C7OA 4QGLA 2AC1A 3QBQA 2AH2A 2QQJA 4UW6A 3NJVA 3H8XA 1E5HA 1QQP2 1YFXA 2NYYA 4GXLA 1VAMA 4J1XA 4YW7A 4I0AA 4DXSA 1JYCA 1JZ6A 4F3JA 1S0IA 4BCUA 2QQKA 1Y7BA 4DUXA 2OIIA 3H7YA 1LOAA 3VBUB 2WS93 1Z0HA 4A6OA 3SLIA 1VRBA 5LW9A 3C7FA 2JDKA 5FPXA 1Q43A 2GNTA 3F2ZA 3LFMA 4DXTA 4EWAA 3MBWA 1FPN3 2KM2A 3OG2A 1W90A 4LLFA 2VNGA 3O7OA 4LHNA 5FY7A 1QXPA 3SMHA 1KGYA 4AQ6A 5E8AA 4CZSA 1B09A 2W0XA 4M0HA 1X8MA 2BFUS 4I0BA 2JDZA 3JQWA 3ZXEA 1UD1A 4AHYA 4XQDA 4COVA 5F6LB 4F83A 1PVC2 2VMEA 4W6XA 1PGW2 5LEKA 2BFUL 2D3RA 2RHPA 2VE1A 2VOVA 3DYMA 1W8UA 3ZYPA 1RTVA 2HWC2 4PIXA 1J1LA 2BPA2 3WCSA 3N9NA 2CAUA 3PUSA 1MZEA 3FJSA 4BXFA 4DUWA 4NPRA 2ZZQA 3K3OA 1RHI2 5FOBB 1UO9A 5C33A 3G6JB 3SKJE 3BTZA 4LE4A 1LECA 2VZOA 1ENRA 3AP5A 3OY8B 3RS6A 3HR9A 2JB4A 3IDEA 5LRSA 3RSJA 2D3SA 4KWKA 3NO8A 5LBEA 4TYSA 2X29A 3M4FA 4U36A 4RR3B 1ULGA 2E53A 4XILA 5IAVA 4AI8A 3NL1A 2E6VA 1LAJA 1XQNA 2ZX1A 3MV01 5HCHA 3I2OA 1LHNA 2VPVA 4AHWA 2EXJA 3IPVA 4BM8A 1ZA4A 2DCYA 5JSOA 3ECQA 3V0BB 1Q3EA 4YVWB 2YU1A 3LA3A 3I3MA 3M3CA 3OYWA 2O8QA 4K21A 3BB6A 4LBKA 5FK7A 3NKGA 3LCPA 1UU4A 1PK6C 3VL9A 5A6ZA 3O0WA 2WNUB 4CYDA 1F5JA 1JYVA 3BTAA 4P9IA 2JENA 2SBAA 3DXTA 4V1PA 1JYXA 3T1LA 4IE4A 3WR0A 5BUVA 3NVCA 1SCSA 4P9GA 1VBC2 3HQXA 4BQ4A 4JTOA 1G9DA 2FZ2A 1C8M1 1W6PB 4XF4A 2DV9A 1KS4A 1UY3A 1SACA 1QY4A 1W2OA 2BNMA 1CQ9A 2WZEA 1DGRN 5IVFA 3QLQA 5I8TA 4XAEA 2A6ZA 1JU4A 2VTXA 1J1TA 1BMV1 3JB4C 1O59A 4IGOA 2A3XA 2XWBB 4ISRA 5JLVA 4NMIA 2VZQA 3USSA 4NROA 4IEOA 1R093 4YPJA 1IKQA 2ADDA 5I0DA 1LEDA 5C7GA 4FOWA 5FYVA 3T0AA 3DV8A 4JQTA 1RUH1 1VALA 1C5HA 2ARCA 2WT2A 2JD4A 1G86A 4BQ2A 5A1LA 4IETA 1AR73 5FV3A 5FP9A 1ASJ3 2J1EA 4QPIB 2WWSA 3OSDA 4A7KA 4AGVA 2B9VA 2YY1A 1QQP1 3CO2A 3VBHC 4Q0VA 1BCXA 1DG6A 1GP4A 5BPXA 4YZ2A 1H9PA 3ILNA 3POYA 4AR2A 4WZCA 4Q4V2 2OX0A 4N43C 3PURA 1NY71 1ZYBA 2R1DA 4NHXA 4LKDA 4RGGA 5FWEA 2PHTA 1SHWB 1WD3A 2OYZA 1K45A 2ZGUA 3NAPA 4P9YA 4CXWA 3VD9A 3PIJA 3N7KA 3E6CC 1M06G 1CZVA 3OD4A 4IEYA 5GLUA 4D69A 2DBIA 3CQOA 1QWRA 4S2HA 5EV7A 3UGFA 1O3RA 2ZX2A 1DZQA 3VDDA 1W8WA 4DB5A 4GH4B 3N7LA 1VBA1 1PVC1 2JG9A 2RJLA 1PGW1 3BODA 4QXCA 1GWLA 2WLPA 4FQZA 4QQ2A 1AR62 2VZRA 4HVOA 3WF1A 4BDVB 5J37A 3P3NA 1ENXA 1VBE3 4A4AA 1GP5A 2RJ2A 4B1LA 2WLQA 2VQ0A 2Y0OA 1IQDC 4L99A 4D6QA 3AP9A 1OH4A 4CCOA 4R4ZA 3MF9A 3B02A 4XTMA 2YFZA 1LHVA 1VBB3 1ZBA2 1K5MB 4KBBA 4Z2WA 1G8WA 2ZGMA 5EJ3A 4AQTA 4Q8LA 2CYFA 3C8XA 4FXGB 3WP4A 1HN1A 2EA7A 2X5IC 2ZTNA 3B00A 3J8F3 1V6MA 4GMP3 5FPVA 1REEA 1ULFA 3MI8A 4LA3A 3MYXA 3IDBB 4KU8A 4QQHA 1H8VA 2PLV3 5EYXA 4CCMA 1ENSA 1UN1A 2VZUA 3CEWA 3QOPA 5FUIA 4LLOA 1U0AA 2Z69A 3ZYFA 4IGQA 3D82A 2Q8DA 3ZYJB 1KJRA 2QQIA 2VR4A 2B39A 1D4VB 4BYYA 4TWTA 4A42A 4Y22A 2UU8A 1CN1A 5DAQA 1COV3 1POV1 3U14A 4LKSA 1J3RA 1PIV2 2R7EB 2O8OA 4HL0A 3E97A 4LO6B 2BVVA 1W0NA 4XQ4A 1SDDB 3VHNA 5FZDA 3VBRB 3AZYA 4QX1A 2EIDA 4MGYE 3GALA 4J1WA 5FCCA 1LTEA 3T2QA 5IATA 5KXEA 3W58A 3IKWA 1TMF2 5A7WA 3CJIA 3HBZA 2R071 4AEDC 4BMEA 4RS5A 4FSJA 3KT1A 4DRRA 5BV6A 5JDBA 1HQLA 3HQUA 1OVSA 2XBO3 2W08A 5DAPA 5DABA 5IUQA 1R1A3 3ZSJA 2JDMA 2NQYA 1W3XA 4ZS2A 1O7FA 4Q5OA 1AR92 1UU5A 3C7GA 4UI9L 4QPWA 5E89A 5IW0A 3RZZA 4BQYA 2CDPA 2WJSA 3HN1A 2ORZA 3WNLA 4LOTA 3M3IA 2PQQA 5EP9A 5F3CA 1JZ3A 1XE7A 4MADA 5AC93 2I2SA 3T1MA 2VY0A 1JHJA 1GICA 3N9OA 3CDZB 4Y20B 4D3WA 5FAXA 4IV3A 4AI3A 1AR81 2ZX4A 3ACFA 1ZZ7A 1H8TA 3LSEA 4KH9A 4MLOA 1SDWA 3ILRA 5C4WB 5K9YA 1RUOA 1KEXA 1AXKA 1NG0A 5FP4A 5IFTA 3O1VA 3CMGA 3RMXA 3N9PA 4Q4V1 1BVP1 4FTBA 1TME2 1JTZX 1Y3TA 2E26A 3IN9A 5LBBA 1NQDA 5A3NA 3MGUA 2VZPA 1SPPB 2B9UA 3S0MA 4LK7A 4DINB 4R52A 4FPHA 2XQXA 4XFBA 1OHFA 3HMYA 1QJX2 2XMLA 4QT6A 5DDJ1 4P9JA 3IT8A 1HRI3 1KXGA 4FPJA 2Q0AA 3HWJA 4FPEA 1IPSA 3I49A 3KT4A 3AC0A 5JOWA 3UK9A 1AR61 3LFIA 3NV2A 4BPZA 1VRH3 2B7YA 2P3KA 1D7PM 1JZ2A 3W9AA 3WNNA 3I2JA 3OOXA 5FQ0A 1Z7S2 4UW5A 4O9EA 1ZBA1 4XQWA 2ADEA 2YPJA 4CP1A 3I2KA 3WVJA 5JXJA 4X6RB 4PF1A 1SLIA 4WM8C 2JXAA 2HYKA 4FFIA 3ZYBA 3NNJA 4M3CE 2PN5A 1CVNA 5C8WA 5I91A 1JBCA 5FYUA 4JHZA 2DTYA 2GSYA 4HKLA 5FZGA 4ES9A 2RR11 3MIHA 4CDQC 5LWBA 3PVOA 3X29B 3MHZA 4BB3A 2VBBA 1D4M3 2E63A 3ILFA 3I3EA 3JD72 5J3UA 2J22A 5ACA2 4E9KA 3SEPA 3O1OA 1UW8A 4PDWC 1VPHA 2D3PA 5HBAA 2GH8A 3BPSA 1U5ZA 1Y4WA 5LA9A 2XUEA 5JOXA 1IS3A 1PIV1 2PHDA 1UY0A 3K4ZA 3VKOA 5HV4A 2IXJA 3N35A 1IKPA 2E51A 4M3CB 5DAVA 3ABZA 4FP3A 4LR4A 1X82A 4MGSA 5LK5A 5CFCA 5SV8A 2D44A 1RMU3 2FDHA 1PZ7A 3WW1A 2JG9B 5D8AC 1LESA 1NCRB 1YLLA 4JCKA 4Q4Y1 4WVWA 3I3BA 5C3RA 1ZX5A 2A6WA 2F17A 1CAWB 1W9YA 3ZMOA 4L97A 4INDA 1AR91 1PNGA 4CTEA 3OGJA 2UY9A 3FE5A 3WF0A 4LTAA 2XH6A 2B46X 2QJVA 5L7OC 3T09A 2XONA 5BNNB 1V70A 3MPBA 4KBZA 2WNVB 2W1WA 2Y33A 3G7DA 2WINB 2Y38A 4HN1A 4Y1XA 2W5FA 1NQJA 1SMVA 1V6KA 3B01A 3I2FA 5L9BA 1TG7A 3ZPYA 1QJZA 4AEDB 4K9SA 3RGBA 2YUEA 4N7IA 5CADA 1QOTA 5FO9B 5GLZA 1TEIA 1EAH2 3I97A 2WO2A 3AVRA 3LAGA 2HLEA 3SXWA 5DZFA 5C8CB 4Q8KA 2WKKA 5JWPA 3LEGA 4IE5A 5G05L 5J1XA 4Q2FA 3FHIB 1FOD2 2XHNA 5DAXA 1OFNA 3WCRA 4UFMA 2JB8A 1RGSA 4DS0A 3GZUC 1V00A 1ZZ8A 2ZMKA 5FUPA 3N7MA 4ZXEA 3VBOA 4ZXKA 4AFMA 1TME1 2FMYA 4C8DA 2VU9A 4GJYA 3Q9OA 2B42B 2XJVA 4QU2A 4CDXB 2R043 1R083 4P08A 3KGZA 1H1AA 1X9PA 1P8JA 1VB2A 1JYNA 1NE6A 4XE9A 4GAZA 5L9RA 4L11A 4COZA 1QJX1 3VBFB 5F2SA 4KGQA 3GGLA 2JG8B 3H0OA 1QMJA 1OQDA 2YV8A 4QXHA 2ZA9A 1R64A 1DU3D 3GHMA 4JC1A 1HXS3 4Y26A 1JODA 4DMIA 1DGLA 1NA1C 4AI2A 4PT6A 4NE9A 1PNFA 3L2HA 2OUHA 4K40A 1ND3B 1RUE3 1O8SA 4HETA 3WP5A 3ZDSA 3FBMA 2BTVC 1Z7S1 4MX3A 2D40A 2RS52 3VBSC 2P34A 4FPKA 3A21A 4OHVA 5FOJB 3VZMA 1XNBA 1CIWA 3GM8A 5DAWA 4Z92B 2QBXA 5JPNB 5CG8A 5BNOA 3MFCA 3UETA 3R4UA 2IXHA 3SKVA 1OKOA 1STMA 2I74A 3ZYIB 4IV3B 1MZ5A 1AX1A 2JDUA 4QXBA 4GQ7A 2NP0A 2WSVA 4N90A 4OMDA 1UOGA 3VGIA 2IXIA 1J3QA 1DQ2A 5FYSA 1LHWA 1RUJ3 3KM5A 4YSFA 2W1UA 1V6IA 3JD71 3BYWA 4U2AA 2YDEA 5ACA1 5DUXA 5FZMA 3NNGA 2ZBJA 3K51A 2DVAA 5LBCA 4Q4W3 3JBG2 2NMOA 5FP8A 2QNKA 3V0AB 2WL1A 1NX9A 3FUOA 1XPWA 3AKPA 1AL0G 4R9BA 3U0ZA 3ZSLA 4M4RA 2VZSA 2FDGA 3MF6A 5DN2A 4CCNA 3LKJA 5FFOC 1V9U1 4LKFA 4AVTA 3WW2A 3DYOA 3WNPA 4AOCA 1MQTC 1VBD3 2R062 1EV12 3VKLA 3M1HA 2HEWF 4PDWB 3IAPA 4IQPA 2OPKA 2R6QA 2X8KA 4N9HA 2RS33 1AL22 4N53B 5HXMA 2RMU2 5KXBA 4RQPC 2A5ZA 2ET7A 5C3QA 1REFA 5F7UA 3MV11 3POJA 3ZMNA 5JPMB 2RDQA 2EIEA 5A70A 5ABJB 1RUC1 3B9IA 3THPA 5FYCA 2Y6KA 1JHNA 1NLRA 1EYBA 3ZR6A 4DIQA 1YRZA 4IEVA 2Y34A 4M0NA 4CUBA 3UT0A 5C9AC 1RIRA 1UOJA 1UYZA 4CP9A 1LOGA 5EPAA 4ATEA 4FQ4A 3VLBB 1GWMA 2IUWA 1H6XA 1N47A 1ZNPA 5KWRA 2DF7A 5FO8B 1FMD1 1F5FA 1HB1A 3DPRB 2LUWA 1ZBE2 4BXSV 1NOVA 2BBAA 4LA2A 2CHHA 4MH0E 4KG8A 3VV1A 2QUOA 3WNMA 2PAMA 1WCUA 3Q8CA 4D7SA 3K46A 1Y9MA 4YARA 1ULDA 2ZHKA 4SLIA 4Y24A 4ASKA 4ES8A 2HWE3 2R1BA 1XXNA 3KVAA 1OOPA 4ASLA 1YJKA 1NE4A 4JGYC 1B35C 2VTFA 3WZ1A 2HKXA 2VGDA 3SHRA 3ZFEA 4DQAA 2GMEA 2KD7A 3MDPA 4MYEA 2E7QA 1XBFA 2ZHNA 2RM23 1VE0A 3AMHA 4Y1UA 1SLLA 2VMGA 1G7YA 4KWLA 1YXWA 2KXLA 3Q8EA 1ZRIA 2DU0A 1X9TA 4HANA 4M01A 1OUSA 2MEV2 2OPWA 1AF9A 1MEC2 1HV0A 1W2NA 2JE8A 2W68A 1N1SA 1QNYA 2Q8CA 4CU6A 2A1XA 3T0DA 3KS7A 1RUF2 4OLLA 2VNRA 2RS51 3VBUC 1H30A 1RUD3 2Z42A 3M3EA 2CGPA 4HKWA 4XJ9A 1F4AA 3ST7A 2JDYA 3ZFGA 4GA9A 1JZ5A 1DZRA 1V6OA 2D98A 2Z4FA 4BQ3A 2B45X 4QPGA 1G9BA 4YVSA 4UF0A 3WQ0A 2B4KA 4MVTA 3MZHA 4Q27A 4E2GA 4AW7A 2ZPXA 3J7LA 3PU8A 5F39A 1BJQA 5CKNA 1KDKA 2VUCA 2XDVA 3LDKA 1OSGA 4Z1VA 4P14A 5FZ4A 3D8CA 1OF4A 4E4HA 3PJQA 1LB2A 2PAKA 3GJBA 3VBSB 2C1FA 4WVVA 1AYM2 3PTYA 4LNVA 4Y33A 5A32A 1PO11 3GF6A 4QAWA 4RFT0 1QJY2 1S55A 4HT1T 3WF4A 3VD5A 4LO7A 4X6QB 2VCMA 4ORFA 1RYYA 3JBG1 3SISA 3RG0A 3CIHA 3PMEA 1ND2B 2VVDA 4HSJA 5C5TA 3NKTA 1W3VA 4JGZA 5JXGA 4IE7A 3TBDA 4AAXA 2EIGA 3S7EA 1JN2P 3WQ1A 4AQSA 4FTEA 2HBUA 3H8UA 4XF0A 1UZ0A 5A6QA 4P5YA 3OBRA 3EB7A 3UV9A 2QQPA 4RR3C 5LK7B 5H9RA 2ATFA 5FRAA 1AYN2 4CDWA 3LOIA 2PA7A 2R061 2W95A 3VDAA 2GMMA 1X50A 3KT7A 5DQ0A 2GDFA 4LHSA 5KXDA 2HWB3 1AL21 3O14A 4JTNA 2OVUA 4NWWA 4QX5A 4YVWC 4GB33 5FYBA 3T08A 4DEQA 4XHBA 1BZWA 5A1FA 4E8DA 1LODA 2IVIB 1LU2A 1AUYA 1W9SA 3RDIA 1DIWA 2WNUC 4V2VA 4XUQA 4Q4X3 5LEJA 3S5AA 4FPCA 1AVBA 1QJU3 4EWEA 3HBKA 2D5HA 3RWKX 3POSA 5DUUA 1MQTB 2P4EA 2Q30A 4AQ2A 4BK5A 2JKXA 4PBPA 1GSLA 2QQWA 1NCQC 1UZVA 3GZTB 3TNQA 2WABA 1IPKA 3FLTA 2V5YA 2R0HA 1R1ZA 2A3WA 1BKZA 4Z8BA 2ZX3A 4YW5A 5FMCA 2WS92 4YYOA 3PJYA 1JS9A 1GBGA 5IK8A 1WMDA 1BHGA 2E7TA 4XUPA 4XFFA 4OMCA 3U1XA 4AVBA 2LROA 4CXXA 1FPN2 3LIGA 2YZ4A 3A23A 3QH6A 2R32A 2C9KA 2C4XA 1AJKA 1CESA 3OGGA 2PHFA 4OUSA 2XGXA 2ZACA 1O5UA 4P9WA 4PQQA 2VOXA 1FV3A 3OTFA 1JZ4A 1CAXB 3KV9A 4XBLA 4CEYA 3PUQA 4XETA 4UFKA 1AXYA 1H2NA 1GMMA 1HRV1 3TRSB 2QZ2A 1ZRRA 1F31A 4KU7A 1GNYA 5JZGA 2JWPA 4QPIC 3WX5A 2VUJA 5C3PA 1DF0A 1OXCA 1OKQA 2VM9A 4PIZA 1YQ5A 2MEV1 2WO1A 4LORA 3USUA 1MEC1 1RVF1 2HH9A 4UFJA 4EZHA 1RUF1 4LEJA 4MXWA 2GC3A 2GC1A 5A7SA 2HWF1 1YHFA 3VKMA 2Q1MA 2D97A 4LHKA 2XOMA 4QM9A 1IG3A 5FZOB 3UGHA 5CZKA 3TEXA 1BEV1 4JRLA 5E6HA 1BK1A 3KVBA 3WDVA 5EJZB 4NIHA 1YIFA 3DL3A 5EFUA 4GH4C 2JDPA 5BY5A 1NXD1 1GOGA 1UY2A 2GP3A 2VBDA 2ZGRA 3UJQA 3HN3A 5LCWL 4XABA 4ZHNA 3ZXDA 4A6SA 3K3NA 4XYXA 3WV6A 2H0VA 2HWD1 4OULA 3EO6A 5LA0A 2PHRA 1TVGA 5FTTC 2D6NA 4UW3A 3DUIA 1K5MC 4RFRB 5JI7A 5FPLA 3S7IA 2WR9A 5EHDA 1GQHA 1TE1B 1OQ1A 3NWKA 3ZFEB 4W6YA 1J84A 2WZPP 3IAQA 2XR4A 5FLJA 1W6OB 2PHWA 3MFAA 3RPQA 3D0JA 1AYN1 1UIJA 3NQHA 4XIKA 3CZUA 1QIQA 1EP0A 3AMMA 3HNMA 4RGKA 2ORXA 1YQ6A 1R092 4KWUA 3LDBA 1KRIA 1MS5A 1WW7A 2D6LX 3J7NA 2ARXA 2ZHMA 4S2GA 3KQRA 2BWAA 1HJGA 2ETEA 1C8M3 2Y6JA 5DG2A 2XUMA 4CE8A 2XLGA 1AR72 1GR3A 4Y1YA 5FZCA 4MXVA 2QE3A 1ASJ2 1WCKA 4MSVA 3WNKA 4D8MA 5C71A 5A7NA 4COYA 1OA4A 1W8FA 2ZABA 4QHZA 1PK6A 5ISLA 3OUJA 4XF1A 2RDNA 1VAKA 3UJOA 3RJ2X 4ARXA 3S57A 2WYSA 2WZ8A 4NRPA 3VBRC 4NIGA 4MUVA 4IEPA 1N3OA 2G4IA 3E6BA 3E6DA 1CJPA 2QQUA 4AAPA 2WZR3 5FYZA 1H4GA 1PX3A 2DCJA 1UOFA 2VOKA 1RITA 2FCVA 3RYKA 2FD8A 3K4AA 1UWWA 2D6MA 1U5XA 5GLTA 3SH4A 1RUH3 1VP6A 2C9AA 3BN6A 5L9VA 4YGDA 3INAA 3M3OA 4PIYA 1I5ZA 5JR2A 1CAUA 1CX4A 3RVHA 1NCQB 3ENRA 2FDJA 1MACA 3T30A 1YJLA 2GZWA 1DZTA 2K0GA 1IZ3A 4M4PA 3LSDA 4Z07A 1W6MA 5FJKA 3BI3A 2GALA 2VQAA 4DZGA 2VJXA 3I59B 1DGRA 2YG0A 1MS0A 4QXKA 4CDWB 1VBE2 2LALA 2PXJA 4LBMA 4YW6A 3MO4A 2QQOA 5SV5A 5C4WC 2XB6C 3K4DA 1UX6A 1VBB2 1JI6A 5K8SA 1UZYA 4COUA 1S1AA 1K3IA 2VULA 3TN91 4AI1A 4AVVA 4DUVA 4QM8A 4N7UA 1CAVA 5FY8A 4YZ5A 2D6KA 2C6SA 3VBHA 3J8F2 2GP5A 5LB6A 2GNMA 4YNIA 4OQ8A 1VBA3 2UY8A 4XF3A 5A3TA 4AHXA 4E2QA 2X09A 3FMGA 4QX8A 3ZXFA 3LF7A 4NPMA 2D6OX 3AFGA 2PLV2 4ISQA 4NWVA 2WNOA 3NJXA 5FMOS 1C28A 2RS13 3C7HA 2FDFA 1ODMA 2XL7A 3AMQA 3HD8B 3RI9A 3ACIA 5FMOL 4W65A 4XOGA 1EUUA 4XF9A 4JKKA 1OA3A 5FZAA 1G9FA 4LBQB 1UCXA 2QQVA 3IMNA 1LOCA 3N9LA 5F3EA 2AENA 1L7QA 4FAGA 1COV2 2VH9A 2VMCA 4WM7A 4CDQA 4RD7A 4AFCA 4FBFA 3TWIA 3SITA 5F9TA 1VMFA 4BLJA 4JHTA 1W8OA 4UFLA 5F5IA 4YG3A 5HXVA 1SBFA 1YQ2A 2YPDA 4XJWA 4QHBA 4CEWA 2VXJA 1G6NA 1OD3A 1ULOA 4LJHA 4R4XA 1X36A 4TLFA 1LOBA 2X53S 5A33A 1HIXA 1GZWA 5FBJA 3VZJA 3N36A 2XBO2 1UPSA 3FFZA 3NNMA 3FLPA 1SFNA 4OHZA 2HWC1 1R1A2 5BNPA 5IFPA 2OXBA 4GKYA 4BWOA 2X5IA 2MPFA 3VN4A 4LUMA 3VHPA 2OS2A 3H1MA 5HCBA 1RHI1 3KGLA 3W21A 4AGGA 4BLIA 3N7JA 1H6YA 1KQRA 1PM7A 1POV3 4OI2A 1U5YA 2A73B 2E7AA 3NV4A 5IVJA 5A6YA 3MUY1 4ET7A 2CY6A 1D0HA 2GH2A 3ACGA 2G9ZA 1L7RA 2Z2SB 5GZEA 3GYDA 1AR71 3M70A 1XNTA 3RI8A 4IV1B 3URFA 3NAPC 5AC92 3ES1A 5JOYA 2DCTA 4YM0A 1C1LA 1E5IA 3VZNA 4ZKTB 1ZZBA 1OBNA 2R073 2Y60A 4KI5M 1NLSA 5DMYA 3RYRA 3VDDC 1ULCA 4TXWA 2K9ZA 2JG9C 2W91A 1GQPA 2BGCA 1WLDA 4LO4B 5EWSA 2FCUA 3RJRA 2PMWB 1OQEA 2WDBA 1NCRC 3M3QA 4GIQA 4JZRA 4H14A 4FCAA 3MICA 2JEMA 4A44A 1QH7A 4Y3OA 4UT5A 2VZ3A 3RWNA 1IOAA 3CL1A 1O3TA 5F6KA 4XFCA 1X33A 1UZWA 1XU2A 2JIJA 3KZ4C 4P02B 5DUVA 4E2SA 5LRRA 1VBC1 5JAXA 1W6NA 2IXKA 1AR83 1FX5A 1UOBA 4IEZA 4K3UA 5BNNC 1HRI2 1X7NA 2WNVC 2WT1A 1J83A 3MIFA 1F4HA 4XVHA 3AZZA 4RHV3 4XDPA 4NIDA 1YCIA 5H9SA 3WHTA 4J25A 1RL3A 4DNYA 5FUNA 2WWUA 1VIWB 1VRH2 1DP0A 3VZOA 1UYPA 3ASIA 4Q4V3 1WA6X 2DVBA 5C8CC 4XDOA 1PGL2 3LE0A 4M00A 1RXFA 3QCWA 2YXSA 3P3PA 4MO3M 3RRDA 2J1RA 3U4XA 1LNSA 4GZ9A 4IEUA 2CDOA 3WG3A 4EYUA 1S0EA 4L0PA 5DDJ3 3S5QA 4GMP0 4CDXC 5H9QA 2YGMA 4GMP1 5FXVA 4QMAA 1J3PA 5FDBA 4I30A 5CA6A 1HN0A 3MW3A 4EN6B 5GZDA 1A8DA 2ID4A 3VBFC 2ARBA 3ZN5A 1C4RA 4QDSA 2JG8C 1H4HA 3IPVB 2BDRA 4O61A 1URXA 3ZYHA 3OYWB 1ALYA 1D4M2 2CSGA 4B29A 5KHKA 4RS5C 1OH3A 5CKMA 1AXZA 4QKNA 4NIAA 1G9CA 5HCAA 4XMAA 5CKQA 1YQCA 5I8SA 1ND3C 1DYKA 4LULA 3C7EA 1RINA 2WSUA 2PHXA 3H9AA 1XNAA 2DFCA 5E88A 4N8MA 1JYIA 2ZXQA 1QJEA 3PVBB 4GJZA 4PJYA 5EXOA 5CFDA 4BZ4A 3WSOA 4WVMA 1ENQA 1VMJA 4PLMA 4IESA 1S2KA 4YZ4A 5IK4A 3BIEA 3ZKYA 1RMU2 3PDQA 3J7MA 4IGPA 3B93A 4K7JA 4LBLA 4C0BA 2RR13 3ZXLA 4PHZA 1LCLA 4XACA 4A45A 4IV3C 4QU1A 2VZTA 2XJPA 2UYBA 2XBO1 5H9PA 3AZXA 4LQRA 4WM8A 1E57A 3DKWA 2BVBA 4YG6A 3ZN6A 4CU8A 3A4UA 5IVYA 1K42A 4G3YC 3QD6A 2B8MA 2PFWA 3WP6A 4ZPIA 5L36A 4G9SB 4OHWA 4FT8A 1OD5A 4IEQA 4EQVA 4RA0A 1XSQA 2BV4A 3AYAA 5AC91 2IVJA 2VQTA 5T5PA 1W03A 2ZGSA 5T5OA 1N1TA 5DPNA 2WT0A 1NXMA 1WKYA 4Q4Y3 3NMBA 1LOFA 3AMNA 1JU3A 1CX1A 3E1F1 3ON7A 4NR1A 3SCGA 3VD3A 3WY6A 2C26A 4YM3A 4CDUA 4AHZA 1I5PA 5IVCA 2LRPA 1MS1A 1S0FA 2Q4SA 4H55A 3OEAA 3BALA 4PQ9A 2A6YA 5FXXA 4C1WA 4FPLA 5D21A 3KCXA 1WW6A 2R042 1R082 3NAPB 4N53C 5D8AA 4AG4A 4IUGA 3LA7A 3JUUA 1Q8SA 1YQ8A 4CRQA 3BU0A 3MIBA 4WBBA 5ABJC 1HRI1 4OUEA 3VDDB 1VAVA 2HEVF 1RC6A 1UY4A 4CEWB 1TMF1 3OBTA 2DFBA 3WW3A 1MS3A 1YC61 2DYCA 1HXS2 3KV4A 1DGWX 3FWEA 4QGNA 4TZDA 5CBLA 5LZ6A 1A8MA 1N3PA 2Y64A 4FFGA 5B4XA 5BNPB 1DQ5A 1RUE2 1Y9GA 2IFRA 1MS4A 2BERA 2WAAA 5K0UA 3VL8A 1W8ZA 2W39A 1S0BA 5FY9A 3ZOIA 4XFAA 3BUCA 3AKRA 4XTPA 4BHPA 4KGGA 4A2UA 1F35A 1DYOA 4LE3A 3DPRC 1N1VA 4V2WA 4QB1A 2V73A 3GJAA 3N9MA 3V56A 3O12A 2WN3A 2Y0IA 3R6SA 3B69A 4EN7B 4MV2A 5FMBA 5LY1A 4CCLA 2WWJA 2ZKLA 2WAOA 2AZ5A 3SH5A 3U75A 3E5QA 4EN9B 1O3QA 5DZEA 1OURA 4Y5SA 2UYAA 2WN2A 5F3IA 3BVCA 2Y6LA 4NHMA 2GAUA 1H2MA 1RUJ2 1WCDJ 5FPUA 3OPTA 4HK8A 4H3WA 1GWKA 2AYHA 1OFSA 3POWA 2VMFA 1PO23 2UWAA 3OGVA 4UBHA 4Q4W2 4IDZA 4Y22B 3VD4A 2XLAA 2PHLA 1GQGA 1WZXA 1KITA 3O5SA 3RMYA 3VKFC 5I0SA 1UIKA 1CIYA 3AM2A 1NA1A 3B94A 3FZ3A 3IZOA 5A3OA 4HN0A 2XJRA 2A6VA 1UYYA 4GD4A 1WMEA 2JDAA 4A3ZA 5F2WA 3HT2A 2FDIA 3HNBM 1VBD2 3CNAA 3POIA 4JX0A 3CJIB 4XCBA 3R4DB 5A7WB 4KMQA 4RS5B 2W1SA 5DXDA 2IWGB 1W6QA 4DEVA 5FZ6A 2RS32 3W20A 2QQMA 5LA1A 4NIIA 1GP6A 4DRVA 3ZO0B 4FPGA 3LDRA 5J7MA 2K46A 4IL7A 2VVEA 5FZBA 2VOTA 1CD3G 5B4NA 4I09A 4GWIA 4XUNA 4I0WB 1V9U3 3BIWE 4EN8B 4O7XA 1ND2C 2VL4A 1WBLA 3ETQA 4HPKA 4PLNA 1IS4A 3BCWA 4AF9A 4AEJA 4FTSA 2FHRA 4K1ZA 5IYYA 1H8TB 1EPWA 3WINE 3AZVA 1O4YA 3AJYA 3HIFA 2P6HA 5FYYA 4CU7A 4JDMA 4EV0A 5L19A 1OLME 4XC9A 2OQ6A 1SLAA 5CG9A 1NT0A 3NJYA 4NHLA 2CWSA 4QGMA 2R041 1RUC3 4RYDA 1SBDA 4XUOA 5KHHA 2HWE2 4Q0PA 4XCAA 2ZGPA 3BPZA 3QACA 3A0NA 5JVVA 4WVMB 3B7MA 3T3YA 2QDRA 1W05A 4UW4A 3SC7X 1A34A 4RQPA 2RM22 5IK7A 4WV8A 4YM2A 3SEEA 5ANNA 2FZ1A 1DQ6A 1FMD3 3ITQA 2XPJA 3J7HA 1RUE1 4WVZA 1AHSA 3ZN6B 4LO5B 5IT6A 1RUD2 2PHUA 3AB0A 3POGA 5FQ0B 3WLUA 3ZDVA 3CF6E 3ZFFA 5A3UA 1PM4A 1ZZCA 3LOBA 4LKEA 1DQ1A 1JMUB 3MPPG 5C9AA 2V5DA 1CR7A 1AX2A 3BOWA 1OA2A 1S2BA 3NJZA 4AEMA 5K7PA 2ZCWA 3WG1A 4L92A 2ZGQA 1SQ4A 5B2GB 2Y8KA 1OVPA 2JICA 1EAH1 2JIGA 3LWCA 2B5HA 5FPZA 5A3MA 3H7JA 3ZSMA 1O4TA 3O0XA 1FOD1 2XL9A 1XC6A 5FREA 5CVRA 4A7ZA 5JOZA 4IE6A 4CDUB 4R9AA 4XDQA 1ZRCA 4Y4RA 4OI4A 1UL9A 3KSCA 3N3HA 3ROUA 3FBYA 4JGYA 1JZ8A 3D3AA 4Q4W1 5T3NA 5CB7A 4XFHA 2VAUA 4R9CA 5FJHA 3SCFA 1DBNA 4KL1A 3APBA 2OZ6A 3K2OA 5FZ9A 1JYTA 3EHKA 5DG1A 1XE8A 1GKBA 4S2DA 1BBT3 5CFCB 2G9GA 2WUHA 1YI7A 1J58A 1HJFA 3JB8A 3DN7A 5F5CA 5GZFA 3VBUA 3ZIWA 3HVDA 4ZU5A 3ZN4A 4B7EA 1PO13 2BYVE 1QOOA 4YGCA 2HWB2 2A71A 3KCYA 3THDA 4B4PA 3LZZA 4BE3A 4FP2A 4GB32 2QQLA 4OI0A 2BOIA 4C0HA 1H1MA 4DPNA 1SG3A 1LHUA 4Q4X2 3POEA 1QJU2 2BU9A 2XKOA 3WDWA 1WLTA 1V0AA 2D6PA 2W46A 1V6LA 2YB7A 5BNQA 2WBKA 5EZWA 2VC9A 3ZXAC 4OI1A 3MW2A 1O3SA
chains in the Genus database with same CATH topology
3FX3A 3OF1A 2ZHLA 4SBVA 1UZZA 4QQLA 5BXXA 1L3JA 3ZFEC 1G9AA 1RUG3 3OY8A 4HZFA 3VBOB 5DUWA 3UKTA 3WUCA 1WUVA 1SLBA 3J4UH 4QQOA 4RR3A 4JRAA 4K6BA 4PLOA 1J59A 1HV1A 2GC2A 4XMIA 5KC5A 3EJKA 3WOGA 2F6BA 4MGZE 3LB9A 4C90A 3V0BA 2IXLA 4YVWA 1ONAA 4RGAA 2FBEA 2RM21 2DU1A 3GZAA 3IDCB 1KFXL 2WFF3 1EV11 3ZYRA 2WNUA 4XBNA 4HLTA 2MHFA 3AZWA 5HCFA 4PBOA 2XJUA 1W6QB 3H1WA 1OPOA 5JR7B 3U4XA 2D5FA 4X8PA 4DFSA 2CWMA 2Q5TA 2RMU1 5GLVA 4LT5A 1D2QA 3I8TA 1GANA 2CNAA 1SEFA 4AWDA 1HQNA 1RUNA 1W6PA 2CV6A 3FUQA 1XRUA 3MLLA 1HRV3 5BNOB 2ZMLA 3I2DA 2VW0A 3H3ZA 4JGZC 1WMFA 1PHMA 3KB5A 1RUI3 1DHKB 1RJ7A 2C0ZA 2WA4A 3JZVA 2BWCA 1RVF3 1MVEA 4XFIA 3WDUA 3OPZA 4DY3A 5JI9A 1MZ6A 3WDTA 2HWF3 5DZGA 1ZBE1 4CDWC 2JKBA 4DY5A 1BVVA 3EBRA 3LA2A 3THTA 3NV3A 1HLCA 1OLRA 5KBFA 4XIOA 2V09A 4JDOA 3WP3A 1BYHA 4YW4A 2A75A 1BEV3 2A70A 1V6JA 1UKRA 1PMIA 2ZGNA 3LGRA 4I2OA 1QH6A 3ZVXA 4E4SA 3PHMA 4ZU4A 1N3QA 3AXEA 2GN7A 4YZ1A 4NO4A 1XNDA 2XJTA 4FPOB 4ASMB 2HWD3 2DVFA 2TEPA 1HW5A 1OLQA 2R49A 1C8M2 3AP4A 4GH4A 3ZYGA 1KFUL 4AVCA 4DOUA 2XG3A 1QF3A 4HK9A 1WD4A 3ELNA 1GV9A 5T5JA 1XNKA 1SBEA 1SLTA 2SLIA 4YG0A 1WLCA 2WZR2 1AYM1 1ZRFA 2BW8A 1MS9A 3NV1A 1QJY1 1GZCA 3IWZA 2IC1A 1RUH2 2PELA 1XYNA 1WBFA 3WG4A 2R16A 3W59A 1HX6A 2ERFA 2I07B 1MZFA 1OOPB 2VVFA 3PVEA 4IV1C 2ES3A 4LBQD 1C5IA 1XYPA 1YWKA 4XW3A 2WNEA 2JJ6A 3T2TA 2A3YA 1DLLA 2BEOA 3ES4A 3KD4A 4HBNA 1NY72 2NN8A 1G9CA 1O5LA 2VXRA 1LKNA 1OMIA 4ATFA 4XJ8A 3I54A 2WIIB 2VMHA 1QDOA 3SH3A 4AVAA 4AK3A 3ALQA 4BMBA 3IBMA 4GWNA 4WZFA 2Q8OA 3WDYA 4Z92B 4UBGA 1W0OA 4CP2A 1S0GA 3WT3A 3VBRA 3ZFGB 2WA3A 1CGPA 4XFGA 4BIOA 4QPGB 2C5DA 1W0PA 3ATGA 3JCIA 1VBA2 4YVSB 4FXKB 1O4ZA 2Z79A 4I3GA 4OZXA 4XEZA 4IEWA 2H6CA 4FPYA 3K48A 4LO8A 2RS12 4MGKE 1QU0A 3WHUA 1C1FA 1FI2A 1Q8VA 2WS91 1FXZA 5A32B 3TN93 1F2NA 1FPN1 2VUAA 4Y20A 4L8QA 5I93A 1LJ7A 4JGZB 3VKNA 2Z5WA 5C4WA 1QQP3 4JVAA 1TNRA 3QH7A 2RJKA 5F1RA 3CU7A 1GNHA 1JUHA 1Q5OA 4MZUA 3ZX7A 2VW2A 2DWRA 4ITCA 4C1XA 4XJAA 5J96B 2ZOEB 4EJRA 3ZXKA 4YFWA 2OUJA 1PVC3 2ZGKA 4AXOA 1MS8A 1YFYA 2VMIA 2XVGA 1TNFA 2R072 4N43A 5J36A 2RE9A 4NOTA 2HJIA 2NLRA 5AFBA 2HWC3 1I9RA 4HVQA 2QCSB 2WZR1 1RHI3 3NSTA 4YZ3A 5T55A 1AJOA 4KG0A 2ZKNA 1CPNA 1IS6A 3ZIXA 3CLPA 3M8LA 1AR82 1IPJA 1UU6A 2ZX0A 3KCCA 4XXAA 4CEYB 4RHV2 3N4MA 3BU7A 3PVNA 4XZPA 1MVQA 5JZGB 4GWMA 4A7YA 3D4KA 1FT9A 2IFWA 3VZLA 3USUB 1R091 4MXWB 2OA2A 5CNAA 1ZREA 3FC0A 4M3CA 2YROA 1VBC3 1Z78A 1BXHA 5DDJ2 4OFGA 4H7LA 2VNOA 1ASJ1 4WM7C 1NCRA 4CDQC 2R30A 4YGBA 4NVPA 4YFZA 1QXRA 3ZXJA 1CAWA 2RS11 1C8NA 5CAZA 3L2YA 2ZGTA 4IERA 1FATA 4CEWC 1LGCA 1TQ5A 4P5HA 1WLWA 1A78A 1YFWA 3ME2A 4OVEA 5BNNA 2WNVA 5BNPC 3HT1A 1HDKA 1APNA 2EVXA 2ZZJA 3D0SA 2MNGA 1S0DA 4AEDA 5T5LA 4IEXA 4Y1ZA 5AFEA 4AI0A 1JH5A 2TNFA 3MIDA 4AFBA 1OI6A 4COWA 2DTWA 5C8CA 1ZM1A 4OHXA 2OZJA 4EWDA 2BQPA 1LR5A 4N9IA 4YLZA 2WC2A 2RR12 4LBJA 1X8EA 2P17A 3IIAA 1JXNA 1JW6A 1VBE1 3U10A 1WA4A 1QXJA 2KA3A 2QFEA 4CDXA 2DCZA 4JAAA 4URTA 1POV0 5GZCA 4XPVA 1VBB1 1XNCA 1H2KA 2H0BA 1A6CA 4Q0QA 1QGLA 4FOYA 3VBFA 5I8YA 4LHLA 3WDXA 1YIPA 2JG8A 3J8F1 4R8HA 2XWJB 3EQEA 3C2UA 2H6BA 2CTVA 3JQXA 4B3NA 4Q1RA 4AFDA 2Q1ZB 4P9LA 3DF0A 2PLV1 1AR63 1PK6B 4Q4Y2 4XJUA 1EY2A 2P3JA 3B3QE 3WUDA 5T54A 1PZ9A 2BNOA 1ND3A 2DUOA 5CU1A 2A7AA 2D93A 2GMPA 3CJIC 4EN0A 1ZBA3 1SLCA 3ZSEA 2UURA 2JX9A 1COV1 5FLIA 1CAUB 3MIEA 3SNMA 3V65A 1ULEA 2PTMA 2QDNA 4BOWA 4RHV1 1W6MB 5T52A 1QHDA 4JDNA 4Z82A 1R1A1 4FVVA 2F4PA 3V64A 1MR5A 4F8AA 1H8TC 1WCSA 4YRDA 3H50A 3WW4A 3V0AA 1PIV3 3OD0A 2PAEA 1U5IA 2YMZA 1RJ8A 4B4QA 1CAVB 3VBHB 1TMF3 4PCRA 5CFDC 4N43B 4W6WA 4PDWA 3FLRA 1AZDA 4N53A 1QKQA 1AR93 1EPZA 2YC0A 3R0RA 1PO22 4GALA 4RL7A 1VLNA 1H1IA 1QDCA 1ZZ9A 2NM1A 4AVSA 5ABJA 5J48A 3I4IA 4DXZA 3JU9A 2VOWA 1FNYA 4E4ZA 3OCPA 3GBFA 2QZ3A 3WG2A 1H2LA 3R4SA 4WM7B 3WQ7A 4CDQB 4B4RA 4Y4YA 1DFQA 5I0TA 5HI0A 3AK0A 3FFQA 3KLSA 2IXCA 4XBQA 3H1YA 1VRH1 5L7OA 5A33B 5JIUA 1GZWB 1GFF2 3DPRA 2ENRA 1YO8A 2VG9A 1PGL1 1LOFC 2ZGLA 1TME3 2DVGA 2X5IB 1UMZA 1PZ8A 1Q8OA 3GHNA 4HKOA 4CDUC 1DQ0A 1T6GC 1WGPA 4ONUA 1QJX3 4Q0SA 2TBVA 4M3CF 1V9U2 2JE7A 5FLHA 3ZSKA 2ILMA 3NW4A 3RQ0A 3B5LB 4PF5A 3AP7A 5CFCC 2E9QA 3A0KA 4OHYA 1KDMA 2BBVA 5CIRA 1W39A 4Q0UA 1N1YA 1D4M1 3B9CA 1Z7S3 4YW1A 3SCHA 1HKDA 1JOJA 4JQRA 1UPIA 5A3LA 2UWBA 4BQ1A 5I0RA 3ACLA 1RUC2 2XJSA 4KNCA 2P3IA 2CGNA 5K0UC 5GLWA 4S2FA 1F8VA 3PNAA 4TSVA 4YW2A 1W6NB 5KXCA 1PGSA 3BOPA 2LTNA 3C3VA 1RMU1 1GYKA 4GKXA 2W52A 4NHKA 4P14A 5KHGA 1I3HA 3D6EA 3VBSA 1LHOA 2VECA 1PVXA 1CJDA 5KHIA 4O9GA 2D7FA 5GZGA 3JD73 1FMD2 1LU1A 4OUMA 3ZXGA 5ACA3 2BNNA 2K2SA 2OW4A 4XXPA 2NZ9A 3MIGA 1ND2A 4HMZA 2XHKA 4L2NA 3EXUA 4F7ZA 2GNBA 1GNZA 3M7AA 2IZWA 4AFAA 1S0JA 3AKQA 3VBOC 4A3XA 3I7DA 1UKGA 4EROA 4X8NA 3AXDA 2GN3A 4AYUA 2EF6A 5F5QA 3PLQA 4QPYA 2WQZC 2CL2A 2WFPA 1LENA 5FO7B 5BYNA 4UXAA 1HQWA 2AR6A 2EAAA 3TAYA 1PO21 5C6CA 1A3KA 4FAHA 1LEMA 4AEKA 1R081 4CP0A 2CGOA 5IK5A 1MQTA 2O1QA 2EALA 5CFDB 2GU9A 4QD2A 5D1IA 1BBT2 1FYUA 1YNAA 4Q26A 1EAH3 1CONA 1M4WA 4BA6A 3CJXA 2XJQA 5BNOC 3PMSA 1FOD3 1HXS1 4HSLA 1FNZA 1PO12 4FPFA 4K1YA 3TOJA 4MGIE 4WM8B 4YW3A 2ZAAA 4B8EA 5KC6A 4FOQA 2P2KA 4K8FA 4JV4A 2D43A 2DVDA 1JUIA 2YYOA 3GBWA 1CAXA 4XJZA 3AKSA 1WW4A 2DCKA 5J98B 1IQAA 2ZJCA 1F9KA 4KWJA 3UL2A 1YYNA 3WNXA 3UKNA 1GZ9A 4GULA 4Y1VA 2YHJA 2QVSB 1LGBA 4I3PA 1IHMA 1RUJ1 1Y43B 5FBZA 4G4FA 2VW1A 2GC0A 3OJBA 1DDLA 1RUG2 2AREA 2RS53 2NMNA 1B35A 3VHRA 2TUNA 3H3UA 4LUKA 1SFYA 1YFUA 3TNPB 5D8AB 2ZS6B 3RYPA 3S6PA 3ZFFC 1KS5A 4I02A 1VJ2A 3TB0A 5JMCA 4AGRA 3GNEA 2DUQA 2XLFA 1FAYA 3WD5A 1VBD1 1NYWA 3E5XA 2WFF2 3RNSA 5L7OB 1GLHA 4Y5Z0 2ET1A 5E1RA 3DGTA 1XYOA 3E5UA 2PYTA 2RS31 4L9BA 2XVLA 5K0UB 3JBG3 2FQPA 1ZRDA 3MEPA 1XU1A 3AJZA 2XKPA 1LRHA 2DUPA 1AX0A 1HRV2 1RB8G 4AE2A 1W6OA 2EXHA 4KQ7A 1H9WA 4Q1PA 2P37A 2BUKA 5JSRA 1RUI2 1EV13 2R063 3J26N 1OOPC 1OPMA 1H0BA 5JCTA 1DGWA 1KJLA 3AFKA 3O0VA 1RVF2 5L73A 1AL23 5GM0A 2RMU3 4FO9A 1WW5A 4HVRA 3S30A 4RSUA 1O91A 2HWF2 2QKDA 4R9DA 4D7TA 4ZU7A 1IGOA 1FV2A 3J9SA 3M2MA 4BH9A 5EYYA 2HWE1 1U12A 3GBGA 4XHXA 1BEV2 1NA1B 1NZCA 3L9JT 4QQPA 4NN0A 1BBT1 3ZFGC 2N7GA 3R05A 2NPIA 2LM3A 4QPGC 4YVSC 5GKAC 5KHJA 3KMHA 3VUOA 1I1EA 1ZBE3 4C91A 2HWD2 3IM0A 2R0FA 4FOVA 4IXLA 1RUD1 1NCQA 4HFSA 2A6XA 1CPMA 1Y9QA 3U07A 3AMPA 3I59A 5AVPA 3D5OA 3WXPA 4HPKB 1REDA 1QOSA 2AGSA 4D7YA 2CAVA 2YGLA 4H7MA 1UAIA 1W2UA 1YI9A 2MEV3 4P9XA 1MEC3 4J6GA 1LULA 1RUF3 1RUG1 3HAGA 4META 1DQ4A 2Y26A 1C57A 3AYEA 5I0UA 1VB4A 1V6NA 2XVKA 4QPIA 1Q56A 3MW4A 1ZZ6A 1BQPA 4YM1A 1Q8QA 1KD7A 4E4DX 2EXKA 2EXIA 2UWCA 2G9FA 1UF2C 1VR3A 3VHOA 1LGNA 5AVAA 4RQPB 4LBOA 1I6XA 2WFF1 3AYCA 2ZMNA 1AYM3 2HEYF 4LBQA 1YUDA 3AX4A 2ZGOA 3TYJA 1QJY3 2HWB1 1DYPA 2FMDA 3MLJA 5J09A 4GB31 2WQ4A 2AUYA 3MLKA 4Q29A 5TSWA 1SCRA 3ZFFB 5E16A 5JIAA 1LOEA 2DURA 4Q4X1 1D2SA 4B7KA 1QJU1 2GNDA 4E27A 5C9AB 4I01A 1IS5A 4LBNA 5GALA 1C3HA 1ZVFA 4D94A 1AYN3 1Q8PA 5JSPA 1RUI1 3VZKA 1BMV2 3AKTA 3U11A 4CEYC 4BIFA 4YGEA 2JECA 1QNWA 1S0CA 2ZAHA 3AP6A 1K5MA 3AYDA 5JZGC 3TN92 5T50A 2I45A 2JE9A 3UKVA 4JGYB 1B35B 4IV1A 1D0GA 5GJ6A 4K20A 2O0OA 2EAKA 4QGLA 3QBQA 2AH2A 4UW6A 2NYYA 1QQP2 1YFXA 4GXLA 4J1XA 1VAMA 4I0AA 1JYCA 4F3JA 1S0IA 4BCUA 1Y7BA 2OIIA 3H7YA 1LOAA 3VBUB 2WS93 1Z0HA 3SLIA 5FPXA 1Q43A 2GNTA 4EWAA 1FPN3 2KM2A 3SMHA 4LLFA 2VNGA 3O7OA 4LHNA 1QXPA 4AQ6A 4CZSA 5E8AA 1B09A 2W0XA 4M0HA 1X8MA 2BFUS 4I0BA 2JDZA 3JQWA 3ZXEA 1UD1A 4AHYA 4XQDA 4COVA 5F6LB 4F83A 1PVC2 4W6XA 1PGW2 5LEKA 2BFUL 2D3RA 2RHPA 2VOVA 3ZYPA 1RTVA 2HWC2 4PIXA 1J1LA 2BPA2 3WCSA 2CAUA 1MZEA 3FJSA 4NPRA 2ZZQA 1RHI2 5FOBB 5C33A 3G6JB 4LE4A 1LECA 3AP5A 1ENRA 3OY8B 3RS6A 3HR9A 3IDEA 5LRSA 3RSJA 2D3SA 4KWKA 3NO8A 4TYSA 2X29A 3M4FA 4U36A 4RR3B 1ULGA 2E53A 4XILA 4AI8A 3NL1A 2E6VA 1XQNA 2ZX1A 1LHNA 2VPVA 4AHWA 2EXJA 3IPVA 5JSOA 1ZA4A 2DCYA 3ECQA 3V0BB 1Q3EA 4YVWB 3LA3A 3M3CA 3OYWA 2O8QA 4K21A 3BB6A 4LBKA 3NKGA 3LCPA 1UU4A 1PK6C 3VL9A 3O0WA 2WNUB 4CYDA 1F5JA 3BTAA 4P9IA 2JENA 2SBAA 4V1PA 3T1LA 3WR0A 5BUVA 3NVCA 1SCSA 4P9GA 1VBC2 3HQXA 1G9DA 4JTOA 2FZ2A 1C8M1 1W6PB 4XF4A 2DV9A 1KS4A 1SACA 1QY4A 2BNMA 1CQ9A 1DGRN 3QLQA 5I8TA 2A6ZA 1J1TA 1BMV1 3JB4C 5JLVA 4ISRA 2A3XA 2XWBB 3USSA 4IEOA 1R093 1IKQA 1LEDA 4FOWA 3DV8A 1RUH1 1VALA 1C5HA 2WT2A 2JD4A 1G86A 4IETA 1AR73 1ASJ3 4QPIB 2WWSA 4A7KA 4AGVA 2YY1A 1QQP1 3CO2A 3VBHC 4Q0VA 1BCXA 1DG6A 5BPXA 4YZ2A 1H9PA 3ILNA 3POYA 4WZCA 4Q4V2 4N43C 1NY71 1ZYBA 2R1DA 4RGGA 2PHTA 1WD3A 2OYZA 2ZGUA 3NAPA 4P9YA 3N7KA 3E6CC 1M06G 3OD4A 4IEYA 5GLUA 4D69A 1QWRA 4S2HA 5EV7A 1O3RA 2ZX2A 1DZQA 3VDDA 4DB5A 4GH4B 3N7LA 1VBA1 1PVC1 2JG9A 2RJLA 1PGW1 3BODA 2WLPA 4FQZA 4QQ2A 1AR62 4HVOA 5J37A 3P3NA 1ENXA 1VBE3 2WLQA 2VQ0A 2Y0OA 4L99A 3AP9A 4R4ZA 3MF9A 3B02A 4XTMA 1LHVA 1VBB3 1ZBA2 1K5MB 4KBBA 4Z2WA 1G8WA 2ZGMA 5EJ3A 4AQTA 4Q8LA 2CYFA 4FXGB 3WP4A 2EA7A 2X5IC 2ZTNA 3B00A 3J8F3 1V6MA 4GMP3 1REEA 1ULFA 3MI8A 4LA3A 3MYXA 3IDBB 4KU8A 4QQHA 1H8VA 2PLV3 5EYXA 1ENSA 1UN1A 3CEWA 3QOPA 4LLOA 1U0AA 2Z69A 3D82A 3ZYJB 1KJRA 2B39A 1D4VB 4BYYA 4TWTA 4Y22A 2UU8A 1CN1A 1COV3 1POV1 1J3RA 1PIV2 2O8OA 4HL0A 3E97A 4LO6B 2BVVA 4XQ4A 3VHNA 3VBRB 3AZYA 4MGYE 3GALA 4J1WA 5FCCA 1LTEA 5KXEA 3W58A 3IKWA 1TMF2 3CJIA 3HBZA 2R071 4AEDC 4BMEA 4RS5A 4FSJA 3KT1A 4DRRA 5BV6A 5JDBA 1HQLA 2XBO3 2W08A 5IUQA 1R1A3 3ZSJA 2NQYA 1O7FA 1AR92 1UU5A 5E89A 3RZZA 2WJSA 3HN1A 3M3IA 2PQQA 1XE7A 5AC93 2I2SA 3T1MA 2VY0A 1GICA 4Y20B 4D3WA 5FAXA 4IV3A 4AI3A 1AR81 2ZX4A 1ZZ7A 1H8TA 3LSEA 4KH9A 4MLOA 1SDWA 3ILRA 5C4WB 5K9YA 1RUOA 1AXKA 1NG0A 3RMXA 4Q4V1 1BVP1 4FTBA 1TME2 1JTZX 1Y3TA 3IN9A 1NQDA 3MGUA 2B9UA 3S0MA 4DINB 4R52A 4FPHA 4XFBA 1OHFA 3HMYA 1QJX2 4QT6A 5DDJ1 4P9JA 3IT8A 1HRI3 1KXGA 4FPJA 2Q0AA 3HWJA 4FPEA 3KT4A 5JOWA 3UK9A 1AR61 3NV2A 4BPZA 1VRH3 2B7YA 2P3KA 3W9AA 5FQ0A 1Z7S2 4UW5A 4O9EA 1ZBA1 4XQWA 2YPJA 4CP1A 3WVJA 4X6RB 1SLIA 4WM8C 2JXAA 2HYKA 4M3CE 2PN5A 1CVNA 5C8WA 5I91A 1JBCA 2DTYA 2GSYA 4HKLA 4ES9A 2RR11 3MIHA 3PVOA 3X29B 1D4M3 2E63A 3ILFA 3JD72 5J3UA 5ACA2 4E9KA 1UW8A 4PDWC 2D3PA 5HBAA 2GH8A 5JOXA 1U5ZA 1IS3A 1PIV1 2PHDA 3VKOA 2IXJA 3N35A 1IKPA 2E51A 4M3CB 4FP3A 4LR4A 1X82A 5LK5A 5CFCA 5SV8A 2D44A 1RMU3 1PZ7A 3WW1A 2JG9B 5D8AC 1LESA 1NCRB 1YLLA 4JCKA 4Q4Y1 4WVWA 1ZX5A 2A6WA 1CAWB 3ZMOA 4L97A 4INDA 1AR91 1PNGA 4CTEA 3OGJA 2UY9A 3FE5A 4LTAA 2XH6A 2B46X 2QJVA 5L7OC 5BNNB 1V70A 3MPBA 2WNVB 3G7DA 2WINB 2Y38A 4HN1A 4Y1XA 1NQJA 1SMVA 1V6KA 3B01A 4AEDB 3ZPYA 1QJZA 4K9SA 5FO9B 2YUEA 4N7IA 5CADA 1QOTA 5GLZA 1TEIA 1EAH2 3SXWA 5C8CB 3LAGA 5DZFA 4Q8KA 2WKKA 5JWPA 4Q2FA 3FHIB 1FOD2 1OFNA 3WCRA 1RGSA 4DS0A 3GZUC 1V00A 1ZZ8A 2ZMKA 3N7MA 3VBOA 4ZXKA 4AFMA 1TME1 2FMYA 2VU9A 3Q9OA 2B42B 2XJVA 4QU2A 4CDXB 2R043 1R083 3KGZA 1H1AA 1VB2A 1NE6A 4XE9A 4L11A 4COZA 1QJX1 3VBFB 4KGQA 2JG8B 3H0OA 1QMJA 1OQDA 2YV8A 2ZA9A 1DU3D 3GHMA 4JC1A 1HXS3 4Y26A 4DMIA 1DGLA 1NA1C 4AI2A 1PNFA 3L2HA 2OUHA 4K40A 1ND3B 1RUE3 3ZDSA 4HETA 3WP5A 3FBMA 2BTVC 1Z7S1 4MX3A 2D40A 2RS52 3VBSC 2P34A 4FPKA 4OHVA 5FOJB 3VZMA 1XNBA 1CIWA 5JPNB 5CG8A 5BNOA 3MFCA 3R4UA 2IXHA 2I74A 3ZYIB 4IV3B 1MZ5A 1AX1A 4GQ7A 2NP0A 2WSVA 4N90A 3VGIA 2IXIA 1J3QA 1DQ2A 1LHWA 1RUJ3 3KM5A 4YSFA 1V6IA 3JD71 4U2AA 2YDEA 5ACA1 5DUXA 2ZBJA 3K51A 2DVAA 4Q4W3 3JBG2 2NMOA 2QNKA 3V0AB 2WL1A 3FUOA 3AKPA 1AL0G 4R9BA 3U0ZA 3ZSLA 3MF6A 3LKJA 5FFOC 1V9U1 4AVTA 3WW2A 1MQTC 1VBD3 2R062 1EV12 3VKLA 3M1HA 2HEWF 4PDWB 4IQPA 2OPKA 2R6QA 2X8KA 4N9HA 2RS33 1AL22 4N53B 5KXBA 2RMU2 4RQPC 2A5ZA 2ET7A 1REFA 3ZMNA 5JPMB 5ABJB 1RUC1 3B9IA 3THPA 1JHNA 1NLRA 1EYBA 1YRZA 4IEVA 4M0NA 5C9AC 1RIRA 1LOGA 4ATEA 4FQ4A 3VLBB 1N47A 1ZNPA 5KWRA 2DF7A 5FO8B 1FMD1 1F5FA 3DPRB 2LUWA 1ZBE2 1NOVA 4LA2A 4MH0E 4KG8A 3VV1A 2QUOA 2PAMA 4D7SA 4YARA 1ULDA 2ZHKA 4SLIA 4Y24A 4ES8A 2HWE3 2R1BA 1XXNA 1OOPA 4ASLA 1YJKA 1NE4A 4JGYC 1B35C 3WZ1A 2HKXA 2VGDA 3SHRA 3ZFEA 4DQAA 2GMEA 3MDPA 4MYEA 2E7QA 2ZHNA 2RM23 3AMHA 4Y1UA 1SLLA 2VMGA 1G7YA 4KWLA 1YXWA 2KXLA 2DU0A 4HANA 4M01A 2MEV2 2W68A 1AF9A 1HV0A 1MEC2 1N1SA 1QNYA 3KS7A 1RUF2 4OLLA 2VNRA 2RS51 3VBUC 1H30A 1RUD3 2Z42A 3M3EA 2CGPA 4HKWA 4XJ9A 3ST7A 3ZFGA 4GA9A 1DZRA 1V6OA 2D98A 1G9BA 2B45X 4QPGA 4YVSA 3WQ0A 4MVTA 3MZHA 4Q27A 4E2GA 4AW7A 2ZPXA 1BJQA 1KDKA 1OSGA 4Z1VA 3D8CA 3PJQA 1LB2A 2PAKA 3VBSB 2C1FA 4WVVA 1AYM2 3PTYA 4LNVA 5A32A 1PO11 3GF6A 4RFT0 1QJY2 1S55A 4HT1T 4LO7A 4X6QB 4ORFA 3SISA 3JBG1 3RG0A 3PMEA 1ND2B 2VVDA 4HSJA 3NKTA 4JGZA 3TBDA 2EIGA 3S7EA 1JN2P 3WQ1A 4AQSA 4FTEA 4XF0A 3H8UA 3OBRA 3UV9A 2QQPA 4RR3C 5LK7B 5H9RA 2ATFA 5FRAA 1AYN2 4CDWA 3LOIA 2PA7A 2R061 2GMMA 1X50A 3KT7A 2GDFA 5KXDA 2HWB3 1AL21 3O14A 4JTNA 2OVUA 4NWWA 4QX5A 4YVWC 4GB33 1ZRCA 4XHBA 1BZWA 1LODA 1LU2A 1AUYA 3RDIA 1DIWA 2WNUC 4Q4X3 5LEJA 4FPCA 1AVBA 1QJU3 4EWEA 2D5HA 3POSA 5DUUA 1MQTB 2Q30A 4AQ2A 4PBPA 1GSLA 1NCQC 3GZTB 3TNQA 1IPKA 3FLTA 2V5YA 2R0HA 1R1ZA 2A3WA 1BKZA 4Z8BA 2ZX3A 4YW5A 4YYOA 2WS92 3PJYA 5IK8A 1GBGA 1WMDA 2E7TA 4XFFA 4AVBA 1FPN2 2YZ4A 3QH6A 2R32A 1AJKA 1CESA 3OGGA 2PHFA 4OUSA 2XGXA 2ZACA 1O5UA 4P9WA 2VOXA 1FV3A 3OTFA 1CAXB 4XBLA 4CEYA 4XETA 1AXYA 1H2NA 1HRV1 3TRSB 2QZ2A 1ZRRA 1F31A 4KU7A 5JZGA 4QPIC 3WX5A 2VUJA 1DF0A 1OKQA 4PIZA 2MEV1 3USUA 1MEC1 1RVF1 1RUF1 4LEJA 4MXWA 2GC3A 2GC1A 2HWF1 1YHFA 3VKMA 2Q1MA 2D97A