2AZ5A

Crystal structure of tnf-alpha with a small molecule inhibitor
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
148
structure length
132
Chain Sequence
DKPVAHVVANPQAEGQLQWLNLLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Small-molecule inhibition of TNF-alpha.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine
molecule keywords Tumor necrosis factor (TNF-alpha) (Tumor necrosis factor lig
total genus 22
structure length 132
sequence length 148
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00229 TNF TNF(Tumour Necrosis Factor) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.40 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2az5A00
1PK6C 1RJ7A 3TWIA 4DB5A 2WNVB 2WNVA 2ZJCA 3TYJA 3V56A 4MXWB 4GIQA 2KA3A 1C3HA 1OQDA 5L36A 2R30A 2Z5WA 1C28A 5TSWA 3LKJA 4G4FA 4N90A 1U5ZA 2R32A 4QQOA 4TWTA 4G3YC 2HEWF 4KGGA 4QQPA 3WD5A 1D0GA 2Q1MA 4NN0A 1RJ8A 1DG6A 5KC5A 2QDNA 3AB0A 4EN0A 3K51A 1KD7A 1GR3A 3L9JT 4E4SA 1DU3D 4MXVA 3K48A 3B9IA 4OUMA 2TUNA 4QQHA 2WNVC 3QBQA 2ZPXA 4QQLA 1PK6A 2RJLA 1OSGA 2AZ5A 3ALQA 2RE9A 3ME2A 1A8MA 1TNFA 4F3JA 3URFA 3IT8A 4QQ2A 2Q8OA 4OUSA 2TNFA 2JG8C 5KC6A 1D4VB 1ALYA 5L19A 4MXWA 1XU2A 4D7YA 5HBAA 4KGQA 2OIIA 2X29A 2HEVF 3MI8A 4OULA 2JG9B 5KWRA 2QE3A 3QD6A 1JH5A 1O91A 2WNUA 4KG8A 1S55A 2HEYF 1U5XA 2R6QA 2JG8A 1I9RA 2JG9C 2JG9A 1JTZX 4E4DX 5BNQA 1PK6B 2O0OA 5CIRA 3B94A 2E7AA 2RJKA 2JG8B 2WNUC 4TSVA 1WCKA 4HT1T 4RSUA 4QPYA 4J6GA 1XU1A 4MSVA 4DOUA 3B93A 1IQAA 1D2QA 2WNUB 1TNRA 1U5YA 3FC0A 1OQEA 1KXGA
chains in the Genus database with same CATH superfamily
5C8WA 3OSDA 4Y1UA 3WV6A 1COV1 1JZ4A 5J1XA 2BOJA 1GQPA 1QJEA 3MIEA 1UZZA 3OD4A 3ZR6A 5FKBA 5DMYA 2WZR3 2I2SA 2EALA 3VBUC 4CDXC 3V56A 1EAH1 2VQUA 4QWNA 1H6XA 3UETA 2YY1A 1FMD3 1V00A 1XE8A 2ZTNA 2WFF3 2ZABA 3IAPA 1QIQA 2W39A 4K8RB 1LESA 3VZKA 4K3UA 4CDWA 3RQ0A 3VGIA 4HANA 1GKBA 1TQ5A 1UX7A 1OPOA 2Q8DA 2GZWA 3ZSJA 4JTOA 4R52A 4EN0A 2VNGA 2ZACA 1W6OB 2XWBB 1C5IA 1ZBE1 1JMUB 4LKDA 4P5HA 4CP9B 3TEXA 3NAPC 2XMLA 5DUXA 3H7YA 4KWJA 4AE2A 1BBT3 5E88A 1ASJ3 2FDJA 5FMOS 1OA4A 2X5IC 1W6PB 4YRDA 1JUHA 2XB6C 3QCWA 1CAUA 3PU3A 4EWEA 1OF4A 3ZPOA 1AL23 1HB2A 3I3EA 3OY8B 1AYN1 1V9U3 2BYVE 1WUVA 2DV9A 4KU8A 1K12A 3LEKA 4FAGA 1B09A 2R043 4AHZA 4OQ8A 5FLHA 4CU7A 1HQNA 1W8OA 3OTFA 2ZGLA 2XJPA 4WM7A 2QQOA 3VBUB 2VZTA 4L0PA 2OX0A 1R083 3QBQA 1VMHA 4K8FA 4CEWC 5BPXA 2X10A 4V2WA 1SFYA 3I2DA 2H0BA 2ZAAA 4IEPA 5I0SA 1OSGA 2RR13 3HBKA 1NKGA 4K20A 4KWKA 2ARCA 4P5YA 2JWPA 1FXZA 2C0ZA 1AJKA 2A6YA 4GXLA 2BTVC 2WSUA 3PUIA 4FPCA 5GALA 5ISLA 3WDYA 3VBSA 4DPNA 5LW9A 3VDDA 2CV6A 2XDVA 4K40A 2IFRA 5LK5A 2JDZA 3ZYPA 1ALYA 1W03A 2J42A 3B5LB 2G9FA 2AEYA 3KCXA 5IHRA 3PUAA 3WOGA 1RVF1 1W6QA 2A3WA 3GGLA 3I4IA 4NMIA 3UYJA 1DQ6A 1VBC3 1VALA 3CJIC 3E5XA 1AR91 5A7WA 3ZDVA 4D7YA 1QJY3 4IGPA 4JKLA 4EWDA 3WW3A 3MI8A 4I02A 3LOBA 3VKOA 4P02B 3SMHA 1A34A 1UY4A 1O91A 3VBHC 2W0XA 2WNUA 3IBMA 1E5IA 2A71A 3CNAA 5EFUA 3TBDA 4HKLA 3AKRA 4Q0PA 1Q8OA 4DRRA 1QJU2 4B4QA 3U37A 3MIDA 1RHI1 5L9VA 2JG8A 2WINB 3B7MA 1J58A 3Q9OA 2VMCA 4BLIA 1RMU1 3NV3A 3HVDA 3ASIA 4FAHA 4J1XA 4AI2A 1PGW2 2BWAA 1D4M2 3BGAA 5ACA2 5LBFA 4NVPA 5FPBA 4GALA 1XSRA 1YQ6A 4A7ZA 2XUMA 4XUOA 2JG8B 1YXWA 4R8HA 1MQTA 1ZX5A 2FMDA 3CMGA 1JS9A 3DF0A 1WBLA 3HN1A 4DOUA 5JUVA 1I1EA 3OCPA 2WNUB 3WX5A 2WS91 1EUTA 1POV0 2QQNA 4RGKA 4YM1A 4HK9A 2BV4A 4QPIC 3WQ0A 3JBG3 1PNFA 5D8AC 2JXAA 4YARA 5JSOA 2VH9A 2WZEA 3HNMA 1CR7A 1EV11 1VR3A 1IPKA 4Z2WA 5KR7A 5LA2A 2BNMA 2MPFA 4A3XA 4QKBA 2D6OX 2LM3A 2RR12 2R073 4UFHA 3WSOA 3H8OA 2YU1A 2Z5WA 4BB3A 2ILMA 2OT7A 3GZAA 3FHQA 5JZGC 3N9OA 4XIKA 1PX4A 1H8TB 2JDMA 5EHDA 4H55A 2UYBA 4LBLA 4LOTA 1SBEA 2DUOA 3RG0A 4NOTA 2WQZC 1HDKA 2MEV3 2VBPA 3LZZA 3ZKYA 1BBT1 1RUH2 2I74A 1RXFA 4BXFA 2WN2A 2VD7A 4URTA 1TVGA 4QQPA 2WWSA 4M00A 5JI7A 5IJRA 3A7QA 2B4KA 4COVA 1AYM2 3BN6A 1ND2A 3ES4A 2R0HA 4NJ4A 1RUH1 4LBNA 3DPRC 4YM0A 4XIOA 4AAPA 2KXLA 4JRLA 1X8EA 3K51A 5EJ1B 2UWCA 2ZAHA 4EE2A 2UY9A 5A1LA 2OQ6A 2WWJA 5CAZA 1EAH3 2VVFA 2OS2A 4GWJA 4QGNA 5L9BA 5A33B 1BJQA 4ASMB 2P1BA 5A6YA 3PHMA 3I2IA 3K75B 4BQWA 2WA4A 1PK6A 3IMMA 4M01A 4ET7A 2OYZA 1Y9GA 1R093 5AC93 3WG4A 2E7QA 2J1RA 4TN7A 5FPZA 5IFTA 1C5HA 3E6DA 2JDKA 3ME2A 5JI9A 3AMQA 1N1SA 3OEAA 2ZX1A 2DUPA 4Q8KA 3ZSEA 4NHLA 3K2OA 3UJOA 1HX6A 4LE4A 1CD3G 3H50A 2JD9A 2HYXA 2TNFA 5GLTA 3NV2A 3PIJA 4ORFA 5F3IA 5BNOA 1JOJA 1F8VA 1WMFA 2ZKNA 2GALA 4NR1A 3S30A 5CFCC 5IVJA 1MS9A 4XILA 5A33A 2HEVF 4XQWA 4LHLA 2D6KA 4IV3B 2WN3A 4C1XA 2F6BA 5A3UA 2FDGA 3MIBA 5CG8A 2ZHKA 4CXXA 3ZXGA 3M3IA 5ABJA 1YI7A 4CPBD 5BYNA 2XJUA 2HLEA 1CONA 3ZXJA 4D69A 5IVBA 1XNCA 4DIQA 1Y4WA 1PO12 5FPUA 4MYEA 3ZN4A 4DXSA 1Y9MA 3AKQA 3J7LA 3K3NA 4WM8C 2QNKA 4Y4RA 1X7NA 2VUCA 4AFAA 1XQNA 4MADA 3TEZA 1S0BA 2XJVA 2JE9A 1AR82 1GLHA 1AYM1 1ND3B 3D82A 3POBA 4O61A 3FHIB 1EPZA 3O7OA 1US3A 1WW5A 1XU1A 4HETA 2DU0A 3AP5A 1QH7A 4YM2A 1B35A 5K4LA 5FP7A 3D0JA 4ZXKA 2HH9A 1OLQA 3OGVA 1CJDA 2ZGKA 5FREA 1GQGA 2BNOA 4RHV2 2GNDA 1DQ5A 4AK3A 4LK6A 1RJ7A 5AC92 4OMDA 2XXZA 4BMBA 2WS93 1VBE2 3J9SA 3SXWA 4Y24A 5FZHA 3TYJA 5FDBA 4EJRA 1TE1B 1S2BA 1VAMA 3I97A 4AHXA 1T6BX 5FZFA 3U1XA 4XFHA 2EXIA 1W8ZA 3JCIA 4NHXA 5BNPC 2P3KA 3ZXAC 5JWPA 2WZR2 4Q0QA 2FCTA 2XLFA 1UPIA 3VD7A 1LCLA 2O1QA 2PHTA 4HN0A 5FWJA 3NNLA 3AYDA 5D8AA 3BTZA 2ADDA 1HV0A 5A6QA 1WW4A 4LLFA 4QMAA 3WD5A 1LHWA 4YZ2A 4UW3A 1D0GA 3JD71 4BQ2A 2ZOEB 2VW2A 5JMCA 3AXEA 2Z79A 3IPVB 5GLWA 1IOAA 2WC2A 1YQ5A 2WWUA 5LBCA 4NAMA 3BOWA 1WMEA 3ZMOA 2AGSA 5DXDA 4ASLA 1YC61 2EIEA 2GN7A 3DEMA 4E4SA 4HKWA 1UY0A 2E63A 2WFPA 1K5MB 4QKDA 1LECA 4E2SA 1UKGA 2VCMA 4OUMA 1FV3A 1QHDA 3B01A 1BK1A 5F5QA 1QJX1 1NXMA 1RUG3 3AFGA 3GHNA 4M4PA 1W3XA 2QZ3A 4W6WA 5FUNA 4I2OA 3WHUA 5FMDA 4CU6A 1C8M1 4CCKA 4YVSA 2G1MA 3RZLA 3POJA 3FBMA 4JGYC 2IXCA 1JOBA 2F17A 2H6CA 3H1MA 5BXXA 2PELA 3PMEA 5C9AA 2PQQA 5KXCA 5HV0A 3OGGA 4FTBA 3OBZA 3LEMA 4L97A 4XXAA 1W06A 1D4VB 4Z07A 1RUH3 1DZQA 2Y8KA 4CXYA 1XNBA 5FYHA 1JYCA 1J3QA 4IERA 5T52A 1W6NA 3H8RA 3I8TA 2VPVA 4Q1RA 4WM7B 5FOBB 4BWOA 5IK8A 4QGLA 1HRI2 2P5BA 5A3NA 5BNNA 3RZHA 2BGCA 3I59A 2XVGA 1ACCA 4CSWA 3VHOA 4OFGA 2HWC3 3TEWA 3E1F1 5J98B 4MGKE 1GICA 5ABJC 5JMOA 1N3OA 1NA1A 4LULA 4LUMA 3NV1A 2WT1A 2RM23 3VZNA 5C3OA 1I9RA 1YYNA 2XG3A 4HSJA 1YNAA 1LGCA 1ZBA2 1H6YA 2JB8A 2CHHA 1MS0A 1UOFA 1MZFA 3DXTA 4TYSA 4UW5A 1H1IA 2YHJA 1BEV3 3ZYFA 5BNQA 4FOQA 3VD9A 4LBOA 4I30A 5CIRA 5E1RA 3V65A 3HT2A 2HKXA 4XCBA 3WY6A 3ACLA 5FBJA 4DXZA 1UXZA 3WQ1A 1SLCA 3ZSKA 1DHKB 1WCKA 1LEMA 4XBNA 5KHGA 3W58A 1C8M3 4J6GA 1PZ7A 1US2A 4Q4V1 4XAEA 4XZUG 1OFSA 2EICA 1ZA4A 5C9AB 5C6CA 1I6XA 4BQ5A 1RVF2 1ASJ1 1UX6A 1WLCA 2TBVA 3ZFEC 1AR92 4NWVA 3OGRA 1CX4A 2RS32 4KNCA 4AEDB 4AHWA 4UI9L 5A7WB 3RZGA 4P9GA 2IZWA 3GF6A 3MYXA 4BQ1A 4E8CA 4D94A 1Q5OA 1XYOA 2DCYA 2WNVB 2WO7A 3RMXA 3RSJA 1H1AA 2UU8A 3AK0A 4CCJA 4GMP3 1L7LA 2QQVA 3ZX7A 4ZKTB 5F2SA 1W8FA 3S5AA 2VMFA 5DAXA 4Q5OA 5M0TA 1RUC3 2Y6KA 4QPGB 3U11A 4TWTA 4P9WA 2HJIA 1YO8A 4GB32 2VOWA 2QKDA 1WA4A 4NUBA 1ENXA 3G6JB 3WP6A 4BE3A 4TZDA 5IVEA 4UF0A 1JYTA 2ZGOA 5F5IA 4FPYA 4TXWA 4EN9B 4DEVA 2B8MA 2RDRA 3ZYIB 3U10A 4FVVA 5C33A 1W8WA 3VBHA 1IZ3A 2Q0AA 4JTNA 2RG4A 3U0ZA 4CDUC 5FXVA 4X6RB 3VDBA 1CIYA 5FPVA 2A6XA 5BNPA 1AX2A 4HBNA 1BZWA 1I5ZA 2RM22 3RYRA 1F4AA 1BKZA 2FCVA 1R092 3ILFA 4LR4A 5FYMA 1OXCA 2QBXA 5F5AA 4ZZ5A 5ANNA 3D5OA 4JGZC 4PLOA 4Y5Z0 5C4WC 4RS5B 3UKNA 3VKLA 3LPGA 1W9FA 1RL3A 2DTWA 3RI8A 1CIWA 3MICA 1PVXA 1QEXA 3HJRA 5F2WA 4WVMA 5I0TA 3O1TA 1TNFA 4UFMA 3OOXA 3TN93 5C3QA 4F3JA 4AVSA 5CA6A 3IT8A 5FJKA 2W95A 4UOJA 2K9ZA 4AVAA 1FAYA 3JQWA 4XDQA 1VMFA 4MXWA 1E5SA 4LTAA 2A1XA 2D3SA 3NMBA 2OA2A 4Z2AA 4NROA 4QU2A 4XQDA 4BK5A 4AXOA 1JYWA 4PI2A 3S5QA 1ZBA1 4A6OA 3WNNA 2C6SA 5GLVA 4K21A 3QD6A 2ZEYA 1G86A 1JH5A 3H3LA 5I8YA 4BZ4A 5JAXA 2BFUS 2XJTA 3PUHA 3MO4A 4NIAA 2QCSB 1IQDC 4PIXA 1LU2A 4H2AA 2D6PA 4PF5A 3OYWA 2IVJA 3F95A 1N47A 5A7PA 4QM8A 5FY1A 4EWAA 4ZS2A 5FMCA 2BBAA 1AR83 1GFF2 3CL1A 4X8PA 5B4XA 4IV1B 3S0MA 3T2PA 5FR3A 1DQ1A 4CDQC 3VD4A 1EPWA 4YVSB 1K5MA 2DFCA 5FZ3A 2PAKA 2Y6HA 4GWNA 1AR62 3B94A 1F2NA 4HN1A 2FDKA 2D5HA 1UMZA 3SCHA 2RDSA 1NYWA 1Z7S3 1REFA 4RSUA 4LEJA 2Z69A 4LO6B 3WF4A 2HWE3 3ZFFA 1ONAA 3P3PA 2D97A 5LASA 4C0BA 3AZWA 5CYYA 3FC0A 4MUVA 5LBBA 2CGPA 3MBWA 3O1UA 1VAKA 1KFXL 2VMDA 4AW7A 1AX0A 1NCRA 4XF3A 1N3QA 1OA2A 3E5UA 3KCYA 2CGNA 4LIUA 4ZY9A 5C3RA 2J1AA 5KHIA 1QJU3 3M70A 5I0UA 5F3CA 1TME3 2VU9A 2HWD1 4AFDA 4KBBA 2WIIB 1ZRCA 4HK8A 1BEV1 1JZ5A 3WT3A 1JODA 2JENA 4IGQA 3MUY1 4XTMA 5IVVA 1VPHA 4KBZA 1O3QA 4SBVA 4BU2A 3ZN5A 2ZGMA 4HVOA 2RM21 1LGNA 2DTYA 1ND2B 3LD8A 5FYYA 4D0QA 3DYOA 2D40A 2ZX0A 4JDMA 2B39A 3CO2A 5F8PA 3MLKA 2YGLA 1Q8VA 2VOVA 1RUD3 5LEJA 1ZBE3 3IM0A 5FZBA 3A23A 1C57A 1XNDA 4H14A 5IK4A 3BYWA 2E9QA 5F3EA 3O0VA 1ZRRA 4TLGA 4YVWA 3WVJA 1W9TA 1SBFA 1G9BA 1IHMA 3IPVA 3N9MA 4MGSA 1L7QA 2VL4A 1W6MB 1HRV1 3H3ZA 4MOAA 2HWB1 1YLLA 2WFF1 3CBNA 3AZXA 1H2NA 3ELNA 4JGZB 4AVBA 3UKVA 5BNOB 4LBQD 1RUJ3 1WA6X 2RS13 4PF1A 4U36A 2WJSA 1PVC3 2NMNA 2R1DA 4XMIA 5A32A 2WO2A 5A3TA 3AFKA 5IWFA 3ZYRA 4BXSV 1U12A 3NKTA 3W5NA 2EAKA 3UNPA 3VD5A 5J48A 1IKQA 1MQTC 1H4HA 2P34A 2WQ4A 2GP3A 3EJKA 4JDNA 2X5IB 4XYXA 1RUF2 3FLTA 2CU5A 1LOCA 4QXBA 3E5QA 1P8JA 2KM2A 4GKYA 1DFQA 4FFIA 1OC1A 5I8SA 3FLPA 1ZRDA 4CUGA 2YC2A 1KS4A 4UW4A 3WQBA 4MG2A 3HWJA 3Q8AA 5CADA 2XJQA 1BXHA 2UWBA 2X29A 3O1VA 1RIRA 4NHMA 1OUSA 1OI6A 1I5PA 3A0NA 3ZXFA 4W4ZA 2QQLA 3J8F2 5F5CA 1JYVA 2P6CA 1XE7A 4ITCA 2R7EB 2VJXA 4KG8A 3ZKUA 4YZ1A 1YQ2A 5JOWA 1LHVA 1VE0A 2OPWA 4HLTA 2WA3A 2PMWB 2R6QA 3BI3A 1CJPA 2E33A 1FPN2 2A3XA 2J1UA 4UFKA 4XE9A 4W8JA 4QKFA 2C9KA 3O5SA 5FY8A 1OLMA 3BTYA 4L99A 3NJVA 5FZ7A 3GZEA 4RN5A 5B4NA 5JIUA 3WW2A 1GNZA 1REEA 5CB7A 5LK7B 1G8WA 3GCXA 4AEDC 1RUC2 1MZ5A 4JGYA 4OVEA 3DECA 4IEQA 3DCQA 3J7MA 2AC1A 4FPLA 4MZUA 4NHKA 4EQVA 5C9AC 4Y20A 2RR11 1Q8SA 5IAXA 4LE3A 1S2EA 2HBTA 5F9TA 4NPRA 1NE4A 4IEOA 4Q26A 3EB7A 1PGL2 3JUUA 3I2JA 3WDWA 4FBFA 3GZUC 2BZDA 5J09A 4YW3A 1NLSA 1KQRA 5CFCA 2Q8CA 5JIAA 3LGRA 3IIAA 4L92A 4LXLA 5FYVA 4N8MA 1PMJX 4K1YA 2PA7A 4IE4A 2B7YA 4WZFA 4OI1A 3WUCA 5BNOC 2VVEA 1ZZ8A 3OBRA 4Q4Y2 2OQ7A 4MXWB 4D3WA 5D21A 3KWVA 4YZ4A 3C3VA 2D3RA 3BALA 1SFNA 2EXHA 4HPKA 2FDIA 5L36A 1XNTA 1KEXA 1UL9A 2R30A 2VW0A 3O14A 4MGTA 2BBVA 2UY8A 3ZXKA 2CY6A 2CDPA 2YBKA 4XW3A 3A0KA 1VAVA 2OZ6A 4HMZA 4AGVA 4YM3A 1NY71 2JDPA 4LBQB 2XVKA 5FIXA 1UMHA 3HR9A 4N7UA 3UKTA 5CG9A 1YHFA 2V4AA 4GQ7A 2IXHA 3JXSA 5FP3A 3WNXA 1MS1A 1DGLA 2AYHA 2K46A 2MEV2 2VE1A 4Y1ZA 5T3NA 4OCTA 3ZMNA 4NN0A 5FXXA 2WAAA 3SH3A 2ZX2A 1LOGA 2Y34A 1NCQA 2FBEA 1CVNA 4WBBA 1GOHA 2R061 1QGLA 5A6XA 4GULA 3K48A 3RJRA 1X50A 1TMF2 3B9IA 5CISA 3O1RA 3QOPA 3I49A 3KM5A 2ZHMA 3M2MA 2VTFA 3KCCA 3H8XA 3CJXA 4PHZA 4QQLA 3U07A 1LJ7A 4XTPA 1LOFC 4IE0A 4PJYA 1POV1 4C8DA 1SEFA 1UD1A 1H9WA 1RUOA 3THTA 4YVWB 3MPPG 2ARBA 5T5PA 3T0AA 5T5OA 5FQ0A 1OD3A 3IDCB 3RYKA 5FOJB 3MW4A 1VMJA 3RRDA 1NQDA 4BLJA 1X82A 2VBBA 4CRQA 4OUSA 1CAVB 4RQPA 1SFPA 2YDEA 3KD4A 2YYOA 1CZTA 4RR3A 1F5FA 1O4YA 2D93A 4IE5A 5FPAA 1QJZA 4I09A 4S2FA 3WLUA 3ZFEA 3LSDA 5E89A 2VY0A 1ZRIA 4DINB 1O59A 5DZGA 5JR2A 4RS5A 5KWRA 1SMVA 5GZEA 1OMIA 2VZSA 1F35A 3POGA 5ERLA 5J37A 3RZMA 4R9CA 5FLJA 1O5UA 1D7PM 2ID4A 3ROUA 4HZFA 2Y0OA 1R64A 3LDBA 1NT0A 1SCRA 2LW8A 1JZ3A 1DBNA 1QKQA 1FPN3 1W6OA 1ULDA 1YFXA 4QXHA 3TRSB 3T2QA 2O0OA 2E6VA 5C5UA 3H42B 2J7MA 1MVEA 1OOPB 2OZJA 1EYBA 3M4FA 3O0WA 3PJYA 4W65A 2P3IA 2ZEXA 4XOGA 5E8AA 2WL1A 3WNKA 1VIWB 4QX8A 5J3UA 5C70A 1W6PA 2RS51 2XQXA 4GZ9A 3JB8A 1ZVFA 3AXDA 4XETA 3RZZA 1EV13 3KV9A 5I93A 4O9EA 4MO3M 1AYN2 1OQEA 2DVFA 4GA9A 5TSWA 1GV9A 2ATFA 1ENQA 4DXTA 1RUD2 2WFF2 1JZ7A 4QKNA 2WT2A 1RUF3 5DDJ3 1AL21 4QB1A 2WT0A 4XMAA 1IS5A 1WW6A 5A7SA 3T1LA 1S0IA 3Q8BA 3AZZA 3KGZA 3V64A 3WEZA 2BJSA 3WQ7A 3FE5A 4XUTA 2NN8A 4LHSA 1QY4A 3VKFC 4DMIA 1CAXA 2ZMNA 3EQEA 2R49A 2GC1A 3Q8FA 4PLNA 1RXGA 1YJLA 2GNBA 2VCBA 5AC91 3AM2A 1C8NA 2DF7A 4FPKA 2HWD3 1UOBA 4X6QB 1TME2 4FPGA 2Y33A 1SCSA 2V73A 2BP6A 4FO9A 4S2DA 3SC7X 2XR4A 3TN91 2JDNA 4GAZA 4YPJA 2RJ2A 4ZHNA 4UXAA 4XJ9A 5FP9A 2YFZA 1FATA 1AZDA 3I2FA 2VZVA 2ZGNA 4H7LA 3ZFFC 1J59A 1ULPA 1W04A 2EIDA 4QPGC 3MGUA 3KHCA 2QDNA 5FMOL 2DWRA 2DCKA 2A6ZA 4WVMB 1J84A 4LNVA 5IVFA 1JU3A 4RFRB 5HCHA 3D0SA 1ENRA 3ECQA 4IGOA 1GUIA 1RHI2 1AR63 1QDOA 1CZVA 4AFBA 1T2XA 1NLRA 2RS33 4KU7A 4Q4Y1 2WO1A 2VZRA 3AYAA 5KHJA 4AI1A 1S0FA 2JIGA 3BOPA 3ZFEB 1XJAA 2RE9A 5DG1A 4RD7A 4FQ4A 3DYMA 2CL2A 2YC4A 3H1WA 2JDUA 4UW6A 3URFA 1X33A 4FTEA 3D4KA 4OHYA 1RYYA 3O1PA 3EHKA 1H4GA 5KC6A 3ZOIA 1AUYA 1OOPC 3BPSA 4LO5B 4QB6A 4WVZA 3VBFB 5CFDB 4HG6B 2RS53 2Q1FA 3A4UA 5DDJ2 1AJOA 3VBOC 4CDXA 3V0AB 5LB6A 4F8AA 3KB5A 5T55A 4OLLA 4XABA 3THPA 3ZYGA 1LHOA 5EPAA 4JZRA 1AYN3 1V9U1 3FN9A 4A7YA 3ZO0B 5DUWA 4C90A 5FXZA 3SH5A 2FDHA 4KWLA 3ZR5A 4XFCA 4I0AA 5EV7A 3ZN6B 3SNMA 4B7KA 1YFYA 2YC0A 4XACA 3ZIWA 2BEOA 4LA2A 5ABJB 3L2HA 2ZXQA 1QWRA 3OGSA 4DY3A 3OBAA 1UZVA 2G9GA 2QQKA 3SQOA 1PMIA 1HJGA 1HN0A 5KXEA 4L9BA 4LPLA 4IV3A 4CCEA 3MF9A 4ARYA 4EROA 4KH9A 3VBOB 3UGFA 3WG2A 1JI6A 2OUHA 5K8SA 2Y6FA 3VBFC 2IXJA 3MZHA 1TZOA 4BM8A 5C8CB 1GP6A 3J4UH 4HT1T 5GM0A 1HB4A 1UCXA 5F39A 1QQP2 5LATA 4NRQA 4JKKA 5JXIA 1HXS1 1Q8QA 2R1BA 1UMIA 2Z2SB 2J1VA 3BVCA 3M7AA 5FJHA 3IDAA 2W52A 1BMV2 4HVRA 2VBDA 2LALA 1YRZA 5FMBA 2XLAA 3NNFA 4XF1A 3P3NA 4ATEA 4AI0A 4A7KA 2VNVA 3TWIA 4NRPA 2RMU2 4D6QA 1DQ4A 3POIA 4YZ5A 4H7MA 4PBOA 1WD3A 1UU5A 1JHNA 1K5MC 5L7OC 3BU0A 4NE9A 4IEYA 2XBO2 3R4SA 1MEC3 5FQ0B 5T5JA 3LKJA 3CU7A 4L2NA 3FWEA 3NJYA 4R4ZA 1VBA2 2P4EA 3F2ZA 3PMSA 4AZZA 4E8DA 1NAEA 3JD73 4CTEA 4FPEA 1CPMA 1C1FA 2LROA 2W08A 4QHZA 4KGGA 1W2UA 2PHDA 1RUC1 3CJIB 4JVAA 5CFCB 4FT8A 5GZCA 2D6NA 3VLBB 2XVLA 2QJVA 4ISRA 1VBA1 2CYFA 1SLIA 1Q8PA 3HNYM 4CA9A 4FP2A 4FXGB 1AHSA 2WKKA 1VBC1 4Y20B 2R072 1MACA 1IG0A 3LB9A 1GZWA 3O1MA 5K7PA 2VCAA 1XPWA 5L9RA 4BISA 4IE7A 3S7IA 5JSPA 5LBEA 3W59A 4XZPA 5AVAA 4FXKB 1J3RA 1W99A 2YPDA 2R071 1PVC2 3WINE 1Y7BA 4CEWA 1VRH1 3ORJA 4A2UA 2ZX3A 3R6SA 1R1ZA 2AENA 3POFA 3IN9A 3IDBB 2JX9A 3LA2A 5JLVA 4XBLA 3SLIA 1J83A 1GYKA 5J7MA 2VZPA 3AKTA 4UFJA 5JOYA 2Q5TA 1Q43A 4L8QA 5JSRA 3VDAA 3MV11 3N7LA 5C7GA 1UXXX 1UY3A 1XRUA 4Y1VA 2CWSA 1VBD2 3WR0A 4C0HA 4MGIE 2A7AA 1Q3EA 3DL3A 4ARXA 4UYBA 1XU2A 2ZGSA 1ND2C 3I2KA 2YGMA 1JYIA 1URXA 4XHBA 4Y22B 4C91A 1V6LA 5T5LA 2KR2A 4P00B 4NIGA 3PVEA 2R042 3JBG2 3THDA 3EBRA 4GKXA 3I3BA 4PIYA 4FPOB 1VBA3 2VZQA 2O8QA 4YYOA 4H3WA 1VRBA 2IXKA 3L2YA 1NA1C 4AGGA 1S55A 1WKYA 4J1WA 1MVQA 2ARAA 1DCSA 4YGBA 5FZKA 3SEEA 1ZA7A 1NX9A 3N9NA 5LRRA 2JD4A 3N7JA 2W68A 3I2HA 4IV3C 3E6CC 1D0HA 3IAQA 3S7EA 1UQXA 1O4TA 2GH2A 3AKSA 3IDEA 4PT6A 3W21A 4XJZA 1EY2A 2Y6LA 2YPJA 3K3OA 4YW5A 3LF7A 2UWAA 1NCQC 1Y3TA 4JQRA 4IUGA 1QNWA 2VULA 3INAA 3MW3A 4ZXEA 2RS31 3LFMA 5EIYB 2L9LA 1G7YA 5F6LB 1HJFA 3KF5A 1V70A 2QQMA 3LEGA 4YG0A 4OQ9A 5A1FA 1OLRA 2CAUA 5IW0A 4TLFA 1D2QA 4W50A 1ULOA 2P17A 4YG6A 5LA9A 4N7IA 1OUXA 4Z82A 5IAVA 1D4M1 3UGGA 5ACA1 1OBNA 4JCKA 2VR4A 2P6HA 5D1IA 2DCTA 2VOXA 3AP9A 4IV1C 2VZOA 4Q0UA 5BY5A 2W92A 4BQ3A 4P08A 1V9U2 3HAGA 3I54A 1W3VA 2GC3A 1SDDB 4AVCA 1W0PA 4YW7A 3T0BA 3VZMA 1FOD1 3P6BA 3RDIA 3DYPA 1F15A 1F4HA 1RUI2 3AMNA 1YIFA 4Y4YA 4YG3A 3P1IA 4FP3A 2VXRA 4OHZA 4QQOA 1GP4A 1ST8A 2XH6A 2QTWB 2LUWA 2XL9A 2VW1A 4R9AA 1PGW1 3VZJA 1AXKA 1PHMA 1W90A 1ZBA3 3JU9A 3VDCA 1HQLA 2MNGA 2YB7A 1WLDA 4GD4A 2DVDA 3FX3A 3N7KA 4OYUA 5CU1A 4LBKA 5LA1A 1G9DA 2PTMA 3S6PA 5C4WA 1RTVA 4AQ6A 5L7OA 1VRH2 3BIWE 5GZFA 3LEIA 3ILNA 4AEKA 3ZXDA 4B4RA 4CDUA 1DG6A 4JV4A 5I8TA 1W2TA 3MIFA 2PHWA 4DUWA 1KS5A 2HYKA 3DXUA 4GJYA 4BDVB 2PHRA 5BV6A 2I07B 1U0AA 4P9IA 4R9DA 2WUHA 1WMDA 3LOIA 1H0BA 1XNAA 3IIIA 4META 4Q0VA 4INDA 3DKWA 2VECA 1NZCA 4WV8A 5DUUA 1S0EA 2GNMA 2OPKA 4EV0A 4BHPA 5JOZA 4CEWB 5LZ6A 2ZPXA 1WCDJ 2NYYA 2W9XA 3MFAA 4QHBA 1V6IA 1L7RA 5HCFA 4CU9A 4BJ0A 2BWCA 2PHUA 4HXCA 5A3PA 5JCTA 3ZDSA 1W6QB 3ZYBA 1VRH3 1LOEA 2VM9A 2H6BA 1A8MA 2YXSA 4IEZA 5CFDA 4B4PA 2WBKA 4QQ2A 3WW4A 5B2GB 1VB2A 3FMGA 4B3NA 1HXS2 2JDYA 3T08A 4KWUA 1LKNA 1UOGA 1QXJA 2VQ0A 2YG0A 3CZJA 1RUG2 5HCAA 4Q2FA 1Z7S1 4D6SA 3OUIA 1NG0A 1NLQA 1BYHA 4ISQA 5F3GA 1W39A 5FZ8A 3AJYA 4CDQB 4W6XA 1IS3A 1PX3A 4ZU5A 2FHRA 2D43A 1SLBA 1IS4A 4I01A 1WMXA 1WWYA 2QE3A 3FBYA 4XC9A 3ZFGB 4CCCA 3DUIA 1GZTA 2EA7A 4E27A 1SDWA 1CAUB 1R1A1 3RYPA 5FZ6A 1AX1A 5DAVA 5T50A 2QQUA 2C1FA 4HONA 2WZR1 1DQ2A 2W1WA 2D44A 1O3TA 3HQUA 3H1YA 2X05A 1W0OA 3VBRA 3RZKA 1VB4A 2IFWA 3IB3A 1S0DA 4LKSA 3ST7A 1FYUA 1GP5A 3PJQA 1DP0A 3SCFA 4CUCA 5JVVA 4IV1A 5HXVA 4B7EA 1S0CA 5SV5A 2P3JA 4KMQA 3LCPA 4XURA 4Q0SA 5CZKA 4D7SA 2WRAA 2YBPA 4QPYA 2P37A 5T54A 2VMHA 3T4HB 4QX3A 4LUKA 3N7MA 4J25A 2W87A 4Q4W1 3S57A 2DVBA 1PVC1 1UWWA 3HD8B 3NW4A 2VXJA 4WM8A 3AZYA 4RS5C 1PGSA 4BA6A 1W2NA 5KHKA 4QPGA 3T30A 1W0NA 1XC6A 3KLSA 5EYYA 5A3LA 4NPMA 3OYWB 2ZA9A 2ZBJA 3DKQA 1LOBA 5FYUA 2DYCA 2XJSA 3G7DA 1DLLA 1UO9A 2DFBA 2E7TA 2WZPP 2XKPA 4D8MA 4CPBA 1DQ0A 5FWEA 1H2KA 4UT5A 2PFWA 1V6MA 4IQPA 3GJBA 4S2GA 4C1WA 3WZ1A 4YZ3A 4LO8A 2C9AA 5HCBA 1W8HA 3LDKA 1PO13 4WM7C 2ZEZA 3VBFA 4CYDA 4ONUA 5KXDA 3NSTA 1MS3A 4WZCA 3RI9A 3VDDB 3W20A 4Y5TA 4E4ZA 1WD4A 3FHAA 4QT6A 3OY8A 4EN8B 3T2TA 4UBHA 1AYM3 3QACA 2XBO3 1NUKA 2W94A 3UV9A 2P2KA 1GOFA 2HWE2 4XFFA 3R0RA 3E6BA 5IK7A 2WZ8A 3ACFA 3AP7A 5FK8A 2WNVC 2ZMLA 5FZCA 1FI2A 1HIXA 4P9LA 3ACGA 2VTXJ 3U78A 1D4M3 5ACA3 4OMCA 2UYAA 3C7OA 4GB33 4RGAA 2V09A 3OPTA 5CKMA 3ZSLA 2HWE1 5E6HA 4WVWA 4PDWA 5FCCA 4YNIA 2IUWA 1XOYA 3RPQA 2VO5A 2F4PA 2ARXA 2B9VA 4OHXA 3RJ2X 3VHPA 1X9PA 5HPOA 1OF3A 1YUDA 4AYUA 1M4WA 3KVAA 2W5FA 1W9SA 3I7DA 4ZPIA 3IMNA 4MGYE 5KHHA 4CEYA 4Q4V3 1COV2 4UF0B 4DNYA 3AKPA 4YVSC 3FL7A 4PLMA 1O8SA 2R063 2FZ2A 4M3CF 1OFNA 2W46A 3LSEA 3QH7A 1EV12 3WF0A 2ZKLA 2XOMA 2XKOA 2PAEA 4XHXA 4CE8A 1UIKA 3K4AA 2D6LX 2W1UA 1OT5A 2QUOA 2P3YA 1R091 2NLRA 3KQ4B 2DVAA 4PI0A 1AXZA 4LO7A 4N43A 1BEV2 4BH9A 1G9AA 4JDOA 1C4RA 1GU3A 2JG9A 4GWMA 4YLZA 1S0JA 1QH6A 2FQPA 2WS92 3AVRA 3PTYA 2GU9A 3U75A 4FTSA 4NIDA 4AEDA 2WYFA 2BNNA 2XONA 4O7XA 5DQ0A 3RGBA 4BQYA 2ZZQA 5CFDC 1W8UA 4RGGA 5EYXA 4Y1XA 4IESA 4LKEA 5FYZA 1MR5A 3U4SA 4AR2A 4FOWA 2EXJA 1IGOA 3NJZA 4LLOA 3FLRA 3V0BA 3UJQA 1XB9A 2Q8EA 1LODA 3KV4A 1VBE1 3ZVXA 2HWB3 1MS8A 4P9YA 1ND3C 2E32A 3CHXA 1UN1A 1F9KA 4XVHA 2EF6A 5I91A 1HRI3 5KBFA 1CAWA 1VBB2 3KQRA 2H0VA 4WM8B 4AQTA 2R041 5C4WB 1BBT2 4YFWA 3GZTB 1SLLA 4JAAA 3O0XA 5EWSA 4DB5A 2B45X 2ZJCA 3PNAA 3TN92 2VMIA 2ZGRA 1W8TA 3BTXA 1QJY2 2AEZA 1BMV1 1PZ9A 2PAMA 2A3YA 1QJX3 1WZXA 4HPKB 1Z0HA 5HV4A 1XYPA 2HWC1 3MDPA 3RVHA 2AR6A 1POV3 2PLV2 2DCZA 2R0FA 2C26A 3PUSA 3EMRA 5FZGA 3BODA 3PTRB 1FMD2 1XNKA 5FZ4A 2DBNA 1GQHA 4XF0A 1W6NB 3H8UA 4CP1A 2AH2A 3GNEA 3OJBA 2Z42A 3GBWA 3POYA 3H9AA 3MEPA 5FPXA 4UFLA 1UU6A 3N3HA 3KS7A 5IT6A 2E51A 1DYKA 2VCCA 1AR93 2WQ8A 2YROA 3DPRA 3O1OA 3NKGA 4V1PA 4QX5A 1UZWA 3CIHA 3HEIA 5DZFA 4DEQA 5KC5A 3J8F1 3UL2A 2HBUA 3B02A 1DU3D 1UU4A 2IC1A 2GAUA 3KV6A 1C8M2 2E53A 5HXMA 2QQPA 1KITA 3WXPA 2WLQA 4CDQA 1QF3A 1RMU2 1VBC2 2BFUL 4DZGA 4I0WB 1MZ6A 5JPMB 1NE6A 1X9TA 3VD3A 2ET7A 4EZHA 4AG4A 1WLTA 1BCXA 2WR9A 1RITA 3CQOA 5DDJ1 2XJRA 1YI9A 3M3OA 2NP0A 2UURA 2RMU3 3ZYJB 1W9WA 2X53S 4G9SB 1G9FA 2QDRA 2GC0A 2YZ4A 3WNLA 4BK4A 4D6RA 3VL8A 1WBFA 3EO6A 4Q4X2 1ZBE2 1JHJA 3D6EA 5F32A 4Q4W2 3ON7A 1R082 1RUNA 2HWF1 1HB1A 4KGQA 4F83A 5GKAC 4XFAA 2VGDA 5A3MA 4XXPA 3T2OA 1PO11 1AXYA 3CF6E 1H30A 3PUQA 2EXKA 5CBLA 2PN5A 4DFSA 5HBAA 5FFOC 1H8TC 5FZEA 3AMHA 4XBQA 1YCIA 1PM7A 5A32B 2VAUA 3AL5A 2VMEA 4IW3A 1DLCA 3M3QA 3C7HA 1DDLA 1ND3A 1XSQA 4QGMA 4LT5A 5FY0A 1GANA 2R16A 5FP4A 1HV1A 4JGZA 5FZDA 3AZVA 5JXGA 1O8PA 3B3QE 3MUZ1 1JTZX 1STMA 2W2IA 3ETQA 3EYPA 3LWCA 1GWLA 3NRUA 4LBQA 4NHYA 4XAAA 5CVRA 5FYIA 4E4DX 5C71A 3QH6A 4UBGA 3VZLA 3OEBA 3VBRB 3RNSA 2Y6JA 3VB9A 1SHWB 2WNUC 2YFUA 4YW4A 2XPJA 2GMEA 5JXJA 4HSLA 2LRPA 4BCUA 1FNZA 3R05A 1COV3 3VBSB 4RHV3 1QJY1 2G9ZA 1IS6A 2XLGA 4MGZE 1Z7S2 4JGYB 3UGHA 2BERA 2B5HA 4A4AA 1OVPA 3VZOA 5KXBA 2OUJA 2PLV1 3HT1A 1KDMA 5LY1A 2W1QA 1KGYA 5FYTA 3V0AA 2O8OA 2VZ3A 1O3SA 1HN1A 3VL9A 5GZGA 3LDRA 3TB0A 1ENSA 3VBUA 1ZZBA 2NQYA 2ADEA 3GHMA 5FP8A 4Q4X3 5A7OA 3ETPA 4K6BA 3D3AA 5LY2A 3SH4A 3DPRB 4G3YC 2BOIA 5APAA 5FYBA 5H9SA 3VHRA 2BVBA 4LBMA 1RGSA 4IDZA 1A6CA 1JZ6A 2ZGQA 1FOD2 2WNOA 4KL1A 1V6OA 1VP6A 3LA3A 2OW4A 3GBFA 4E9KA 5JDBA 2Q1MA 3GDBA 4XPVA 4YGDA 3RMYA 1UAIA 1YFWA 3BTAA 5DAWA 1I3HA 4ZZ8A 1REDA 2W3JA 2VOKA 3T1MA 1ZZCA 4L11A 2W1SA 3GBGA 1KD7A 4FFFA 2BW8A 4MHUA 5EXOA 2ETEA 4XFGA 4Y22A 2TUNA 2E31A 2Y0IA 4RHV1 4RQPC 3U14A 2F4LA 1VBB1 5C8CA 3LAGA 4AQ2A 4EN7B 3NAPA 5E16A 4QXCA 1E57A 3MHZA 4P9XA 3N9QA 4NRMA 2LS6A 3NJXA 4XDOA 1AR81 1SLAA 4FCAA 4GWIA 5F6KA 3WP4A 3UK9A 4QXKA 1H8TA 4DO0A 3ZPYA 5JXHA 2QVSB 2QQIA 1V6JA 1ZNPA 1JYXA 3BCWA 4Q4W3 4FFHA 4BYYA 3KSCA 1SG3A 2JG8C 4NO4A 2C4XA 3ZN6A 3FUOA 5L19A 2SBAA 1GOGA 2GMMA 3LIGA 3AL6A 3SHRA 2WAOA 4JC1A 1PO22 3E97A 1ODMA 4IE6A 1RC6A 4A41A 5H9RA 3HN3A 3RS6A 4DS0A 2DVGA 4OHWA 3B69A 1PMHX 4Y3OA 4FPHA 3ITQA 4QHOA 2Y6GA 5FO7B 4B1LA 4E4HA 2K2SA 1LGBA 1RUF1 1RMU3 1KJRA 5FTTC 4EYUA 4QX2A 4XUQA 5IVCA 1PO21 2R062 3Q8EA 1U5XA 4BQ4A 2VTXA 3AP4A 3GALA 4Q4V2 5FXWA 1OOPA 4YFZA 1YWKA 1FMD1 3VKMA 3AVSA 4OUEA 4WVVA 1MEC1 4M0HA 4XFIA 4ATFA 1H8VA 4O9GA 1RB8G 2OKXA 3H7JA 3AP6A 3IWZA 1OVSA 3IZOA 1WLWA 1KJLA 1D2SA 1DIWA 2ERFA 2VUAA 4IL7A 5FO8B 1SZBA 3ILRA 3N9PA 1RVF3 1WGPA 2CSGA 5IYYA 1MQTB 4JHTA 1EAH2 5FPLA 3H3UA 1U5IA 1Y9QA 2PLV3 4A3ZA 2ZGPA 4LITA 5L73A 5FY9A 3WP5A 1U5YA 2N7GA 4AQSA 3SITA 2VNRA 4FPFA 4QX0A 4CP9A 1RUI1 1PZ8A 2TEPA 3HIFA 5BNNB 2CDOA 1QJX2 2HWD2 3KGLA 3POEA 3WF2A 5HI0A 1H2MA 1LRHA 1JYNA 5G04L 3CZUA 4NPLA 1WCUA 1XXNA 2V4VA 3WF3A 4COWA 2WNVA 1HRI1 3N4MA 1CPNA 1DGRN 3KT1A 1G9CA 4GMP0 1CAVA 2EIGA 5JPNB 1GNHA 1AVBA 4JQTA 3R4UA 4GH4C 2Q4SA 2NPIA 1POQA 2ZMKA 2WSVA 3AYEA 4Q29A 2JECA 3NL1A 1QOTA 2V5YA 3PVNA 1WCSA 2V72A 3N9LA 3POSA 4M3CB 4QPIA 5K0UB 1IKPA 4JHZA 3PLQA 5EZWA 1CAWB 3J26N 5K9YA 1ZZ7A 3ZM8A 1LHUA 1K3IA 3ABZA 4LHNA 3BIEA 4IEUA 1HXS3 3MV01 4Z1VA 1NZIA 4AEMA 5A1AA 3V0BB 1RJ8A 4B8EA 5JR7B 5DG2A 1QOOA 3M3EA 4K7JA 2YV8A 3VV1A 3ZXLA 1KDKA 2Q30A 5JZGB 1S2KA 1JN2P 1GWKA 4HL0A 4LO4B 2VZUA 4MXVA 4DQAA 1RUJ1 2RS11 2KD7A 1XBFA 2YUEA 3MPBA 4U2AA 3WHTA 1UKRA 1OH3A 1IG3A 4AF9A 4CDXB 4ES9A 5FZ0A 1SPPA 1UZYA 1M06G 2BGPA 4LIVA 3HMYA 4N43C 4PQ9A 4AOCA 1S0GA 3I59B 4CEYB 2ZS6B 1ULEA 5D8AB 5K0UA 3M1HA 5FUPA 1A78A 4B1MA 5FZOB 3JB4C 2Y38A 2JDHA 5A3WA 2XHNA 1OKQA 2HWB2 2PHLA 4QB2A 1CWPA 4I3PA 2PHFA 5C3PA 2XUEA 4EZ4A 4YW2A 3UT0A 4RR3C 3I3QA 2VQAA 4CP0A 3VUOA 1WCQA 3KMHA 4IEVA 4X8NA 3SKJE 3WNOA 4FI9A 3K46A 3KVBA 1GSLA 4Z8BA 2OIIA 5FZLA 3LFIA 4BIFA 1YIPA 1RUE3 2FCUA 3LA7A 1TG7A 2B9UA 3NVCA 4F7ZA 4URAA 1RHI3 1ZYBA 3JQXA 4XEZA 3MFCA 4PIZA 4GH4B 4CCDA 5A6ZA 1ZZ9A 2V5DA 2ET1A 4PDWC 5EQUA 5G05L 2HEYF 5CEHA 4MVTA 4GMP1 1H9PA 4W6YA 1APNA 2XWJB 2PQSA 1CESA 4Q4Y3 1W8NA 2NMOA 5FUIA 3HPNA 3HNBM 2DCJA 4SLIA 3RWKX 3ZFGA 3GXUA 5LRSA 3FUQA 4QX1A 1HQWA 1UIJA 1GMMA 4Y33A 2ZZJA 3LQCA 3NV4A 4RR3B 2GH8A 1N1VA 3R4DB 4BQXA 1CGPA 1F31A 2D98A 2I45A 4IEXA 4CP2A 1VLNA 3GYDA 3VBSC 2B46X 1GBGA 1H2LA 2IWGB 4RA0A 5FRAA 3CDZB 3B93A 4MHRA 1ULGA 5FAXA 4R9BA 2D5FA 1KXGA 3PU8A 1O4ZA 1SQ4A 1UY2A 4RYDA 3OUHA 2PYTA 4LBJA 4CEYC 5IUQA 1PO23 2RV9A 4Q8LA 1PGL1 2A6VA 4CUBA 3ENRA 2Y64A 4FOYA 1MPXA 4K9SA 4RL7A 2VC9A 2WO3A 2GN3A 4LJHA 2KA3A 4CVUA 1C3HA 4BMEA 1IPSA 3T09A 1HW5A 1NA1B 4LOSA 1C28A 1Z78A 2A70A 2CWMA 2QQJA 3GCWA 4IEWA 4R4XA 1X8MA 5JOXA 2ES3A 5FZIA 1UF2C 4P14A 2GSYA 4CDUB 1JOPA 3X29B 2A75A 2BDRA 2ZHNA 1JZ2A 2HEWF 3U4XA 3MIGA 3GJAA 1E5RA 1DF0A 3NAPB 3SISA 4DY5A 5IFPA 4RFT0 3K4DA 1SLTA 4LHKA 4XQ4A 4N53C 2HWC2 4FPJA 1PM4A 4A42A 3O1SA 2G19A 5K0UC 1Y43B 2FD8A 5A7QA 3TNQA 1NY72 3JZVA 4YGCA 5FZ1A 1J3PA 3USUA 3DGTA 2DU1A 1ASJ2 2AREA 2ZCWA 3AB0A 3JBG1 4MV2A 5DAQA 3TEYA 1UPSA 1JZ8A 1QNYA 4PCRA 3L9JT 1FT9A 1UY1A 4LK7A 1OA3A 3JD72 4CDWC 1YJKA 1EP0A 3SKVA 3OPZA 1AL0G 3BB6A 1MEC2 2DBIA 4QQHA 3VHNA 1JXNA 2A5ZA 1QU0A 4PBPA 2VQTA 3DV8A 4LMFA 1H1MA 1F5JA 5A80A 2ZGTA 5BNNC 4XJUA 5D2AA 2W47A 2AZ5A 1EUUA 4UAPA 3ALQA 1RUG1 2D7FA 4B29A 5JZGA 2JE7A 4KI5M 2ORXA 4E2GA 3QLQA 1JUIA 4GB31 3WDVA 4COUA 3C7FA 3I2OA 4I3GA 1RINA 4TTGA 1ZM1A 3WP3A 4A45A 2VVDA 5F37A 3ATGA 3AMMA 4AI8A 3WUDA 1QQP3 4N53A 3NNGA 3UESA 3MF6A 4YSFA 1NCRB 4BOWA 5DZEA 2QZ2A 4NWWA 4LKFA 1E5HA 3B9CA 3H0OA 4Q4X1 3W5MA 4ZU7A 5A7NA 1N1TA 2JKBA 4HVQA 4HFSA 2JKXA 2BUKA 5F7UA 2J1TA 5EJ3A 1VBB3 2D6MA 3A21A 3K77A 3M8LA 3OPWA 1BK0A 3ZLIA 1RUJ2 2RS12 5L7OB 4Y5SA 4MLOA 4GJZA 1JBCA 3OBTA 2FMYA 1VBD3 2J1SA 3NNMA 4ZONA 3PURA 4QAWA 1PK6B 1BQPA 4E2QA 2YMZA 3K4ZA 2RJKA 4QU1A 2VZ1A 3N36A 5BUVA 4MGQA 4AFMA 5FY7A 4AWDA 1KFUL 4XFBA 2YBSA 1DGWA 1UYXA 4XJ8A 5CKNA 1J1LA 2JJ6A 5C8CC 1TNRA 1GZWB 1LAJA 5DPNA 3OGJA 3AC0A 5FLIA 4LQRA 5IVYA 1PK6C 4FOVA 4BIOA 4M3CE 1NOVA 2VUDA 4QD2A 2JE8A 2X09A 1WW7A 4JKMA 2SLIA 3PVOA 1J1TA 1ZZ6A 2GP5A 1B35B 3CJIA 3IKWA 4P9JA 4RQPB 1KRIA 1PIV1 1PNGA 1AR72 3SEPA 5I0DA 3MW2A 3EXUA 4XF4A 2VMGA 3P5BA 3NO8A 3MLLA 4FSJA 2WLPA 4MH0E 5IATA 2JICA 3WG3A 1U5ZA 1DZTA 2IXIA 1XE0A 5FO9B 5FKCA 1LEDA 1AR71 2FZ1A 4NAOA 1K42A 3WDUA 1S1AA 2CGOA 1GWMA 4IXLA 4Y1YA 3NQHA 1OHFA 1TMF1 5DABA 4AVVA 2PXJA 2E26A 1R1A3 5AFBA 5LWBA 2XBO1 4ZS3A 1QXPA 3VKNA 1QQP1 2G4IA 4OZXA 5ANQA 1DZRA 2GDFA 4S2HA 1RUI3 5DAPA 3FJSA 4V2VA 1HLCA 3CEWA 4XCAA 4YWAA 3T3YA 3WF1A 3WNPA 5BNPB 1QJFA 1O5LA 1RUE1 2XHKA 4QX7A 4A44A 1R1A2 1FPN1 4COZA 3I2GA 3KHBA 3N35A 4CCOA 2EIBA 2GMPA 3ZSMA 2VNOA 1QOSA 1BLZA 4OZOA 1HB3A 3PVBB 3WG1A 2JB4A 3HQRA 2EAAA 4DUVA 2OVUA 4QPWA 2RJLA 3NNJA 3ZYHA 5CKQA 1OH4A 3WDTA 3KT7A 1DYPA 1BVVA 2BPA2 4XUNA 4LA3A 2Y60A 2DDUA 4DUXA 5EP9A 1C1LA 2JEMA 2BU9A 2GC2A 3C7EA 3POWA 5FZ9A 2K0GA 3KZ4C 1FV2A 3LIHA 4MX3A 4AEJA 4EN6B 3THCA 3ACHA 1NQJA 2Q1ZB 3OB8A 3LPFA 3I3DA 2Q8OA 2IXLA 3ZFFB 4CUAA 1LTEA 2AACA 2ZEWA 1TEIA 3KT4A 4YGEA 3VBRC 5C5TA 2GNTA 2CAVA 2NM1A 2A73B 1W6MA 3LE0A 1K45A 3PL0A 4JRAA 5FZMA 2J22A 4CZSA 4OULA 2JG9B 2PHXA 1ODNA 3RZJA 1N3PA 1LU1A 5LEKA 2NZ9A 3B00A 4Q27A 1DGWX 1VBD1 1LB2A 3PIGA 1HRV2 1CN1A 3BPZA 1BVP1 4Q1PA 4QDQA 4ASKA 4ES8A 1V6KA 2RS52 1W28A 3J8F3 4FQZA 2B42B 2JG9C 3C7GA 3USUB 1OURA 2RDQA 2VUJA 2DUQA 1NCRC 1O7FA 2AUYA 5I0RA 1HRV3 3J7NA 5FY4A 1SBDA 5J36A 4NIIA 4D7TA 1ZRFA 1AL22 3ACIA 3MIHA 4XDPA 2E7AA 5AVPA 3A22A 3KV5A 1LOFA 3Q8CA 3RWNA 1W2AX 3WCSA 4UFIA 2QFEA 3WCRA 3I3MA 4M4RA 2RMU1 3PDQA 3ES1A 5H9QA 2CNAA 2OXBA 3VN4A 1AR61 2IVIB 4XUPA 4CXWA 2MHFA 3HQXA 4HOOA 2VOTA 1S4CA 3ZIXA 2EVXA 4A6SA 3HBZA 1LULA 4IETA 3W9AA 1LNSA 1MS5A 1OKOA 1LHNA 1MS4A 4GIQA 5GLZA 3BKZA 2X5IA 1UYYA 1YFUA 3M3CA 1OQDA 4CDWB 1OD5A 3CLPA 4JX0A 2WNEA 5F1RA 4CCMA 2Z4FA 1FX5A 1QJU1 1CAXB 1OPMA 1TMF3 4G4FA 2Y26A 1UNBA 2R32A 3OD0A 1OQ1A 4N90A 4O65A 5FK7A 3ZFGC 3ZXEA 4DRVA 2LTNA 5EJZB 1GNYA 2FDFA 4NIHA 3AJZA 5LA0A 1RUE2 3HOBA 5H9PA 2ORZA 5J96B 4AI3A 1DYOA 4N53B 2ZHLA 3O12A 3C2UA 1UW8A 2C5DA 2CTVA 1UOJA 3VBOA 5DN2A 4XF9A 1AF9A 2RVAA 1ULCA 1CX1A 1YEWA 2WYSA 3AYCA 3BU7A 4FFGA 4PQQA 1VJ2A 4AAXA 1V0AA 2JDAA 1GR3A 3T4VA 1V6NA 4YVWC 5GJ6A 3OG2A 5LCWL 1BHGA 4AVTA 3DN7A 1PIV3 4AHYA 3OF1A 2BQPA 1B35C 1W9YA 1JW6A 3MLJA 2WDBA 4N43B 2RDNA 3D8CA 3FZ3A 5FV3A 2W91A 3APBA 1GZCA 1HKDA 1YQ8A 1O3RA 4AFCA 1LR5A 4M3CA 4QPIB 1UYPA 1PIV2 3T0DA 2A6WA 1AR73 1VBE3 1R081 3WDXA 2HWF2 3TOJA 5FZAA 1LENA 2BVVA 2ENRA 5SV8A 4AL9A 1QDCA 5A70A 1ULFA 1LOAA 2YU2A 5CNAA 2D3PA 2RHPA 5FYCA 4GH4A 3VDDC 5FY5A 2X8KA 4QDSA 4UWDA 1A8DA 1DGRA 4K1ZA 4QDRA 4ZU4A 1MZEA 1ZREA 3C8XA 1L3JA 1RUD1 4AGRA 2XL7A 4Z92B 5DUVA 2MEV1 2WABA 3KF3A 1Q56A 1W05A 5FYSA 2ZGUA 5GZDA 1SACA 2DURA 2QQWA 4KG0A 4XJAA 1JU4A 5A3OA 4OHVA 5FBZA 1SPPB 2HWF3 4XJWA 2O14A 1CZSA 3BUCA 3RFRA 5C3SA 4CCNA 2ZX4A 1K5JA 4M0NA 4PDWB 1T6GC 5FZOA 1YQCA 4BPZA 1IPJA 2J1EA 1W2OA 3VBHB 4YW6A 3FFQA 4LORA 1CQ9A 1FNYA 2C24A 1GZ9A 2XGXA 4COYA 1TME1 2XQRA 1NXD1 1FOD3 5GLUA 4OI2A 4QM9A 5AFEA 2VG9A 1QMJA 1N1YA 3GM8A 4DXRA 4N9HA 3WNMA 4HKOA 2BRTA 4Y26A 4KQ7A 4OI4A 4CU8A 3FFZA 4I0BA 4TSVA 3USSA 3OUJA 3CKHA 1XYNA 1A3KA 1G6NA 4N9IA 3AX4A 4YW1A 3SCGA 3TAYA 1X36A 1QXRA 3AMPA 4AI9A 4OI0A 4MSVA 3J7HA 1O6UA 1IQAA 1OLME 3NWKA 3WW1A 4CCLA 5IK5A 1NCQB 2JIJA 1UZ0A 3TNPB 1UYZA 2BGOA
chains in the Genus database with same CATH topology
5C8WA 3WV6A 4Y1UA 1COV1 3MIEA 1UZZA 3OD4A 2WZR3 2I2SA 2EALA 3VBUC 4CDXC 3V56A 1EAH1 2YY1A 1FMD3 1V00A 1XE8A 2ZTNA 2WFF3 2ZABA 4CDWA 2W39A 3VZKA 1LESA 4K3UA 3RQ0A 3VGIA 4HANA 1GKBA 1TQ5A 1OPOA 2GZWA 3ZSJA 4JTOA 4R52A 2VNGA 2ZACA 1W6OB 2XWBB 1C5IA 1ZBE1 4P5HA 3NAPC 5DUXA 3H7YA 4KWJA 4AE2A 1BBT3 5E88A 1ASJ3 5FMOS 1OA4A 2X5IC 1W6PB 4YRDA 1JUHA 2XB6C 3QCWA 1CAUA 4EWEA 1AL23 3OY8B 4KU8A 4EN0A 1AYN1 1V9U3 1WUVA 2BYVE 2DV9A 4YM3A 4FAGA 1B09A 2R043 4AHZA 5FLHA 1HQNA 3OTFA 2ZGLA 2XJPA 4WM7A 3VBUB 1R083 3QBQA 4CEWC 4K8FA 5BPXA 1SFYA 3I2DA 2H0BA 2ZAAA 4IEPA 5I0SA 1OSGA 2RR13 4K20A 4KWKA 1FXZA 2C0ZA 1AJKA 2A6YA 4GXLA 2BTVC 2WSUA 4FPCA 5GALA 3WDYA 3VBSA 4DPNA 3VDDA 2CV6A 4K40A 2IFRA 5LK5A 2JDZA 3ZYPA 1ALYA 3B5LB 2G9FA 3KCXA 3WOGA 1RVF1 1W6QA 2A3WA 3I4IA 4D7YA 1DQ6A 1VBC3 3CJIC 1VALA 3E5XA 1AR91 5HBAA 1QJY3 4EWDA 3WW3A 3MI8A 4I02A 3LOBA 3VKOA 3SMHA 1O91A 3VBHC 2W0XA 2WNUA 3IBMA 3TBDA 2A71A 3CNAA 5EFUA 4HKLA 3AKRA 4Q0PA 1Q8OA 4DRRA 1QJU2 4B4QA 3MIDA 1RHI1 2JG8A 2WINB 3B7MA 1J58A 3Q9OA 4BLIA 1RMU1 3NV3A 3ASIA 4FAHA 4J1XA 4AI2A 1PGW2 2BWAA 1D4M2 5ACA2 4NVPA 4GALA 4A7ZA 2XUMA 2JG8B 1YXWA 4R8HA 1MQTA 1ZX5A 2FMDA 3DF0A 3HN1A 1WBLA 4DOUA 1I1EA 3OCPA 2WNUB 3WX5A 2WS91 1POV0 4YM1A 4HK9A 3WQ0A 4QPIC 3JBG3 1PNFA 5D8AC 2JXAA 4YARA 5JSOA 2VH9A 1CR7A 1EV11 1VR3A 1IPKA 4Z2WA 2BNMA 2MPFA 4A3XA 2D6OX 2LM3A 2RR12 2R073 2Z5WA 2ILMA 3GZAA 5JZGC 4XIKA 1H8TB 4H55A 2UYBA 4LBLA 3RG0A 1SBEA 2DUOA 4NOTA 2WQZC 1HDKA 2MEV3 3LZZA 1BBT1 1RUH2 2I74A 5JI7A 4URTA 4QQPA 2WWSA 4M00A 4COVA 1AYM2 1ND2A 3ES4A 2R0HA 1RUH1 4LBNA 3DPRC 4YM0A 4XIOA 2KXLA 4JRLA 1X8EA 3K51A 2UWCA 2ZAHA 2UY9A 5CAZA 1EAH3 2VVFA 4QGNA 5A33B 1BJQA 4ASMB 3PHMA 2WA4A 1PK6A 4M01A 2OYZA 5AC93 1R093 3WG4A 2E7QA 5FPZA 1C5HA 3E6DA 3ME2A 5JI9A 3AMQA 1N1SA 2ZX1A 2DUPA 4Q8KA 3ZSEA 4NHLA 3UJOA 1HX6A 4LE4A 1CD3G 3H50A 2TNFA 5GLTA 3NV2A 4ORFA 1F8VA 5BNOA 1JOJA 1WMFA 2ZKNA 2GALA 4NR1A 3S30A 5CFCC 1MS9A 4XILA 5A33A 2HEVF 4XQWA 4LHLA 2D6KA 4IV3B 4C1XA 2F6BA 3MIBA 5CG8A 2ZHKA 3ZXGA 3M3IA 5ABJA 1YI7A 5BYNA 2XJUA 1CONA 3ZXJA 4D69A 1XNCA 1PO12 4MYEA 3ZN4A 3AKQA 4WM8C 2QNKA 1X7NA 4AFAA 1XQNA 1S0BA 2XJVA 2JE9A 1AR82 1GLHA 1AYM1 1ND3B 3D82A 3FHIB 1EPZA 3O7OA 1WW5A 1XU1A 4HETA 2DU0A 3AP5A 1QH7A 4YM2A 1B35A 3D0JA 4ZXKA 1OLQA 1CJDA 2ZGKA 5FREA 1GQGA 2BNOA 4RHV2 2GNDA 1DQ5A 4AK3A 1RJ7A 5AC92 4BMBA 2WS93 1VBE2 3J9SA 3SXWA 4Y24A 3TYJA 5FDBA 4EJRA 1TE1B 1S2BA 1VAMA 4AHXA 4XFHA 2EXIA 3JCIA 5BNPC 2P3KA 3ZXAC 5JWPA 2WZR2 4Q0QA 2XLFA 1UPIA 1LCLA 2O1QA 2PHTA 4HN0A 3AYDA 5D8AA 1HV0A 1WW4A 4LLFA 4QMAA 3WD5A 1LHWA 4YZ2A 4UW3A 1D0GA 3JD71 2ZOEB 2VW2A 5JMCA 3AXEA 2Z79A 3IPVB 5GLWA 1IOAA 2WC2A 3BOWA 1WMEA 3ZMOA 2AGSA 5DXDA 4ASLA 2GN7A 4E4SA 4HKWA 2WFPA 2E63A 1K5MB 1LECA 4E2SA 1UKGA 4OUMA 1FV3A 1QHDA 3B01A 1BK1A 5F5QA 1QJX1 1NXMA 1RUG3 3AFGA 3GHNA 2QZ3A 4W6WA 4I2OA 3WHUA 1C8M1 3FBMA 4JGYC 2IXCA 2H6CA 3H1MA 5BXXA 2PELA 3PMEA 5C9AA 2PQQA 5KXCA 3OGGA 4FTBA 4L97A 4XXAA 1D4VB 4Z07A 1RUH3 1DZQA 1XNBA 1JYCA 1J3QA 4IERA 5T52A 1W6NA 3I8TA 2VPVA 4Q1RA 4WM7B 5FOBB 4BWOA 5IK8A 4QGLA 1HRI2 5BNNA 2BGCA 3I59A 2XVGA 3VHOA 4OFGA 2HWC3 5J98B 4MGKE 1GICA 5ABJC 1N3OA 1NA1A 4LULA 4LUMA 3NV1A 2WT1A 2RM23 3VZNA 1I9RA 1YYNA 2XG3A 4HSJA 1YNAA 1LGCA 1ZBA2 1MS0A 4TYSA 1MZFA 4UW5A 1H1IA 2YHJA 1BEV3 5BNQA 4FOQA 4LBOA 4I30A 5CIRA 5E1RA 3V65A 3HT2A 2HKXA 3WY6A 3ACLA 4DXZA 3WQ1A 1SLCA 3ZSKA 1DHKB 1WCKA 1LEMA 4XBNA 5KHGA 3W58A 1C8M3 4J6GA 1PZ7A 4Q4V1 1OFSA 5C9AB 1ZA4A 5C6CA 1I6XA 1RVF2 1ASJ1 1UX6A 1WLCA 2TBVA 3ZFEC 1AR92 4NWVA 1CX4A 2RS32 4KNCA 4AEDB 4AHWA 4P9GA 2IZWA 3GF6A 3MYXA 4BQ1A 4D94A 1Q5OA 1XYOA 2DCYA 2WNVB 3RMXA 3RSJA 1H1AA 2UU8A 3AK0A 4GMP3 3ZX7A 4ZKTB 1RUC3 4QPGB 3U11A 4TWTA 4P9WA 2HJIA 1YO8A 4GB32 2VOWA 2QKDA 1WA4A 4BE3A 1ENXA 3G6JB 3WP6A 4TZDA 2ZGOA 4FPYA 4EN9B 2B8MA 3ZYIB 3U10A 4FVVA 5C33A 3VBHA 1IZ3A 2Q0AA 4JTNA 3U0ZA 4CDUC 4X6RB 2A6XA 5BNPA 1AX2A 4HBNA 1BZWA 1I5ZA 2RM22 3RYRA 1BKZA 1R092 3ILFA 4LR4A 3D5OA 4JGZC 4PLOA 4Y5Z0 5C4WC 4RS5B 3UKNA 3VKLA 1RL3A 2DTWA 3RI8A 1CIWA 3MICA 1PVXA 4WVMA 5I0TA 1TNFA 3TN93 5CA6A 4F3JA 4AVSA 3IT8A 2K9ZA 4AVAA 1FAYA 3JQWA 4XDQA 4MXWA 4LTAA 2D3SA 2OA2A 4QU2A 4XQDA 4AXOA 1ZBA1 5GLVA 4K21A 3QD6A 5I8YA 1G86A 1JH5A 5JAXA 1KRIA 4BZ4A 2BFUS 2XJTA 2QCSB 4PIXA 1LU2A 2D6PA 4PF5A 3OYWA 1N47A 4QM8A 4EWAA 1AR83 1GFF2 3CL1A 4X8PA 4IV1B 3S0MA 1DQ1A 4CDQC 1EPWA 4YVSB 1K5MA 2DFCA 2PAKA 4GWNA 1AR62 3B94A 1F2NA 4HN1A 2D5HA 1UMZA 3SCHA 1NYWA 1Z7S3 1REFA 4RSUA 4LEJA 2Z69A 4LO6B 3ZFFA 2HWE3 1ONAA 3P3PA 2D97A 4C0BA 3AZWA 3FC0A 4MUVA 2CGPA 1VAKA 1KFXL 4AW7A 1AX0A 1NCRA 4XF3A 1N3QA 1OA2A 3E5UA 3KCYA 2CGNA 5KHIA 1QJU3 3M70A 5I0UA 1TME3 2VU9A 2HWD1 4AFDA 4KBBA 2WIIB 1ZRCA 4HK8A 1BEV1 3WT3A 2JENA 4XTMA 1O3QA 4SBVA 3ZN5A 2ZGMA 4HVOA 2RM21 1LGNA 2DTYA 1ND2B 2D40A 2ZX0A 4JDMA 2B39A 3CO2A 3MLKA 2YGLA 1Q8VA 2VOVA 1RUD3 5LEJA 1ZBE3 3IM0A 1C57A 1XNDA 4H14A 5IK4A 2E9QA 3O0VA 1ZRRA 4YVWA 3WVJA 1SBFA 1G9BA 1IHMA 3IPVA 1W6MB 1HRV1 3H3ZA 2HWB1 1YLLA 2WFF1 3AZXA 1H2NA 3ELNA 4JGZB 4AVBA 3UKVA 5BNOB 4LBQD 1RUJ3 2RS13 4U36A 2WJSA 1PVC3 2NMNA 2R1DA 4XMIA 5A32A 3AFKA 3ZYRA 1U12A 3NKTA 2EAKA 5J48A 1IKQA 1MQTC 1H4HA 2P34A 2WQ4A 3EJKA 4JDNA 4XYXA 2X5IB 1RUF2 3FLTA 1LOCA 3E5QA 2KM2A 4GKYA 1DFQA 5I8SA 3FLPA 1ZRDA 1KS4A 4UW4A 3HWJA 5CADA 2XJQA 1BXHA 2UWBA 2X29A 1RIRA 4NHMA 1OI6A 3A0NA 3ZXFA 3J8F2 4YZ1A 1XE7A 4ITCA 4KG8A 5JOWA 1LHVA 4HLTA 2WA3A 2R6QA 1CJPA 1FPN2 2A3XA 4XE9A 3O5SA 4L99A 5JIUA 3WW2A 1GNZA 1REEA 5CB7A 5LK7B 1G8WA 4AEDC 1RUC2 1MZ5A 4JGYA 4OVEA 4IEQA 4MZUA 4FPLA 4NHKA 5C9AC 4Y20A 2RR11 1Q8SA 4LE3A 5F9TA 4NPRA 1NE4A 4IEOA 4Q26A 1PGL2 3JUUA 3WDWA 4FBFA 3GZUC 5J09A 4YW3A 1NLSA 1KQRA 5CFCA 5JIAA 3LGRA 3IIAA 4L92A 4K1YA 2PA7A 3WUCA 2B7YA 4WZFA 4OI1A 5BNOC 2VVEA 1ZZ8A 3OBRA 4Q4Y2 4MXWB 4D3WA 4YZ4A 3C3VA 2D3RA 3BALA 1SFNA 2EXHA 4HPKA 2BBVA 5L36A 1UL9A 2R30A 2VW0A 3O14A 2UY8A 3ZXKA 2CY6A 4XW3A 3A0KA 1VAVA 2OZ6A 4HMZA 4AGVA 1NY71 4LBQB 2XVKA 3HR9A 4N7UA 3UKTA 5CG9A 1YHFA 4GQ7A 2IXHA 3WNXA 1MS1A 1DGLA 2AYHA 2MEV2 4Y1ZA 5T3NA 3ZMNA 4NN0A 3SH3A 2ZX2A 1LOGA 1NCQA 2FBEA 1CVNA 4WBBA 2R061 1QGLA 4GULA 3K48A 3RJRA 1X50A 1TMF2 3B9IA 3QOPA 3KM5A 2ZHMA 3M2MA 3KCCA 3CJXA 4QQLA 3U07A 1LJ7A 4XTPA 1LOFC 4PJYA 1POV1 1SEFA 1UD1A 1H9WA 1RUOA 3THTA 4YVWB 3MPPG 2ARBA 5T5PA 5T5OA 5FQ0A 3IDCB 3RYKA 5FOJB 3MW4A 3RRDA 1NQDA 4BLJA 1X82A 4CRQA 4OUSA 1CAVB 4RQPA 2YDEA 3KD4A 2YYOA 4RR3A 1F5FA 1O4YA 2D93A 1QJZA 4I09A 4S2FA 3WLUA 3ZFEA 3LSDA 5E89A 2VY0A 4DINB 5DZGA 4RS5A 5KWRA 1SMVA 5GZEA 1OMIA 5J37A 4R9CA 5FLJA 1O5UA 3ROUA 4HZFA 2Y0OA 1SCRA 1DBNA 1QKQA 1FPN3 1W6OA 1ULDA 1YFXA 3TRSB 2O0OA 2E6VA 1MVEA 1OOPB 2OZJA 1EYBA 3M4FA 3O0WA 3PJYA 4W65A 2P3IA 4XOGA 5E8AA 2WL1A 5J3UA 1VIWB 1W6PA 2RS51 4XETA 3JB8A 1ZVFA 3AXDA 3RZZA 5I93A 1EV13 4O9EA 1AYN2 1OQEA 2DVFA 4GA9A 5TSWA 1GV9A 2ATFA 1ENQA 1RUD2 2WFF2 2WT2A 1RUF3 5DDJ3 1AL21 2WT0A 4XMAA 1IS5A 1WW6A 3T1LA 1S0IA 3V64A 3AZZA 3KGZA 3WQ7A 3FE5A 2NN8A 1QY4A 3VKFC 4DMIA 1CAXA 2ZMNA 3EQEA 2R49A 2GC1A 4PLNA 1YJLA 2GNBA 5AC91 3AM2A 1C8NA 2DF7A 4FPKA 2HWD3 4X6QB 1TME2 4FPGA 4FO9A 1SCSA 2V73A 3TN91 4S2DA 4UXAA 4XJ9A 1FATA 1AZDA 4H7LA 2ZGNA 3ZFFC 1J59A 4QPGC 3MGUA 2QDNA 5FMOL 2DWRA 2DCKA 2A6ZA 4WVMB 4LNVA 3D0SA 1ENRA 3ECQA 1RHI2 1AR63 1QDOA 4AFBA 1NLRA 2RS33 4KU7A 4Q4Y1 3AYAA 5KHJA 4AI1A 1S0FA 3BOPA 3ZFEB 2RE9A 5DG1A 4RD7A 4FQ4A 2CL2A 3H1WA 4UW6A 3URFA 1X33A 4FTEA 3D4KA 4OHYA 3EHKA 1H4GA 5KC6A 1AUYA 1OOPC 4LO5B 3VBFB 4WVZA 5CFDB 2RS53 3A4UA 5DDJ2 1AJOA 3VBOC 4CDXA 3V0AB 4F8AA 3KB5A 5T55A 4OLLA 3THPA 3ZYGA 1LHOA 1AYN3 1V9U1 4A7YA 3ZO0B 5DUWA 4C90A 3SH5A 4KWLA 4XFCA 4I0AA 5EV7A 3ZN6B 3SNMA 4B7KA 1YFYA 2YC0A 3ZIWA 2BEOA 4LA2A 5ABJB 3L2HA 1QWRA 4DY3A 2G9GA 1PMIA 5KXEA 4L9BA 4IV3A 3MF9A 4EROA 4KH9A 3VBOB 3WG2A 2OUHA 5K8SA 3VBFC 2IXJA 3MZHA 4BM8A 5C8CB 3J4UH 4HT1T 5GM0A 1UCXA 1QQP2 1HXS1 1Q8QA 2R1BA 2Z2SB 3M7AA 2W52A 1BMV2 4HVRA 2LALA 1YRZA 2XLAA 4A7KA 4XF1A 3P3NA 4ATEA 4AI0A 3TWIA 2RMU2 1DQ4A 4YZ5A 4H7MA 4PBOA 1WD3A 1UU5A 1JHNA 1K5MC 5L7OC 4IEYA 2XBO2 3R4SA 1MEC3 5FQ0B 5T5JA 3LKJA 3CU7A 4L2NA 3FWEA 4R4ZA 1VBA2 3PMSA 3JD73 4CTEA 4FPEA 1CPMA 1C1FA 2W08A 4KGGA 1W2UA 2PHDA 1RUC1 3CJIB 4JVAA 5CFCB 4FT8A 5GZCA 2D6NA 3VLBB 2XVLA 2QJVA 4ISRA 1VBA1 2CYFA 1SLIA 1Q8PA 4FP2A 4FXGB 1AHSA 2WKKA 1VBC1 4Y20B 2R072 1MACA 3LB9A 1GZWA 5K7PA 3S7IA 5JSPA 3W59A 4XZPA 5AVAA 4FXKB 1J3RA 2R071 1PVC2 3WINE 1Y7BA 4CEWA 1VRH1 4A2UA 2ZX3A 3R6SA 1R1ZA 2AENA 3IN9A 3IDBB 2JX9A 3LA2A 5JLVA 4XBLA 3SLIA 1GYKA 5J7MA 3AKTA 5JOYA 2Q5TA 1Q43A 4L8QA 5JSRA 3N7LA 1XRUA 4Y1VA 2CWSA 1VBD2 3WR0A 4C0HA 4MGIE 2A7AA 1Q3EA 3DL3A 1XU2A 2ZGSA 1ND2C 2YGMA 1JYIA 1URXA 4XHBA 4Y22B 4C91A 1V6LA 5T5LA 3PVEA 2R042 3JBG2 3EBRA 4GKXA 4PIYA 4FPOB 1VBA3 2O8QA 4YYOA 4H3WA 2IXKA 3L2YA 1NA1C 4AGGA 1S55A 4J1WA 1MVQA 4YGBA 5LRRA 2JD4A 3N7JA 2W68A 4IV3C 3E6CC 1D0HA 3S7EA 1O4TA 2GH2A 3AKSA 3IDEA 4XJZA 1EY2A 2YPJA 4YW5A 2UWAA 1NCQC 1Y3TA 4JQRA 1QNWA 2VULA 3INAA 3MW3A 2RS31 1G7YA 5F6LB 1V70A 4YG0A 1OLRA 2CAUA 4TLFA 1D2QA 2P17A 4YG6A 4N7IA 4Z82A 1D4M1 5ACA1 4JCKA 5D1IA 2DCTA 2VOXA 3AP9A 4IV1C 4Q0UA 5BY5A 1V9U2 3HAGA 3I54A 2GC3A 4AVCA 1W0PA 3VZMA 1FOD1 3RDIA 1RUI2 4Y4YA 3AMNA 1YIFA 4YG3A 4FP3A 2VXRA 4OHZA 4QQOA 2XH6A 2XL9A 2LUWA 4R9AA 2VW1A 1PGW1 3VZJA 1AXKA 1PHMA 1ZBA3 3JU9A 1HQLA 2MNGA 1WLDA 2DVDA 3FX3A 3N7KA 5CU1A 4LBKA 1G9DA 2PTMA 3S6PA 5C4WA 1RTVA 4AQ6A 5L7OA 1VRH2 3BIWE 5GZFA 3ILNA 4AEKA 3ZXDA 4B4RA 4CDUA 1DG6A 4JV4A 5I8TA 3MIFA 2PHWA 1KS5A 2HYKA 5BV6A 2PHRA 2I07B 1U0AA 4P9IA 4R9DA 3LOIA 1WMDA 1H0BA 4META 4Q0VA 4INDA 3DKWA 2VECA 1NZCA 4WV8A 5DUUA 1S0EA 2GNMA 2OPKA 4EV0A 4BHPA 5JOZA 4CEWB 2ZPXA 1WCDJ 2NYYA 4QHBA 3MFAA 5HCFA 1V6IA 2BWCA 2PHUA 5JCTA 3ZDSA 1W6QB 1VRH3 1LOEA 4IEZA 2H6BA 1A8MA 2YXSA 5CFDA 4B4PA 4QQ2A 3WW4A 5B2GB 1VB2A 3FMGA 4B3NA 1HXS2 1LKNA 1QXJA 2VQ0A 5HCAA 1RUG2 4Q2FA 1Z7S1 1NG0A 1BYHA 4ISQA 1W39A 3AJYA 4CDQB 4W6XA 1IS3A 4ZU5A 2FHRA 2D43A 1SLBA 1IS4A 4I01A 2QE3A 3ZFGB 3FBYA 3DUIA 2EA7A 4E27A 1SDWA 1CAUB 1R1A1 3RYPA 1AX1A 5T50A 2C1FA 2WZR1 1DQ2A 2D44A 1O3TA 3H1YA 1W0OA 3VBRA 1VB4A 2IFWA 3ST7A 1S0DA 1FYUA 3PJQA 3SCFA 5JVVA 4IV1A 5HXVA 4B7EA 1S0CA 5SV5A 2P3JA 4D7SA 3LCPA 4Q0SA 4QPYA 2P37A 5T54A 2VMHA 4LUKA 3N7MA 4Q4W1 2DVBA 1PVC1 3HD8B 3NW4A 4WM8A 3AZYA 4RS5C 1PGSA 4BA6A 5KHKA 4QPGA 3KLSA 5EYYA 5A3LA 3OYWB 2ZA9A 2ZBJA 1LOBA 2DYCA 2XJSA 3G7DA 1DLLA 2DFBA 2E7TA 2WZPP 2XKPA 1DQ0A 1H2KA 2PFWA 1V6MA 4IQPA 4S2GA 4C1WA 3WZ1A 4YZ3A 4LO8A 2C9AA 5HCBA 1PO13 4WM7C 3VBFA 4CYDA 4ONUA 5KXDA 3NSTA 1MS3A 4WZCA 3RI9A 3VDDB 4E4ZA 1WD4A 4QT6A 3OY8A 4EN8B 3T2TA 4UBHA 1AYM3 3QACA 2XBO3 3UV9A 2P2KA 2HWE2 4XFFA 3R0RA 3E6BA 5IK7A 3AP7A 2WNVC 2ZMLA 1FI2A 1HIXA 4P9LA 1D4M3 5ACA3 2UYAA 4GB33 4RGAA 3ZSLA 2V09A 2HWE1 4WVWA 4PDWA 5FCCA 4YNIA 3RPQA 2F4PA 2ARXA 4OHXA 3RJ2X 3VHPA 1YUDA 4AYUA 1M4WA 3I7DA 5KHHA 3IMNA 4MGYE 4CEYA 4Q4V3 1COV2 4DNYA 3AKPA 4YVSC 4PLMA 2R063 2FZ2A 4M3CF 1OFNA 3LSEA 3QH7A 1EV12 2ZKLA 2XKOA 2PAEA 4XHXA 1UIKA 2D6LX 2QUOA 1R091 2NLRA 2DVAA 1AXZA 4LO7A 4N43A 1BEV2 4BH9A 1G9AA 4JDOA 1C4RA 2JG9A 4GWMA 4YLZA 1S0JA 1QH6A 2FQPA 2WS92 3PTYA 4FTSA 2GU9A 4AEDA 2BNNA 2ZZQA 5CFDC 4RGGA 5EYXA 4Y1XA 4IESA 1MR5A 4FOWA 2EXJA 1IGOA 3NJZA 4LLOA 3FLRA 3V0BA 3UJQA 1LODA 1VBE1 3ZVXA 2HWB3 1MS8A 4P9YA 1ND3C 1UN1A 1F9KA 5I91A 2EF6A 1HRI3 5KBFA 1CAWA 1VBB2 3KQRA 2H0VA 4WM8B 4AQTA 2R041 5C4WB 1BBT2 4YFWA 3GZTB 1SLLA 4JAAA 3O0XA 5EWSA 4DB5A 2B45X 2ZJCA 3PNAA 3TN92 2VMIA 2ZGRA 1QJY2 1BMV1 1PZ9A 2PAMA 2A3YA 1QJX3 4HPKB 1Z0HA 1XYPA 2HWC1 3MDPA 2AR6A 1POV3 2PLV2 2DCZA 2R0FA 3BODA 1FMD2 1XNKA 1GQHA 4XF0A 1W6NB 3H8UA 4CP1A 2AH2A 3GNEA 3OJBA 2Z42A 3GBWA 3POYA 3H9AA 3MEPA 5FPXA 1UU6A 3N3HA 3KS7A 5IT6A 2E51A 1DYKA 2YROA 1AR93 3DPRA 3NKGA 4V1PA 4QX5A 5KC5A 5DZFA 3J8F1 3UL2A 3B02A 1DU3D 1UU4A 2IC1A 2GAUA 1C8M2 2E53A 2QQPA 1KITA 3WXPA 2WLQA 4CDQA 1QF3A 1RMU2 1VBC2 2BFUL 4DZGA 4I0WB 1MZ6A 5JPMB 1NE6A 2ET7A 4AG4A 1WLTA 1BCXA 1RITA 5DDJ1 2XJRA 1YI9A 3M3OA 2NP0A 2UURA 2RMU3 3ZYJB 2X53S 4G9SB 1G9FA 2QDRA 2GC0A 2YZ4A 3VL8A 1WBFA 3EO6A 4Q4X2 1ZBE2 3D6EA 4Q4W2 1R082 1RUNA 2HWF1 4KGQA 4F83A 5GKAC 4XFAA 2VGDA 5A3MA 4XXPA 1PO11 1AXYA 3CF6E 1H30A 2EXKA 5CBLA 2PN5A 4DFSA 5FFOC 1H8TC 3AMHA 4XBQA 1YCIA 1PM7A 5A32B 3M3QA 1DDLA 1ND3A 4QGMA 4LT5A 1GANA 2R16A 1HV1A 4JGZA 3AZVA 3B3QE 1JTZX 3ETQA 4YVSA 3LWCA 4LBQA 5CVRA 4E4DX 3QH6A 4UBGA 3VZLA 3VBRB 3RNSA 2WNUC 4YW4A 2XPJA 2GMEA 4HSLA 4BCUA 1FNZA 3R05A 1COV3 3VBSB 4RHV3 1QJY1 2XLGA 1IS6A 4MGZE 1Z7S2 4JGYB 2B5HA 3VZOA 5KXBA 2OUJA 2PLV1 3HT1A 1KDMA 3V0AA 2O8OA 1O3SA 3VL9A 5GZGA 3TB0A 1ENSA 3VBUA 1ZZBA 2NQYA 3GHMA 4Q4X3 4K6BA 3SH4A 3DPRB 4G3YC 5H9SA 3VHRA 2BVBA 4LBMA 1RGSA 1A6CA 2ZGQA 1FOD2 4KL1A 1V6OA 1VP6A 3LA3A 2OW4A 3GBFA 4E9KA 5JDBA 2Q1MA 3RMYA 4XPVA 4YGDA 1UAIA 1YFWA 3BTAA 1I3HA 1REDA 2VOKA 3T1MA 1ZZCA 4L11A 3GBGA 1KD7A 2BW8A 5EXOA 2ETEA 4XFGA 4Y22A 2TUNA 2Y0IA 4RHV1 4RQPC 5C8CA 1VBB1 3LAGA 4AQ2A 4EN7B 3NAPA 5E16A 1E57A 4P9XA 1AR81 1SLAA 4FCAA 5F6KA 3WP4A 3UK9A 4QXKA 1H8TA 3ZPYA 2QVSB 1V6JA 1ZNPA 3BCWA 4Q4W3 4BYYA 3KSCA 2JG8C 4NO4A 3ZN6A 3FUOA 5L19A 2SBAA 2GMMA 3SHRA 4JC1A 1PO22 3E97A 1RC6A 5H9RA 3RS6A 4DS0A 2DVGA 4OHWA 3B69A 5FO7B