2AZMA

Crystal structure of the mdc1 brct repeat in complex with the histone tail of gamma-h2ax
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
193
structure length
193
Chain Sequence
TAPKVLFTGVVDARGERAVLALGGSLAGSAAEASHLVTDRIRRTVKFLCALGRGIPILSLDWLHQSRKAGFFLPPDEYVVTDPEQEKNFGFSLQDALSRARERRLLEGYEIYVTPGVQPPPPQMGEIISCCGGTYLPSMPRSYKPQRVVITCPQDFPHCSIPLRVGLPLLSPEFLLTGVLKQEAKPEAFVLSP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Mediator of DNA damage checkpoint protein 1
publication title MDC1 Directly Binds Phosphorylated Histone H2AX to Regulate Cellular Responses to DNA Double-Strand Breaks
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 58
structure length 193
sequence length 193
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-09-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10190 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold BRCT domain 2azmA01
3.40.50.10190 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold BRCT domain 2azmA02
1Z56C 2R1ZA 3L40A 2HTFA 4BMCA 3PC8A 2D8MA 2NTEA 4BU1A 4XQ0A 3T1NA 2COUA 1N5OX 2COKA 2XNKA 2ADOA 2K6GA 3COJA 3K0KA 4Y2GA 2EBWA 3OLCX 2ETXA 3KTFA 3PXBA 1JNXX 2WT8A 3I0MA 2COEA 3PA6A 1KZYC 2K7FA 2E2WA 3L41A 3UEOA 3K0HA 5ECGC 3T7IA 1IMOA 4IFIA 4XPZA 1L7BA 2EBUA 4U4AA 3L46A 4Y18A 1CDZA 3EF0A 2INGX 1L0BA 3SZMA 3K15A 1IN1A 4JLUA 3K05A 2M2IA 2VXCA 3FA2A 3SQDA 3HUEA 1OQAA 2LE0A 3II6X 3PXDA 2JW5A 4ID3A 3AL3A 3U3ZA 3EF1A 3HUFA 3QVGA 3PC8C 1T2UA 2L42A 4OFBA 3QVGB 1T15A 3PC6A 2EP8A 3UENA 2VXBA 1GZHB 1T29A 3I0NA 3SHVA 2AZMA 3PXCX 3AL2A 2XNHA 1WF6A 2DUNA 3PC7A 3PXAA 4N40A 4BU0A 3SHTA 3T7KA 3T7JA 4IGKA 1T2VA 3PXEA 1Y98A 3PD7A 4BMDA 3JVEA 3K16A
chains in the Genus database with same CATH superfamily
1GG8A 1CIVA 1GLNA 2IVFA 3HXLA 1YE3A 3OJLA 5BSRA 4RTPA 3JAWA 1S02A 3JQ6A 4MGZR 4Z4EA 3OIYA 1P1RA 4NFYA 4EENA 2CV0A 4NBUA 3PQ4A 2HU5A 3PNPA 1F8FA 1NP6A 3TLBA 3L4KA 1R3DA 1EUQA 1SM4A 3I01A 4WXHA 3T8YA 3VKHA 1QPGA 5EMKA 4A0FA 3OESA 1K9SA 1SZCA 4FYPA 4PZYA 4A5SA 2OBXA 1ZXLA 2JLYA 16PKA 3WICA 5EESA 5IJZA 1E3DA 4E13A 1X1RA 4F9FA 4WBXC 2Q5JA 2H2HA 2P2DA 1PNQA 3JQ8A 1Y3AA 2Y1GA 3GQVA 3NWPA 1X38A 1DFHA 1YZNA 3ZLTA 5HTOA 3KYIB 1DADA 4YRJA 4E2FA 2IY8A 4OLAA 1P0QA 3PHBE 4TRNA 1AA9A 3HXTA 3PDJA 5I4KA 2WLSA 4O2AF 3R0ZA 4HAWA 4MK4A 3G5AA 3KAJA 4REQA 4MW7A 3VDNB 2I6QA 3FFAA 4JZYA 1X7WB 2XOKA 4YQYA 1CUVA 5KYTA 3GVHA 3OE5A 4P6VF 2E7ZA 1EXMA 2PKWA 1KSFX 1Y7IA 2YW2A 4HI0E 4RPGA 5T64A 1GPYA 3WLSA 2XYGA 1TE2A 2W2LA 3PFNA 1XJCA 3WNDA 4R8RA 1GDDA 1TD1A 4PZDA 4F56A 1XLVA 5KWSA 3Q15C 2GF9A 4K8OA 3SLGA 2EC5A 4HGPA 1I6MA 3KKOA 2IDZA 2NADA 4GE3A 3CN9A 4UVGA 3GC6A 5TJ9A 3IOMA 1U80A 4U39A 2BI7A 3DF9A 1N1GA 3F74A 2NVUB 3M9LA 3ZPXA 1K63A 3USES 3NWOA 2WABA 4BLOA 4N7RA 2PMDA 3OZVA 5IFLA 1A9RA 1XL1A 2IS2A 4R54A 1QTQA 3U49A 1R8JA 3WLFA 1XCPA 1XYVA 4EL5A 2H4WA 1H0SA 3DLIA 3OAAD 4GDMA 4LE2A 2XUFA 3IVMA 4DLYA 4E7PA 1RWOA 2XJ4A 2OA0A 4XH9B 2TMDA 3TLGA 3K4HA 3KOYA 3CGWA 3DA8A 5F3RA 4ZVTA 3SC4A 4CT5A 3WLJA 5AVQA 1Y1TA 3L0SA 3CW9A 1P29A 3CVYA 2C1EA 3HNPA 5CIYA 1JQ5A 4ILEA 5C7LO 1PWXA 1U1EA 3A37A 1FNBA 4AVYA 3BGVA 1I01A 3EPPA 3PXXA 4A0SA 4ZVPA 1VHDA 4DTCA 1QHEA 1OLOA 5FV4A 3FJYA 1MVOA 2JFVA 4FYYA 2GM9A 1W59A 2W2KA 1BW9B 1IVYA 1JAZA 2M9MA 2Z09A 1F0PA 3GRPA 4QBIA 4TUYF 5DV9A 1PBTA 2CJFA 2CVHA 2OYSA 2FA9A 1B76A 1GTZA 1SQ0A 2B6NA 3I2KA 4I81A 1CB0A 3C6QA 1EFRD 2IZ6A 4UOQA 3VKUA 2JFPA 2OM6A 2PPLA 3A1DA 4CM4B 4GLOA 4B48A 1YOVA 3V8NA 4BVGA 2DUNA 4N40A 5GOZA 2IXEA 2QR5A 4OHMA 4BAGA 3ZNQA 1W5FA 3BWBA 3U17A 2WB4A 3DDSA 4JGBA 4CCAA 3I73A 3EMKA 2AN9A 4XM2A 3CW2A 3U4HA 1HDYA 2BMJA 4ECEA 1ZR4A 5EJ6A 3AERB 3L05A 4UDNA 4X3PA 5JWHA 3RB8A 4D43A 5K0ZA 1BKYA 5AKKA 1VMEA 5IHXA 2J4DA 2ZQ5A 3ETNA 4OU5A 1PF7E 2G6BA 3KXKA 4KPUB 5H80A 4UFNA 5E4TA 2G5CA 1N6KA 3O9VA 3UN1A 4FKBA 3KB8A 3WMFA 4ZT7A 5K09A 5AK5A 2GBCA 3WBBA 5E7IA 4XYLA 1FS5A 3S2UA 2G9ZA 4K9LA 5LD2C 4MWZA 1IE3A 3LA8A 4HTFA 4MRRA 1KDZA 2WVHA 5FHQA 2B8WA 5DGCA 2X6QA 3RJMA 3ZE8A 1TAGA 1S96A 1Y1PA 2YQZA 3FKSA 3Q98A 1CG6A 2VBCA 3E3NA 4GOND 5KTKA 5IAJA 2X1VA 4FCCA 3RVQA 2ODBA 4ZU1X 3AJ8A 3BCSA 3PQDA 5CW1A 5CM9C 4MUHA 4IUBS 2Y3IA 4UDYX 1O6FA 4PQEA 4REOA 3IODA 4M1OA 2H1OA 3I62A 3WMEA 4I6GA 1W9HA 3IGFA 4KN8A 4OHFA 2XE4A 4HWGA 5I9BA 1QF6A 1KZYC 2C92A 4ZCRA 3E1GA 2O19A 2DOKA 3MWFA 5JAOA 4L6IA 2H2IA 4UE6A 3T52A 1RLIA 3WHKA 4B81A 5FI0B 4O29A 3K73O 5F1YA 3ER6A 3OP1A 5EJGA 1FNNA 2EBUA 2NTVA 1PLLA 1RAFA 2HU7A 1ZIPA 2A92A 1LTQA 3JQAD 3KJQA 4H6VA 5J4YA 2I2CA 1CRZA 2IOFK 2NUAA 3KVOA 1P3Y1 2G4VA 1JLRA 2P3QA 1K08A 2TMYA 3FGNA 2BZGA 3MCWA 3E27A 3LO5A 3QP9A 4FVTA 3G13A 4G36A 4OXYA 3A8TA 3D64A 4R2MA 4A8TA 4JK3A 4RKYA 4D3SA 3HYLA 4DGQA 4PR0A 1X77A 3GARA 1VJTA 3SZMA 4LXHA 4MKHA 1P2TA 2IPNA 3NEPX 3MWGA 5C3UA 5K6AC 1R6XA 4PPNA 3DVQX 1V25A 3SF0A 2IOQA 1BO6A 3E7XA 3F3YA 3HDTA 1OTYA 3QJGA 4MUGA 4NAUA 5AJYA 5ELMA 2JGRA 1ZBDA 2R97A 4Z4CA 4TSKA 2VDWB 2A3NA 1LDGA 1B8UA 1DIRA 2V59A 2NO4A 3CT6A 2W2VA 2LE0A 3FIJA 4HAUA 3FRHA 2PS0A 3NRCA 4V0NA 1CETA 4XWTA 2ZYGA 5IPFA 4DB2A 3OO0A 4L7QA 4P54A 2L42A 2ZE7A 3EGCA 3F2IA 4LSGA 1A72A 3NHJA 2HBZA 5EWLA 5DMXA 3J7AC 3QLEA 3JVDA 3PFIA 3HGMA 4IP0A 5A7HA 2QV7A 1OPRA 2XUOA 3THWA 1SC3A 2R8OA 3A36A 4ZCLA 1L4YA 3VU9B 2WFZA 4UMDA 4B9AA 1XKXA 2GR9A 1PR1A 5IZ4A 3SFVA 3NJ8A 5LC1A 4RY2A 3S1LA 2HM7A 3B5JA 4S35A 3UJBA 3GVIA 3R8CA 3WE7A 2RB4A 4NFHA 5JJCA 1P75A 3T3NA 4Z6KA 3RRMA 3W7VA 3PC2A 4BNDA 5DHUA 1TW2A 4EVIA 3ZD9A 3A3NA 3JQGB 3ZVMA 1A50B 3U56A 1U31A 3BERA 3KQWA 3NASA 4GICA 2PAFA 3CLHA 1GIAA 2XEXA 3NQ41 1XVAA 3VNQA 3CPSA 4K88A 3MBKA 1ULHA 3IEUA 5I7RA 4DLVA 3CO0S 1TZ2A 4HNSA 4CXMA 4KQ1A 4HRVA 2XSZA 1ZNXA 3ADOA 3UB2A 1SC4A 4YRMA 4EGFA 2ZSFA 3SYLA 1QGZA 4ZC1A 1NUTA 1C7FA 2C2OA 3IDZA 4F85A 1F2UA 3SZRA 4E22A 4OH1A 2YWBA 1IBRA 2XWQA 3G59A 5LA6B 2UYQA 4B3MB 2DJIA 1L7PA 1MENA 3HO6A 3SWWA 1Q1AA 1SVWA 3OEYA 3W6ZA 2F55A 4EABA 4B47A 3O7MA 3CPEA 1H4QA 1QKKA 1RHKA 1K7SN 3BFJA 4QYWA 2GK7A 3O6VA 4KW7A 4FE4A 4FUTA 4NVRA 2SHKA 1EFAA 1UC4B 3E53A 4IF4A 3NLLA 1F7VA 4NOKA 5G2OA 2VHEA 1GZUA 1YL6A 3E0XA 1TUEA 5JE8A 3N0RA 3CMCO 1XWFA 2GF0A 1FFGA 1VJCA 4FMDB 1JJAA 5EEGA 4EUSA 1XLWA 1T10A 2V9PA 5BR4A 4R1TA 1OVMA 3DPUA 3RRJA 2PJUA 3VBEA 3GT0A 3RC9A 2OGZA 1VBKA 3HQ4O 1MMFB 2Y2UA 3R7NA 4D4IA 1M1YB 1CQZA 1NP7A 2E2WA 1XTRA 3AKCA 1U9IA 2OY0A 5BUZA 3CRVA 1UXOA 1X8JA 1LZKA 2WPDD 4J0QA 5CVCA 2C5HA 4KPEC 2VPXA 1USGA 1Z6AA 2QTNA 3OG9A 4IFIA 4PX2A 5HTKA 3ZHVA 1QP0A 1L4HA 1KA9H 2V0GA 2OZVA 5JI3E 1SZPA 3NP7A 4O4HB 1TRKA 4NS4A 3S99A 3EBPA 3C5CA 5KYWB 4EY5A 4N0PA 1PJRA 4HPWA 2B8JA 2V7BA 3WYAA 5I8WA 4AJPA 1JR4A 5BN5A 1YTUA 2ZB3A 4G5YA 4I08A 4AD8A 2X58A 1FFYA 4MGIR 3H2JA 2FG5A 4M7RA 1V7QA 3HC7A 2A1IA 3KEOA 3CLUD 3TK1A 3TEMA 5L9AA 4O8CA 3HK2A 1UH5A 2OO5A 4YAGA 3RAEC 4G23A 4Q4JA 1YONA 2CE7A 1CUZA 4CIXA 4DL9A 3KKLA 3CT4A 4TLCA 3CF4A 5LXTF 2PT7A 1M6VA 3IJEB 4PS1A 3EEOA 4J03A 1A77A 1VE6A 2PRJA 4FMCF 5GJVC 3WKCA 4COKA 3V7YA 2EG9A 2LZ0A 3D7MA 4QT4A 1P4HA 4BV8A 1RQXA 2CFRA 1IFXA 2B8EA 3T41A 3LYUA 1ZUWA 3D3NA 4DMCA 3K71B 1OW3B 3KXIA 2E82A 1S4QA 2JJ2D 3MA0A 2PJZA 1PEDA 4CM9D 2O4CA 4NECA 1PZFA 4J94A 4TZ0A 3JYQA 3FRJA 3O2SB 1SAYA 4NCIA 3ZE6A 1PJBA 2Z08A 4P81A 1XG5A 1J00A 3OT4A 2O5RA 5DP1A 2Q41A 1DQSA 4YMSA 4ALJA 3P2IA 1IM2A 4HUJA 3MK31 5DLQC 8ATCA 1IY0A 2EARA 5ALDA 4O2BF 2EX1A 3CG0A 4CMKA 5I3CA 4CLXA 1LWOA 1QRSA 1K3FA 4BJ5A 2O2YA 4YJGA 3MGBA 3SHVA 1AC5A 3JQ9C 3EZFA 3QPAA 5CB4A 4NNPA 1XQYA 3GEMA 1W75A 1SU8A 5GGXA 3GA0A 1ODLA 3SYTA 3TMYA 2UUCB 3IQGX 4K3VA 3DZIA 5AUQA 3FYHA 3G2NA 2H29A 3LKVA 3MTBA 4J0KA 3TLAA 3VC7A 2B6HA 2ZB4A 1XZPA 2JIZA 2X8JA 3OTQA 4OHWA 4WFQA 5DWVA 4ZOLF 4NBWA 2ILTA 5C4MA 2DR2A 1K8ZB 1ZVQA 2PL9A 3GFQA 1YS9A 3DHYA 2DE0X 2UVPA 1YASA 4FSDA 2P75A 4KE7A 1KJIA 2HSDA 3GFOA 4MB2A 4PYJA 5C8YB 3FTQA 2BSXA 3AR7A 4DMRA 5ALJA 5ALTA 1TZJA 1UXGA 5AW3A 1HG1A 1UDCA 1ZR2A 2X8LA 1OH5A 1XZQA 4IEFB 1HLGA 3IEVA 2NTNA 4TXLA 4WCDA 4WNAB 3A6EA 1JMVA 2J5KA 2BDUA 3PC8A 1NSTA 4L5JA 2PU5A 1U7UA 4IGFA 4JODA 5LBTA 3WOHA 5HJ7A 4YR9A 2Q3JA 2HLHA 4UM5A 3TD6A 5T3YA 2AVDA 3ZCTA 2PL3A 4BNIA 1KOJA 3GJXC 1PFYA 1Q0RA 2DR3A 2RHWA 3DS8A 3WAKA 2BH2A 2ZYAA 3JQRA 2X5XA 2O54A 3ZNNA 3BWVA 1UOOA 2R7NA 1T8SA 2FZWA 1NG9A 3TGPA 2H2FA 2FZGA 3VISA 3Q3CA 1U94A 4Z9YA 3KTFA 4Z49A 5H81A 2XYVA 4CETA 1KAMA 3U60B 2UU9B 3EY4A 4MQFB 3L1HA 1TJ4A 3TSCA 4BLWA 3T06B 3W6UA 3FDZA 1QU2A 3BTSA 1GQ2A 1Q7CA 4NICA 5B3LA 1S3FA 4L8WB 4NENB 1RWBA 2X0JA 2HUNA 3WLMA 4JOQA 1TMYA 3W6NA 1ZG3A 4XM0A 3T61A 3T0FA 5BORA 4U7DA 4G5OA 2XCSB 3CA8A 1SVIA 4N5NA 1WDMA 3GD5A 3QXHA 3ZDBA 3PYMA 2ZTUA 4EA6A 1JDTA 2YV2A 3L7LA 3EQ7A 1WW8A 2D1RA 5ITSA 3JQ7B 2IW3A 4RMNA 1IY9A 2XB6A 4YIHA 5F12A 4WBNA 3EW9A 3AEUA 3IOCA 4H31A 1UODA 5I7OA 4OX9Y 2CFSA 1U6JA 2AOTA 3M81A 1L7OA 4LJAA 1K5DA 4RABA 3CX4A 1PUJA 3QIVA 3E9ZA 4HDOB 3U7HB 4GS5A 3L8FA 2W0SA 2C9ZA 3E9NA 5I5GA 1DOHA 1OWOA 5CD1A 5FDFA 1O95D 2Q1TA 3AUUA 2AXPA 3EASA 3GEBA 1GGVA 3QTLA 4G5QA 1WHTB 4Q66C 4V03A 1XEFA 2BFNA 5DLYA 3HGQA 3GCXA 3IPAA 4N9WA 2IA5A 4HEA6 2XMPA 1ORVA 1EFVB 1IBCA 4ZIRB 5FNVB 5THKA 3VR4H 3WQBA 3IV7A 2ABWA 2KSQA 4JLKA 4AJJA 3OZDA 3G23A 3OTGA 1QNFA 3BWCA 4L76A 3B2NA 3DO8A 1U2DA 4IDPA 2D2IA 3NHUA 3TQIA 5E9JA 1AE1A 2CY0A 1U5BB 3ES9A 1LPBB 1ZAKA 3ELDA 2AZTA 1VB3A 2HCRA 2VXYA 2CMHA 5EE1A 2Q29A 3ZG6A 1OD6A 2BKAA 3N6VA 3TG2A 5DISB 4CDRA 4DYVA 4QO8A 2IPMA 3SEAA 1BVUA 1G63A 1IQUA 3N2LA 4B80A 2L17A 1E66A 1C1DB 4HF7A 3SK0A 3PT9A 2QM7A 5J5AA 4BQSA 3WDLA 1P9WA 3QXCA 5AICA 1EM8B 1TEVA 1OLXB 5A0TA 4LF4B 1V9SA 3R3YA 5T4HA 4C4ZA 1AV6A 4MICA 3T6KA 4MQEA 3BSSA 4OGFA 1U1CA 2BT4A 2VF4X 4Q82A 3SJCA 3RODA 2VTDA 4HDCA 4YC7A 1VBNA 2AEJA 1DP4A 1WDWB 2WYHA 2WD7A 3DTVA 5JY6A 1XTSA 3NHYA 1JF8A 2G0AA 5B3AA 4UE2A 2W8BA 1EEHA 2AEFA 1IZ9A 4GWLA 3TRHA 3IIKA 2GHRA 1B2RA 3HKCA 2DQZA 4WY2A 4CKWB 4ZVUA 5ITZB 3NNNA 4Z53A 3I61A 4I1YA 5EINA 1A4XA 3RUHA 1K98A 3NDIA 3NBFA 4KL8S 4Q9DA 1I7SB 1UP4A 2DQKA 3HXMA 3ADPA 2NTEA 1M1YE 2OV8A 3PHLA 4UTVA 2NZUG 2JHAA 4EY7A 1NL3A 3GELA 3OJWA 2IHTA 3KUDA 1OI3A 5KINB 3GFSA 3TXXA 3UWPA 1XP5A 3Q2OA 2IZZA 3UFBA 3N28A 2XZDA 5IVHA 2NPOA 2FEMA 2FMXA 2X8AA 1E1NA 1ACJA 1PZEA 2KM1A 2E5WA 2WHXA 2Y1KA 3HBAA 4H9GA 4RVSA 4CI9A 3EZ6A 3C15C 4JL6A 3WXBA 3WGLA 4OH7A 2NSDA 1CS0A 3TE6A 4DMGA 2PKRA 4KIJA 1YRWA 5LNK1 1WXWA 1E2DA 2HZBA 4NCXA 2O8CA 1GKKA 4TQ9A 3ZY6A 4DLRA 5TQ2B 4GVLA 1D4OA 3E9RA 1U3DA 2QQEA 1G5HA 3UHJA 3IR6A 1OYYA 4EWLA 5DRYA 3GRCA 4Z4FA 2XEDA 3BMCA 3HU5A 3W5HA 2HSEA 3DAYA 3VZQA 2WM8A 4IR7A 2BCJQ 1JJ7A 3DUFB 3LF2A 4FGWA 4CM6A 1SKUA 1XDZA 3H18A 4IIJA 2VDUE 3TIXB 3A4VA 1H8HD 1RI2A 3KS9A 5HKAA 4O4JA 1P1CA 3B1WA 1QHYA 1E3EA 4IRXA 3KIPA 2QD1A 421PA 4HAIA 1XZIA 4RD1A 2QG6A 2OB1A 2BGJA 1E2LA 1PW5A 1CFZA 4P3YA 1V2HE 4W8HA 4IDNA 2PIAA 4WZBE 4CM8A 1A0OA 1D2EA 3FCCA 4KQWA 4EA7A 3UT0A 1V39A 5A9SA 4AF6A 2QJRA 3DJFA 2XUPA 3LDAA 1H2FA 2YR0A 1OQAA 1W4BA 3P32A 3U3KA 2REQB 2YDXA 4WK0B 3P9XA 1ODJA 3R9WA 2JFHA 3F98A 4ZDKA 1GILA 7REQB 5KHOC 5BR1A 3T5GA 2VRCD 3RFFA 1BEZA 3HCCA 3HVJA 3CF0A 3KEQA 1PGQA 4TWBA 3MMSA 3ZHYA 4O1MA 3R7SA 3LUJA 1C3EA 3DLAA 4ETNA 1U7DA 2IC5A 3P2KA 4LTDA 5AXCA 4WZAB 4R8KA 4Y67A 2XMSA 2FKAA 3GLTA 4B6FA 3KQLA 2PH3A 4WADA 1E9BA 2JAHA 4OP2A 3UGKA 2BGWA 1SC6A 2SKDA 1E7QA 3EGXA 3U7GA 2R6AA 1T8WA 1YC2A 2OLJA 3FLMA 5FQNA 4H18A 5HF6A 5IVPA 1XDWA 5E6RA 1VBMA 3UV6A 2D74A 3PEFA 1A82A 1T5IA 5FORA 5BRJA 3VO1A 1GPLA 2XXBA 3DTYA 5F7JA 4DAEA 1UEXC 5ALIA 2RH5A 5GAJA 3ETHA 4QSHA 2VPTA 4IWNA 3ELWA 4BMDA 2FUKA 1U99A 3NOXA 4LZWA 1MLDA 1W0JD 1XZLA 5KTNA 3PGVA 3NR2A 4J0JA 1BRTA 1E2NA 3HCRA 1CIJA 2GFQA 3V1UA 3K4QA 2V6FA 4M1QA 5DRTA 4JH0A 4DKJA 1P72A 4KX5A 4DYDA 4BMCA 1EVEA 1XAIA 2AMJA 1T4BA 2HJ9A 3ONVA 2WSYB 3ZBQA 4D8TA 1ZRHA 3NUGA 4HEHA 2JVJA 4TTQA 3RS2A 4A91A 3DCNA 1KI1A 2WZQA 1W87A 2HSZA 1IUNA 1CVIA 1KI8A 1NU8A 2PSHA 2RGUA 3P19A 3KTAB 2HA7A 3PRKE 1HDOA 3SFZA 1XF1A 5DT2A 5E6UA 1NOJA 5AJTA 2O7VA 3ZXSA 1OHHD 4JJ7A 2ODAA 4I3GA 4L02A 4FCTA 4GHWA 1DBQA 4M7WA 4BLVA 1KNQA 1BXRB 4KVAA 3VKFA 4AP5A 4B32A 1YJCA 2NUBA 1EQUA 2C1XA 3F6SA 3LY5A 2VTVA 4JY7A 4D46A 4EQZA 5AKIA 1ADFA 3QYAA 1U3VA 3DT6A 4YPOA 3SQMA 4RWZA 2FB9A 4FE7A 4PF1A 3DTNA 5DSZA 3U7EB 3QFTA 5JQGF 2M1ZA 3VYUB 1ODTC 3D3WB 3LPNA 1HE4A 4TTTS 1IAQA 3PJFA 2HV8A 2CJPA 2XUJA 2YIDA 3C3BA 2Z8XA 4FWIB 3RBXA 4EVSA 4ZK6A 4LRUA 1OZ0A 4JLNA 1LLDA 3OMWA 3M6UA 4XQ9A 3ZWVA 4BLQA 5CITA 1GG9A 1R9GA 3HZOA 1FQJA 2I3GA 3O4JA 3U3RA 2BI4A 2WU8A 3H4IA 2QP9X 3GFPA 4NEGA 5ALRA 2GBGA 1Z0IA 3JXEA 4LRQA 1KBQA 1FSSA 1PJCA 2YHBA 4M7OA 4JI5B 2VSOA 3UKJA 4BEJA 1I7QB 3KBBA 5HKOA 1UDWA 5KO2A 1U9CA 1GPDG 5KNBH 1WCV1 4BE4A 3F7MA 2OZLB 4RHXA 3C1AA 1SUCA 2HBYA 5J2UF 5K3FB 3KTOA 3Q3HA 4OHZA 1YB6A 1G6HA 5B57C 3IVCA 4DJEC 1YRLA 2CHVA 5KOYA 5DCWA 4HEJA 1TUBB 1ZUIA 2A5DA 1QS0B 4IDFA 4MA4A 1QIHA 3Q7PA 3I83A 1GZDA 1ZM4A 3HPRA 1IM5A 2I76A 1TCAA 3AV0B 3WHIA 4DSAA 3NW9A 3T7AA 4PSVA 4QPZA 1TO6A 4AL4A 4BFUA 2ZWAA 2ST1A 3N76A 2C20A 2GEUA 2VDLB 3BCHA 1N2IA 4DZRA 1XMVA 4Y1EA 1KHTA 3VR3A 3F6PA 3OIWA 2HWKA 2P4EA 3OF5A 4I4TF 2J7PD 3RLIA 1TGVA 4MUFA 2FFHA 4LHEA 1T36B 4H77A 1O97D 4PAOA 5DHFA 3QFRA 3O95A 3RV3A 2VYVD 2B7BA 5HUJA 5EMHA 1F48A 2D7CA 1PV1A 2ZR8A 4F2HA 2XRZA 1CQXA 4Y2RA 3C3MA 2B9EA 2ZBEA 4R1LA 5C80A 3DFIA 3OLZA 4GX2A 1MXFA 1CF4A 1SKQA 1XQ9A 1W34A 2XUIA 3P2JA 1VPWA 2VVTA 3FYCA 5JJIA 2X23A 5KTTA 1IN8A 5DCLA 5EE9A 1EESA 4J4TA 4X8HA 5AVRA 1T35A 5FFNA 2YYYA 1VHTA 1ZI6A 3MCZA 2JLVA 1M34B 2P7IA 2YWGA 2F3UA 3A7DA 4XLLA 4YJ3F 3FYUA 2PQ2A 2ODPA 3PX2A 3CUVA 4C0HA 3L7BA 2PH7A 3BFPA 5FBRB 5KVAA 2QSYA 1JYEA 3L5KA 3PUIA 1K7CA 3MLEA 3JQBC 3B2QA 4HMPA 3SX0A 5T8KC 4D1YA 3HVRA 1D0SA 2IYSA 4MI9A 4DIBA 2PUCA 3ZKWB 2WC1A 1CCWA 1XRQA 5DN6D 1OCEA 4BY9E 1L4EA 1NXQA 2PE5A 2QRZA 4RGYA 1EFDN 1RS0A 1EG2A 3LKZA 4H3SA 4KXWA 3TZBA 4YRKA 4KAFA 2P77A 2QZSA 2Y1XA 2PMBA 2O8DB 4FS8A 1O9GA 4Y2UA 1QSGA 4BCBA 4UATA 2OFOA 1P7WA 3KQQA 5IK2D 2G17A 4KG7A 4ZYTA 3R5SA 5KYYA 2Y0DA 4P7KA 4HWPA 1Y3BE 5LUAA 1ZGZA 4X7RA 3UMSA 5GVRA 3EEQA 1MN6A 2C88A 4IMRA 5FI5A 3VR4D 4OQNA 3UAGA 4JV5B 1LQ2A 4GVXA 3QEBZ 4L22A 1KVTA 1A27A 1SQGA 1QZTA 4X1YB 4W9MC 2AQKA 3NATA 4M6WB 3KQHA 5ALMA 2BKEA 4RF3A 1X86B 3OOYA 3UUWA 5IM5A 4DCMA 5D3QA 2H7VA 2UZ1B 3AUTA 721PA 4G0MA 4IIHA 1QCCA 5HMLA 4Z1OA 3KETA 1I6KA 3HKBA 1FSPA 3JWIA 4MRMB 4PTZA 1PK8A 2JI8A 3P9SA 4UD6A 3GT4A 2EW1A 3DL4A 3PENA 4RFVA 3ZW8A 2DCUA 1CU1A 1JAYA 1W5AA 3MTIA 3COVA 3D4IA 4QT0A 4Z7NB 2OBNA 3FYDA 3HYRA 3QX8A 1E63A 1G2PA 2G25A 1P0MA 4QGGA 5I47A 4J2HA 1Z0SA 3WGHA 2YJZA 4B1FA 2QNBA 4YRSA 1RCTE 1ZH6A 2VXCA 1LS1A 2FZEA 2LUOA 3ZD6A 1WKBA 1JDUA 1JT2A 1R1DA 4EG1A 3ZWBA 4CL0A 5KX5B 3ZDFA 2XYHA 2A9QA 3LE8A 2GCOB 1SCKA 1TXGA 1V5EA 3QVGA 1U2GC 3ZWNA 1N6OA 2CUTA 1Q77A 3KLMX 4DCUA 1YFJA 2J3IA 2ZJFA 4LHYA 1QZZA 4HZGA 3X0DA 1W4ZA 2VBGA 3DMDA 3ETLA 3OM0A 1VMAA 1GYQA 5I9TA 2IBMA 5EPEA 1POWA 3TW8A 1QGYA 1MORA 1I1NA 3HFSA 4PC6A 4DMUB 1V6AA 4ENTA 5CJPA 3F5QA 3AHDA 2EWMA 5KYNA 1BU8A 4G25A 4YLGA 5B1HA 5E9QA 3LTNC 1RRMA 5ADWA 4K1LA 1SXQA 4CM5A 1QV6A 4EIWA 1JRLA 1XMJA 1OI4A 4XX1A 1SVOA 2AFIE 2Q7OE 2D2EA 3O74A 2NUTB 3H1FA 4XQEA 4IYRA 2W70A 2O8NA 2W90A 4OU4A 2BMDA 4BBJA 5K0BA 2JGDA 4B76A 2QUJA 5FL3A 2FPUA 2AG8A 3BDVA 1UZUA 2IL1A 1Y7PA 2DBQA 4NAHA 2I4LA 3PQ6A 5EZ5A 1T6NA 1HDGO 1UKEA 1W4LA 1SG9A 1WZIA 2J9RA 4ROTA 3TW4A 3K31A 2G1AA 3MD9A 4KK4A 3WWZA 3KUXA 4TUYA 1JBQA 3QPBA 4YYEA 1YF3A 2CXRA 3GUUA 2DPGA 5AVUA 4TMXA 3V00A 1XCJA 3A4TA 4LY9A 1QHHA 1Z37A 5AI5A 3V4FA 1E1QA 5KTYA 3L7JA 2G72A 1Z5PA 3OICA 5HCUA 3ZDQA 1V8FA 3LLSA 4MITA 1S2LA 1DCMA 2IDKA 1ZOLA 1LV8A 5K4AA 1MPTA 1K5PA 4PLTA 1POXA 4JBNA 2XODA 4M99A 3EXEA 1USWA 2V6GA 1BH6A 3GRRA 1GUAA 4J3JA 4IJQA 4CG0A 3H0EA 1WKVA 1U28A 4R2HA 1GVNB 5DGIA 1J0CA 1F3OA 4B3HA 2YOHA 1KJNA 3PQCA 2VJOA 5B53A 1SUDA 1WZCA 3BN3A 3IR7A 2HSJA 1TZKA 5BSTA 4EJMA 5SY6A 4PLCA 3D4BA 2XGJA 4AAYA 1EGQA 1QIMA 1S2OA 3BE6A 4ISBA 4K6HA 2HV9A 2HB6A 4EGSA 1Y81A 3HSKA 4TGLA 3B6ZA 1JQLB 3DXXA 5C1PA 3DOEA 1JILA 4LHWA 5JNVA 1W1WA 3LUBA 1HT3A 1V5GA 3RGGA 4BC0A 2ID8A 4TKLA 4TLEA 1TEHA 1GUDA 5CT8A 3DMFA 2P9JA 1XVIA 1IRXA 4OLBA 2OCDA 1P6UA 4K9KA 4EZBA 3MJ4A 5C51B 1H2RS 1H69A 2QAGB 3IDSA 2GK4A 3DKIA 3NHWA 2ZSJA 1QDLB 2DBRA 3EUWA 5ECYA 3U81A 3VAAA 1YVDA 3TX2A 1RM3A 3ZJYA 4BEVA 4ZV4A 1CDZA 1HLDA 2WV7A 2ESRA 3NO4A 2B4RO 1KQNA 1M3SA 4M9QA 4CYMA 1BVYF 1H1LA 2MJLA 4YJHA 5HBGA 2V1UA 5DCYA 1DO0A 2JA2A 2CUZA 3OZIA 4LYAA 1AM4D 3ETJA 1KOGA 1RRVA 3GVCA 1C8VB 1ETHA 1OXMA 1THTA 2IP1A 3FNEA 3AEYA 2WI8A 2VT3A 2Z98A 1Z3IX 3N9IA 5MGNA 2QVZX 4ILKA 4F45A 2ZJYA 2YYSA 1KSJA 4AURA 4ZQEA 3EWIA 3IYLW 3BX1A 1VJDA 4FGLA 3IB6A 3RBAA 1DAPA 3UJCA 4K9QA 3DXZA 3VOAA 4QJBA 4L1KA 1US8B 3AERA 1GNLA 2XB2A 2PT5A 2BBWA 3TL6A 3CFYA 2VYND 3ER9A 4WN9B 4H7IA 1UFOA 5DN9A 2F1HA 2CMDA 3NC0C 2VEOA 4HNVA 2BI8A 4IKOA 2FCRA 1RJ9A 3P96A 3UG6A 4BNGA 4OMFG 3OFKA 5EZQA 2PLNA 3TDMA 3IVXA 4LJ8A 2L2QA 2GYUA 2VHWA 2EL9A 3KKNA 1X0VA 1U8YA 1SY7A 3X3HA 3TD2A 3F6RA 2YIMA 3ZGLA 2EDCA 5HZKA 4WGGA 4R71A 3PTAA 4G0UA 4EB6A 4KIUA 4LSWA 4TLLB 3AVYA 2P91A 3D3KA 3A58B 1XX6A 4XQGA 1ZNZA 3RVNA 2GPTA 4M4SA 2QRUA 3DQZA 3E23A 4RX1A 1I2MA 1NI4B 3DO6A 3G9QA 1TFUA 4DSTA 2CYBA 3VSDA 3ZWXA 1RXVA 4HAXA 4DEXA 5F2NA 3C5EA 3N07A 2ZBDA 2K4MA 1BHO1 2VPIA 5TIIA 2XAAA 4IHAA 1DX4A 4V24A 1T2VA 4BZWA 4R2IA 3ZU6A 2CDRA 4ZI2A 4QJ5A 1JAIA 3DOOA 4RK4A 1X0XA 1JIUA 4GSYA 4D42A 1UCFA 4II3A 1K27A 1YCHA 3BMQB 5JHHB 3OQNA 2PWAA 2R1ZA 2K2QB 2IXAA 1DKQA 2VJDA 4GI7A 4JYCA 4QXRA 5EQTA 4C9BA 4J4BA 4BNVA 1E2IA 1HTTA 1G8KA 2JD0A 2B94A 3AKYA 3QKUA 3Q9UA 3SPXA 3TZKA 5I9LA 1IHUA 2DSTA 4F2DA 4G0OA 2Z2KA 4GMFA 4YP6A 2IHVA 2QD5A 1M2NA 2XY4A 2UYCA 4LQCA 4ZAWA 4ZYYA 4BN4A 5G3ZA 2FEXA 4DSNA 1VLMA 1T43A 5H68A 3IDOA 5FX2A 5LYJF 3G6KA 4OIFA 1LWNA 1UFRA 2IOHA 1TRHA 1GSHA 5GOTA 5D3MB 4CR8A 2HHLA 2O48X 1W30A 5K0FA 4BPRA 1IWPB 2NU7A 2F3QA 4KYTA 3UJ7A 4MWBA 4QHYA 4RACA 6AT1A 3DZHA 1XRRA 2PD3A 1RM4A 3A1VA 2I87A 3AETB 5ALQA 1CUXA 3RHSA 4M9RA 2VDWA 1LLUA 2WYWA 5DHPA 5AVTA 3AVVA 5IYZB 1L4GA 4PWZA 2R7LA 2O1EA 3MMNA 4QLOA 4DGSA 3K1AB 3A11A 4BZZA 4X7PA 5BW8A 2OP0A 3DE4X 1DAFA 2XCUA 4Y6OA 5ALGA 1PD0A 3KFVA 2E48A 1GCGA 1QRUA 2J5XA 4NJMB 5U9CA 4XVHA 1VI6A 3DV2A 3WK7A 1RRPA 1W46A 3UMRA 1OSNA 1QGED 1LJ8A 4FLMA 4G1CA 3U62A 4BO2A 5JAQA 4ZN6A 3D2AA 2QZJA 3CIOA 3TJMA 2YZ2A 1VL2A 4WVLA 1XL0A 1WU7A 4B7UA 3IJRA 1ZRMA 4IDDA 3VBCA 2RMKA 4HGRA 2JK0A 4XD7A 4WNCA 4AWBA 1Q15A 1IULA 3DDWA 4MW5A 2O0LA 2QDKA 4PHFA 5ALXA 5ENVA 4ETMA 1QLJA 4FPXA 1YNOA 1F12A 1ONPA 1G5QA 3BWEA 3F46A 5KB3A 1DO8A 3SS8A 1PYDA 2ZWMA 3C7CB 4MCHA 1LVGA 3UQYS 4MHOA 3IL2A 3DE2X 4TL9A 3UWOA 5J43A 4U3JB 2AHRA 2AE2A 2ZWOA 4B0PA 3TSYA 1Y8RA 1KE2A 2JBAB 2ZP1A 3EPLA 4S1VA 4KSYA 4R1UA 1DARA 1T3HA 2OILA 2J0UA 2OBLA 1PX0A 3RYHA 1HNXB 5GONF 1JGTA 4RTLA 4RL6A 2R751 5LMCA 2TMKA 1P2SA 2DH5A 1A9TA 3LGAA 4EI2A 1JHVA 2GEDA 2JFGA 1UBSB 1N6NA 3MIZA 3S3TA 4ZV9A 1H9AA 2IHZA 2O2CA 3BSYA 3M5PA 2ZVJA 2V5VA 4KYIB 2QZ4A 1OZHA 2CHFA 2JBHA 1JU9A 3OIUA 3DE1X 3D4NA 4XIJA 4ESEA 3IEXA 4MTLA 3IAS1 2OORA 2FVYA 1WPGA 3OA0A 1XELA 1AA6A 4KQXA 4H7PA 3OPVA 1EQ2A 1TIKA 2XOKD 3DAHA 4KQJA 4NHEA 5A02A 1Z68A 1KAGA 4C2UA 1CPYA 3ETGA 3UCXA 4PR3A 1M8FA 4R5MA 3CLRC 3TX6A 2XWSA 5ANRB 1ISJA 4YT4A 1NULA 4DRXA 4PX3A 2W2LD 4D4MA 3CW8X 3AEQB 3E03A 5SICE 4DVJA 3F5FA 2XA9A 4AZ0B 1N9KA 1ID1A 1GUYA 3PKJA 4GQBA 4L9SA 1MB2A 4BN0A 2XMRA 4HLNA 3UA3A 4YPFA 5A0VA 3N0VA 4HHEA 3N3AC 4TT3A 1C41A 3WL8A 4TL7A 1JFTA 4O8ZA 3OZ7A 3P0FA 2FRDA 4RHUA 3TI9A 5AFSA 3K09A 5CJ2A 1IB6A 5E95A 3ZVNA 4CLRB 2C54A 4J3NA 2ODTX 1DIHA 2BGMA 3C39A 5A9TA 5I4BA 5TPWB 1NJGA 4ZOLA 5JC1A 1K5HA 4JVSB 1AUXA 1WW3A 2FPPA 2Q6KA 1ZDMA 1P19A 2O8VA 1XCGB 1PE0A 2RHJA 3ILYA 3RWBA 4R81A 4N12A 3UMBA 3P5BA 4FU0A 3X1MA 3LY8A 4EYEA 5DXJA 4L8VA 2E21A 2O2IA 1WEHA 1NUHA 4RVUA 5K3BA 4BB0A 1U8AA 1TYZA 2J85A 2X9LA 3P9RA 2ODEA 3Q9LA 1LZLA 4QXAA 4MQUA 5TEVA 4C7VA 3HV0A 2O5VA 4JJIA 1D2GA 4J4HA 2ZUUA 1XHLA 3K53A 5A3QA 2ECOA 3ZQUA 2H48A 1X1BA 5CXQA 3S2SA 3HWWA 4R3WA 3W7AA 2AWOA 2G40A 3O84A 5A5DA 5M7EA 1DCKA 1A96A 4IS3A 1ST3A 2HWYA 3QU4A 4KK3A 3TLKA 1WULS 4LNHA 4XI9A 4YB8A 3BMXA 3RT7A 3UPUA 1VRVA 4BXOB 1VGQA 2BP7A 3DNFA 4NK5A 4QGBA 4HG2A 5EPOA 1GPMA 1QFJA 3OQ6A 4BHTA 3S27A 4PN7A 2CNWD 1PNVA 1QANA 3OKPA 1UJCA 4WLNA 3GEHA 3CLKA 3WK4A 1JR3A 3HB5X 1QTRA 3LHFA 5EG5A 2CLDX 1CULC 3C8DA 3QE3A 1PS0A 2QYTA 3U0VA 2A14A 1R6BX 2ZYUX 3CV3A 4K26A 1SVMA 3K5PA 4IICA 1IVNA 4Z2YA 3EWNA 5C34B 2CL0X 1NR1A 2BLLA 2ZRDA 5CX1B 4YP7A 3EYWA 3K30A 4XW2A 2P1RA 1DT5A 4J1TA 5FV7A 5A04A 3WK5A 3OQ1A 3EHEA 2AHOA 4B84A 1DNPA 2Q9BA 3S70A 4DARA 1DKUA 1B93A 3AF6A 3ASZA 2GBIA 1SEPA 2WKRA 1OJ7A 3AUYA 4O0MA 3DAGA 4BWFB 3K70D 1FTGA 2DTEA 1WJGA 2F1KA 2WK1A 3CSUA 1AD2A 1GHTA 3CWCA 3W06A 1NE7A 4UBOA 3VH2A 5BWOA 1PSWA 3LYLA 3GLFB 4EGJA 4E2WA 2V4ZA 3RW9A 4I6EA 1A7AA 3I9JA 1Q1GA 3WNQA 2PXAA 3QVUA 1EZ1A 3TS1A 2IHBA 3NXKA 2CLCX 4CTOA 2NO1A 1EP2B 3FNHA 2G9VA 4FP9A 3FKSD 3RS8A 3STTA 3WBKA 1W581 4MEBA 3PB3A 5JMOA 1R3UA 2FUNB 4IOMA 4Z9XA 4MV7A 5ADHA 4LVUA 3SIRA 1WDTA 4B85A 3LQFA 4DCJA 4EDHA 4R7GA 3X1XA 1LDYA 3L8CA 4M1SA 2PSSA 4UM8B 2ACKA 1JFVA 2DHCA 3JZAA 2BHLA 3KXDA 4UHHA 2ZI5A 4MQFA 4L6AA 4RVNA 5CJJA 4CCYB 1CF2O 1ZA2A 2VZLA 1Y80A 4ONEA 2Z4TA 1L1RA 2HADA 4HSEA 1KYWA 2ZBVA 1U98A 4L28A 3RFUA 1GFZA 4Q7JB 1TEZA 3N7TA 2HQ1A 1U2PA 3ZQ4A 4AJEA 3K0SA 5EJEA 3JR3A 2VQDA 4B73A 3C3JA 5K6TA 3DHWC 4TXNA 4UOEA 4NE9A 5LIRA 1BMTA 4LOKA 4M1TA 3T9BA 3PUVA 1KTIA 3BBLA 4G4SO 4LPSA 2AJ8A 2D8MA 2PX3A 3TVTA 3KJNA 4ND7A 5JNUA 2FZ5A 3IR5A 4IV8A 3ZHUA 3P9QA 2PUBA 4AP6A 4ENQA 3L7YA 1NNI1 1YRQA 4YUWA 1Q21A 3C4QA 2GBFA 1EJBA 2JCVA 4P2BA 4RA6A 4C03A 2BMFA 3S8YA 3A1UA 3IAFA 3QWIA 5CNKA 3FGOA 2WG1A 4JSYA 3DDOA 3V2UA 3HWSA 2WKPA 3ZCPA 1PL7A 4OMCA 1F4LA 1AH2A 1M9NA 1AMOA 1E8NA 1N5MA 5IJXA 3H6HA 3ZXXA 5JO0A 4W5RA 4G1EB 2V8BA 4UPEA 2W6CX 2W8ZA 4MR7B 1WQ1R 2JLBA 2FJ0A 5JVDB 3ZDXB 4ERXA 3CLSC 2BM9A 4Q5IA 1QX3A 1IY8A 5IDYA 1WM1A 2L0XA 3FNGA 4DR5B 2NSLA 1WA5A 2QJTA 4DR1B 3C16C 5EE5B 5AT1A 4AUNA 2JAWA 4K9OA 3MAAC 1XCBA 1CYEA 4Q6WA 5HKBA 5CYGA 1B0PA 3PF8A 1NUPA 4HDRB 2RBKA 3L02A 4P5EA 1J23A 3QE4A 4C6SA 1IHYA 1YVEI 2GKOA 2DULA 1KI3A 1NLUA 4LOLA 1E99A 2FN8A 4W5TA 3OZTA 3R3HA 3GAMA 4KR9A 5I8ZA 4FYHA 4TTVA 3AIOA 1J8VA 4P4TA 3K2IA 2VDRB 3GJRA 4JBGA 5LMZA 4DM3A 3P4UA 5B7GA 2JVKA 4YUYA 3EK2A 4ZI7F 5GZ3A 2JIPA 3N1UA 1KR2A 3FLAA 3Q1KA 5DGHA 1QVVA 2F4VB 2H5JA 4CHTA 4EUHA 5B55A 5CURA 1X9IA 3UC5A 5KPJA 1YR2A 3HCFA 3RAPR 3MCAA 8OHMA 5DI3A 4ZAVA 2HNKA 4KP7A 4CGYA 1NFFA 4MS3B 2VDQB 1XKQA 3R0QA 1S8AA 3LHSA 3GP5A 3PUXA 4YQFA 1A95A 2XSZD 1YBVA 2B7LA 4WK6A 3WR5A 1X80B 2G06A 3H5TA 4BX2A 4GLFA 4CM1A 2I6SA 4HAYA 5BQPA 4Y2SA 4URXR 5IX8A 1BFDA 1MJGM 1K7EB 1YCFA 2X4IA 1OAOC 5E6UB 4TN1A 2OHXA 3UKOA 2YS6A 3AVPA 1D8AA 3H83A 2YWEA 4NABA 1MZVA 2FEOA 1UT8A 1EQAA 3AUAA 3A4IA 3K20A 2WUFA 3R7WA 4BASA 4JZKA 4ARAA 5IAOA 1HTBA 1VZ3A 2EFHB 1F2VA 3E4CA 2PUEA 5C5IA 4KR0A 3M5CA 4MUAA 4D9GA 3H86A 1N2OA 4ZI5A 3JVIA 3VOSA 5KVSA 3E5NA 2IEZA 1SIOA 2DPMA 3ACCA 4F1JA 2I99A 2VJYA 1FP6A 2RDMA 4ZA2A 3G5MA 1CHDA 1R0KA 2G67A 2VUHB 4J7XA 2IXFA 1IUOA 1PJLA 1QF9A 4IGKA 1X7ZA 2NSYA 4O4LB 4Q03A 4HX2A 4L72A 5CLJA 1RWPA 3CVWA 2VRWA 2Q49A 4QWWA 2O9JA 2WE7A 3ZCXA 5K8CA 2VJAA 5JW6A 1Z6YA 2RCNA 5F78A 4ZVSA 1WRBA 1JWBB 2EKBA 5CGZA 3RYIA 4W5OA 3QG5A 3QYFA 1OH6A 4NR0A 5J2TB 1QG2A 2RI1A 4UMVA 3R5XA 2FX2A 4QXOA 5AHOA 1IEWA 1QYWA 2DRIA 2VRNA 3L4BC 2NV2B 4C2BA 5B58T 1JQJC 4GMHA 5HM8A 2J45A 4IXDA 4Q1DA 2XWPA 3Q5DA 3BIFA 3D0OA 4QDKA 2YOGA 2V96A 1NBMA 1X8XA 1FP7A 5LLDA 2QGFA 3UWMA 2AJDA 3JWPA 3QU5A 4PYQA 3C6YA 3GFBA 3COYA 2G1JA 4MPRA 4YVFA 1D7OA 1JKFA 4GRDA 1NKSA 4GYYA 4YALA 4ARSA 1VDZA 1L5MA 1PDOA 1Y9ZA 2WT4A 4RXMA 5DTEA 3WSTA 4WESA 1FYVA 4GPBA 3NETA 4EJSA 1VCIA 3R6TA 3NIWA 4MVJI 3HSSA 2YNMC 3AG5A 4N8SA 1QPBA 2B78A 1ECJA 1JA9A 1M74A 1X13A 2EKQA 1C3JA 1G1MA 5B37A 3DFUA 4LZZA 3W1VA 4FT4A 1BSVA 1IWOA 4MP6A 2EFJA 4B2PA 1G5IA 3L41A 2B25A 3BAFA 2X7JA 3EMDA 4AI6A 3CEJA 3IHKA 4ES6A 1TT5A 3A25A 1TZCA 3UCFA 1XAJA 3CCBA 4MZDA 3G8YA 2JHCA 1CUFA 4ZQHA 4A2WA 2QB5A 3PTZA 2ECPA 3STYA 1NQWA 2C07A 1TO1E 2IYTA 1CZUA 1DWUA 3H9QA 4J7UA 3VR2A 5C1OA 2WDPA 4I4CA 4WLVA 4EPRA 4HNAA 4TM8A 2O2ZA 1RBMA 3T4EA 5BSKA 3VKGA 3PUKA 4YAKA 2WJWA 5JQGA 5DM0A 4IILA 4A73A 1EDZA 3PT5A 3UV7A 2IGBA 4Q7MB 2QD3A 2XTJA 1FA9A 4OKNA 3RLFA 1SOWA 1FRVA 3LV8A 3PLAE 5I01A 1MG5A 2C3UA 1E9AA 2JIZD 4BNHA 3B6EA 3BFXA 4JIMA 4LZLA 3A4MA 5AW0A 2HIGA 1PG2A 1U90A 2NX2A 4YPVA 4LZAA 1XDDA 4WOPA 1J42A 5JALA 4N41A 1O5IA 3ZTWA 2ZOSA 1O7JA 2C78A 3RYFA 1X42A 5DTQA 1CEYA 1Y1LA 4BFZA 3AJEA 3WGYA 4PY2A 3MUNA 3ENNA 3Q7IA 4KHZA 1ZJ4A 2PGNA 4ZVNA 3VNBA 1O6ZA 4WPGA 1JMYA 3IDFA 3QE2A 3QVJA 1AUOA 3WLAA 1KPIA 4IX9A 3Q40A 1HO3A 3CZ5A 2HF7A 1T26A 3ZK8A 3ZWAA 5K8UA 4RSGA 1I7NA 1J39A 4NG5A 2ZTLA 2HHHB 2QN8A 5DX8A 1F3LA 1QYCA 4QD3A 1WUHS 3PGXA 4YREA 4V0MA 1MOPA 5JDCA 1WF6A 4E12A 4PZUA 4G86A 3L8MA 2GN9A 3HUDA 3LUCA 4LKOA 2F1JA 4BO4A 4MJ3A 4D5GA 2O59A 1EVLA 3GI1A 1Z82A 2ID9A 4I1VA 3LM8A 5K3EA 4B3JA 3OPQA 3TSAA 3YASA 1EYZA 2GEJA 4QAQA 2C8JA 4WXRA 1BE6A 1T9KA 3W8NA 2ZE6A 5DMHA 3QFFA 2QZZA 5BUCA 4URWR 3J80A 2F43B 3K0CA 3ZX4A 4D8XA 1RHJA 3MSXA 1ZONA 3KJIA 2ZVQX 4K5QA 3SOZA 2X7HA 2DX7A 5CAEB 3PD1A 3AF4A 1K3UB 1GNPA 5G0TA 2XQJA 3FIUA 3JARB 1S89A 3FWNA 2OV6A 1JVSA 1NMZA 4KDEA 4Q4AA 5IASA 2A57A 1GP2A 5BQFA 1ZEMA 3EXIB 1YQDA 4LXGA 5J63A 1TIPA 1N5OX 3AILA 1JNYA 1Z2OX 2QAJA 3F4LA 3RFTA 4EYQA 4FHGA 1T1GA 3PDIB 2XVAA 5DBEX 2JPDA 5JIBA 4P3NA 3X2FA 2OZKA 1A9PA 1Q83A 4B6SA 2QSZA 1W5BA 1XZBA 2QQ5A 1B1AA 1FYDA 1D03A 3ZBPA 5BVHB 2C59A 3LW8A 3QF4B 1ATIA 3IEMA 2ONZA 2NXCA 1E1CB 2FTKE 3PDHA 4BE9A 5DFAA 5K5EA 3N39C 5CCDA 1QG4A 4R1NA 2I80A 3RIHA 4IXMA 2ZU0C 4PFKA 1FJXA 3DDNA 3W5BA 3ORQA 4MOWA 1T9GR 3P7MA 3M83A 4MV3A 4CDMA 2DWCA 2HRQA 4JCCA 4PGGA 5AH0A 4KBGA 3TECE 4F3KA 5CFLA 2WTNA 3FW1A 3ZIUA 4FR5A 4RETA 3GJ3A 4C78A 2Y92A 1T3TA 3V8EA 1AMNA 5TV2A 3IBYA 1IZZA 4ZVMA 1IZ0A 3GLIB 3JX9A 2VSXA 1Y6GA 4RK6A 2H1IA 1ZK0A 3CXUA 2HDWA 5IAEA 2ECFA 3GCZA 2F9FA 2VJBA 3M33A 3OURA 5A0FA 1JPJA 4K40A 2O0HA 3SIXA 5KYVA 1GNQA 1Z3CA 2Y1FA 1P6QA 1VKOA 2I6FA 1D0VA 1RYZA 3ZWOA 3U09A 3DTVD 1O5TA 5EUBA 1ZGJA 1O3YA 3WB9A 4DC1A 4TYQA 2CXQA 3M6XA 3VVBA 2XXAA 3UF0A 1VLQA 4TKUA 1ZM9A 3L1VA 1N8KA 1YB4A 4XPIA 4GBJA 2LVBA 1DUIA 3KJFA 3MJVA 2JZOA 1VI5A 4JB2A 4PSDA 3W4KA 2XX3A 2CXSA 1HYEA 4MGKR 5JAZA 3B51X 2EZ4A 1EXNA 2VXOA 3LT2A 2OFWA 1UKCA 4FLFA 3RU3A 3IKVA 5L3SB 4GGPA 1TPZA 3M6FA 1KU0A 1XD8A 3JQAB 1PEAA 1WCIA 2QQ0A 3W1WA 3GVPA 2GCEA 1S2IA 4CEHB 1SG6A 1K6MA 1T5OA 4MDYA 3ZE7A 3QELA 3QU9A 4WT7A 5JFOA 5EWMB 4AY4A 3O4GA 1H1DA 2RB5A 2Z2IA 4D9CA 2W58A 5AVVA 3H2HA 1G3IA 5LJLA 4Y2HA 1E9SA 2A1UB 4FQ8A 4KMSA 5KQMA 3NZEA 4D0SA 1SVSA 1N8SA 1Z22A 4TV9F 3TGLA 1T3SA 2R2AA 2W43A 1P62B 1CUHA 4KBFA 4N3AA 1QGOA 1TAQA 3SZGA 2CZGA 3W5DA 4L5IA 2VJKA 2JFBA 1ECCA 3ESBA 2QAGC 4B33A 3FWKA 4E1AA 2Q9UA 1SUWA 3RGWS 3GJSA 5EJ4A 3V33A 3BGWA 3FGZA 4ZGWA 3IMEA 2GN4A 5LQUA 1DCTA 3B1KA 1NDUA 1WXIA 2RH8A 3TPFA 4URFA 5K4GA 1BS2A 4K0KB 3EIXA 2NVWA 1PL6A 2BPOA 2VT2A 5FO1A 3T5BA 5AVSA 5FAKA 5AVOA 3L1KA 3OIFA 4ER5A 3EFBA 3IV6A 1XMOB 1J09A 1QV9A 4C3VA 5TXGA 1WP9A 1ZD5A 3OX1A 1BC5A 1EFKA 3KWLA 4IGAA 3DE5X 4U9IS 1HGXA 5I7AA 4HUQB 4MRMA 2F1RA 5BV8A 4WFJA 4E51A 4IQ8A 4P3OA 4C7BA 2PQ0A 4LOIA 1NJ5A 4UMFA 1RQPA 4HGZA 1ESCA 4J2OA 4HDNA 2RGCA 3MFYA 3TXYA 1ONNA 4FMDF 2DWUA 3HKEA 2QPAA 1N0IA 4MR8B 2W2TA 2GKGA 4PU0A 1PZGA 2IOYA 4F97A 1V4BA 2WWTA 2PRSA 3LH5A 1YRBA 2XA2A 2BM1A 1E6WA 2DBVO 4OQXA 5A71A 3V8PA 4L85A 2Z6VA 2DQYA 1LB1B 3KSUA 1UINA 2YXLA 3LO8A 2GCOA 2PQ6A 1DIGA 4FBMA 2UYOA 3OT5A 3UOWA 1UDBA 4O4HF 4BWGA 4PRZA 4F8EA 1KOLA 1HKUA 3EXHA 1WSAA 1HYGA 2Q5OA 3A14A 3AZOA 3KD3A 5BRNA 3T4XA 3VHRA 3TUZC 4BUCA 1JQDA 2N0SA 5C5EA 1VG9B 2OGWA 2PZEA 3WSVA 3X1DA 1I33A 2CUKA 2CLKB 2ZBRA 1CZOA 4DE5A 2H1WA 3RS5A 1ZMTA 2R6FA 1KBOA 2GZ2A 2PZFA 2FSPA 4ETIA 1JALA 1IHXA 3SIWA 2XUKA 2J67A 4I50F 4R3NA 5A3VA 3ZQJA 5C8VA 4ZT3A 2D5LA 4S1TA 3IPYA 5C46F 1MO5A 4H2DA 3T34A 5AW4A 2A0UA 3AC0A 3MD0A 3ROFA 3QKRA 4DWWA 3A6DA 3Q3IA 1SA0B 1DAEA 3DFMA 3FYSA 2ATEA 2X6TA 3RTGA 4LUCA 4YDHB 4AIIA 3GLHE 1CUCA 1A3CA 3CN7A 4YMGA 4FNOA 4KPYA 1EINA 3ESCA 4QDZA 2WM9B 2D5BA 1ND6A 4YQEA 2JHFA 2VHJA 3GUZA 4K6CA 3SKXA 1NMQA 4IIXA 4UBLA 1HYHA 4A2CA 4EJ2A 5LOVB 2XKAA 2GI4A 4W1QA 1YU9A 1YK1A 1TOAA 3A4LA 2JFYA 1FQKA 1RWXA 3I4CA 4QPPA 3RVLA 1TA4A 1I32A 2VWGA 1N4AA 3UZUA 1O5OA 3WLEA 1PGNA 4CKEA 1B43A 5JECA 2FWAA 1AGXA 1IOZA 2FGKA 2VBFA 5IT9A 1DLIA 1E7RA 4KXLA 1ST2A 3DVSX 3EG5A 4KU4A 4FB5A 1PQUA 2EDAA 2VSFA 4JVMA 1V35A 2CWWA 3KZMA 3R7DA 4ANFA 1I9CA 3MPUA 1TO2E 1VRWA 1DOZA 4FFBA 2D0OB 4YRAA 1IZ8A 2XVXA 1TTPB 2X77A 4NOJA 3FE2A 3INYA 1U7OA 1YFKA 3AY7A 4TQGA 3VZSA 5JFTA 1YUMA 4MPTA 1XNHA 2DTXA 4M9CA 2HA0A 5FBWB 5DBHX 4DAOA 1HF3A 5I3ZA 3GJ8A 3H1TA 1R0LA 3HKDB 2FQ1A 4NH0A 1E0AA 2O7SA 3B1VA 4QFCA 4KO8A 4NMWA 3BIXA 4PXYA 2XYPA 3R5TA 1IXKA 1Z5ZA 2B61A 2P9QA 1IZ7A 1J9GA 4NCJA 4UW9A 3PPYA 1BOFA 4X41A 3AI3A 1U7TA 4V0QA 5IJ0A 2ZUEA 2ODWA 1RZRA 3W5UA 3LVFO 3LP5A 2FP3A 3KOXA 4DQLA 2I2FA 2J31A 3LX8A 1Z6XA 2MSWA 3ILVA 5TNXA 1RABA 4JQOA 3VGJA 5EJ5A 1MJGA 5EIBC 1YV9A 3K0KA 2HJGA 3GEIA 1P74A 4XDGA 1DJOA 4LGCA 2P5SA 1YBFA 1YMVA 3MUEA 3H1BA 2PZLA 1REQA 1SCDA 2W7TA 4G84A 1X1DA 3OC0A 1ULSA 2C57A 2VFAA 4KFTA 4PVDA 4Q15A 1HM5A 3ECAA 1J21A 2RONA 5L3RA 5FUWA 3RRNA 2R85A 5BUQA 1RAEA 1ZIYA 1ZU5A 2ORED 4ND6A 2AYXA 3BJRA 4B87A 3CEAA 3I04M 4L5BA 1JQAA 1NPDA 2FN3A 4XPZA 2NVOA 1ND5A 3VR3D 1KGSA 1PJ8A 3P4XA 2KBFA 2ANCA 5JANA 1P8JA 2G07A 3PZRA 5E8RA 4ZRMA 1U65A 3IQIX 1YQQA 2IK8A 3ISJA 1XC7A 3NDPA 4X00A 3LQYA 3ROTA 5LYJA 2ETVA 1PFVA 2FWNA 4Z3KA 1Z08A 1OV6A 3F5MA 3GZTB 4AICA 3PNOA 5HKKA 3ITKA 5H02A 5ERYA 5F9HA 1I5OA 3S7TA 1A8UA 1PKXA 4MIYA 4JB8A 3RC2A 4EKNB 3WYDA 4Q9HA 4DV7B 2I2WA 4HGOA 4RYDA 3FOBA 2A5GA 2WMDA 2ZIGA 3AEKB 2CMFA 3C7AA 3CNNA 1X8KA 3R3UA 5FNVF 4H16A 1O96A 1RPNA 3F8WA 4ED9A 3A7EA 3PQ7A 1J2EA 1UK8A 5CH3A 3NTOA 1R0XA 2IYQA 1BVRA 4ZQBA 5CXXA 4DLKA 1FZQA 2ZAGA 4LNUB 3VO2A 4NG4A 4KREA 1EZ4A 3II6X 5H9WA 4MVJP 4CMBA 1RZUA 2GZMA 3TTWA 2B9VA 2JFUA 1RKXA 5B2ZA 1YVPA 3OEEA 1HSOA 3SEFA 2Q1WA 2X0IA 3OLVA 1EAMA 3FWHA 5DYWA 1F1JA 2GRUA 5B2EA 2X86A 5G40A 2R44A 5EIEA 3BOSA 3O3NB 1X7HA 4TYMA 4WH0A 4BFYA 1ZGHA 4DWOA 1LXCA 3RKRA 4NCHA 3HLYA 3KYDB 3IP9A 2WJ3A 3ZDCA 1NBIA 3NB0A 3ZCSA 2DFKB 2F8SA 1TF2A 3P9CA 1SH7A 1YT5A 2V6IA 4JN6B 4WE3A 4XM1A 3V4VB 2B30A 2WU0A 1P80A 4JOSA 4Y0VA 4ZT5A 1YJXA 5MFZA 5TMDA 5EHIA 5JAUA 3GCDA 4OGKA 3K9FC 4O2RA 1U11A 4BLSA 3T5PA 3ZXUB 4RJ2A 1UL1X 1ARZA 5CP8A 2P3SA 1X3LA 1MO3A 3IKTA 2G5GX 2YMMA 1G9XA 4PINA 4NI5A 2HMSA 2ZANA 3UJ6A 3R20A 1HEUA 1T8UA 4G2NA 2PFKA 2FPGB 4QODA 3RASA 2I67A 2R62A 3G8DA 1N9ZA 3FPHA 4G09A 4B6EA 3B5EA 5GONA 4UXIA 5F3DA 1TVKA 1ESZA 1Y4SA 2WVJA 1KAHA 4DMKA 4Q4DA 5JEEA 1J9EA 4YBRA 5EC8A 3EOZA 3O8BA 1PT6A 1ZUNA 4CLOB 1NNLA 1YI8A 3LHKA 5DHAA 2PX4A 3FCSB 1WR8A 3I53A 1A7JA 2WLTA 4M37A 5FI1B 5IWAB 2ORYA 2PUGA 3GLRA 4GI5A 3FDIA 4UPVA 5D00A 4BZQA 3OQBA 2RC5A 2IW1A 2PY6A 1PJSA 3MMZA 1ZCFA 4FN4A 4J0DA 4LDPA 5HF9A 1NFQA 3NM6B 2HLNA 1BS9A 2DFDA 1W36B 1WKCA 5HSGA 3AF3A 5A06A 3KQYA 3CH4B 3GLUA 3TNLA 1MP0A 1GXSA 2BZ1A 3FSGA 1O94C 5JRJA 1J2YA 4MIOA 4C22A 3B6MA 2VATA 3F9CA 1GL6A 3HCPA 4TVOA 4AIRA 4B2YA 1OXKB 2VUSA 3W0LB 4J0HA 1E9DA 2DH6A 3EE6A 2GN8A 4RVOA 3LU1A 2P9TA 4S1OA 2CT8A 2QMOA 4TMZA 2B83A 2PRZA 3C3DA 3DLTA 1IN6A 1R5BA 1V11B 5DLDA 3RC1A 4YCMA 2VP3A 3IMGA 1TVCA 4XQCA 4E4YA 4UTRA 4BYGA 1Y6RA 1BA2A 2I6XA 2XWJI 1JWLA 3SQXA 1V7PC 2O8FB 3SVLA 4BKMA 4ZCPA 4NX2A 2JI7A 2P9YA 4L9WA 1JX6A 3TINA 2ZJAA 2WJHA 3OUUA 2JBAA 4AY6A 2Z43A 4BX3A 2EWVA 5DZSA 2DGDA 2GAOA 2QT9A 3ASYA 3EOAI 3PP8A 1EEXB 5AOVA 3QX3A 1KQFA 1GZ6A 1NAHA 5ALFA 2AOUA 2I91A 3QLTA 5K0JA 1QFYA 4N01A 1YBHA 3SQOA 1Z2NX 1NDQA 1BROA 2I4IA 3P8ZA 2PCLA 3DZ8A 3FVRA 1A2QA 2DLNA 3FPSA 2E4XA 4OJYA 4WJZA 2E5LB 1J1UA 4ZHQA 4EEXA 3WQHA 2VF2A 3M6MD 4FT2A 1CLEA 4JA0A 4NYJR 1BMFA 2M32A 5TGTA 1L2TA 1BG6A 3LCUA 3RVKA 3T1TA 3LBIA 2FW6A 3BXZA 4IY1A 2WQ7A 1G3RA 2DR0A 2QZ9A 2ZUBA 3KEFA 3NAQA 4D0NA 1KFKB 2Q45A 1AO0A 3ZLUA 1IIRA 5K8IA 2J9XB 4FHZA 3R5HA 5LJIA 4DR7B 2W2NA 1YTLA 3AONB 4IXNA 4E5DA 5A4FS 3AU9A 3KK0A 1NR7A 2Z30A 2ZYVX 3JZMA 1YKFA 1N1DA 4WNIA 1E1QD 1QNLA 5A5VA 3LY9A 3B7WA 2FPIA 2QTAA 4AM8A 3WTCA 2IS4A 1NVTA 1TMKA 3K3PA 4AZWA 1SD1A 1H66A 5T7BA 1D2CA 4Z0TA 3HY6A 6REQB 4JQYA 1DRJA 4HQ0A 4WTOA 2J59A 2AZMA 4K6OA 3T7CA 2C8VA 4PNPA 5CFOA 5IWCA 1SK9A 2FE4A 3IP6A 5TPWA 2DC1A 3PXAA 4AROA 3T5CA 4BEWA 2O2GA 5AMXA 2JJYA 2HA6A 3GGOA 2W2XA 2J0VA 2LBPA 4GFDA 3VMFA 3WWPA 4ACAA 3REQB 1BXGA 2HO4A 5ALUA 4DCTA 3K7EA 2PGXA 4R7ZA 2C2ZA 5FBHA 2A5JA 2CHUA 3GFVA 1Q2XA 1KYXA 2P0EA 3DFKA 1NU6A 1CRPA 2IFTA 1E1LA 3G8BA 2BMWA 3N87A 4FGJA 2CEKA 4MTCA 4BQOA 5DM1A 3URKA 5AVWA 3FKQA 4HDSA 5CA0A 4KDFA 2O3SA 4ZPXA 2BEVB 3T3GA 4FSHA 1KARA 2GX6A 3CEMA 4Z0HO 5J3JA 1G59A 3CC8A 1H23A 2WNIA 5FWDA 3K1JA 4HB2A 1Q16A 1EK5A 1X7XA 1W76A 1AKYA 1THMA 2HRRA 2ONYA 1AZLA 2XGMA 3IKMB 2NO9A 3TXAA 4PGAA 4C0KA 1MF7A 2GD2A 2QX4A 2RBGA 4DWVA 1W6UA 4XQ0A 5A3SA 3F6YA 2GPYA 3QLJA 2FV8A 4L9RA 1OX4A 4UEQA 2A33A 2FWJA 1IZYA 1HFWA 4BXOA 3NJ4A 4KLCA 4L5CA 5F9FA 3IX7A 3Q5GA 1RI4A 3NBAA 2OYCA 2YWRA 1H2XA 5CH8A 2D3WA 5TT0A 1PG5A 3ZV3A 5AUPB 1X1TA 3O83A 4X8OA 3K9HA 1XTTA 3ZCRA 3ZGOA 3AMVA 3QX7A 1CY8A 3KHSA 2A7XA 4TROA 5BR8B 5JH7A 4NBRA 4IH1A 3O3CA 4KTVE 4DANA 2RI6A 1V6CA 2ZIZA 5SY9A 1N6RA 2REOA 1AJEA 3EG9A 4LC0A 2P2LA 2NACA 1K75A 2V8OA 3W3ZB 3WYNA 4D74A 1TW3A 4C7OB 3VVCA 4JDUA 4C4AA 5FWXA 2SKEA 2GJ4A 2HDNB 1G21B 1MW8X 1KRXA 4PZ9A 1GV0A 3PFWO 4U5QA 4N8EA 3N7AA 1W96A 3GZ4A 4EQ6A 3WLTA 2VTBA 4PIVA 2YWFA 5ENZA 2GB4A 2QUAA 3F3KA 4JNCA 1D07A 5CDHA 5BY2A 3KQMA 3NU1A 4FFMA 1M2GA 1XPOA 4BJ3A 5TS3A 3CZAA 3MJDA 5E3JA 3BH0A 2KYRA 5DWDA 3Q8KA 4QVGA 4GI2A 4MRVA 4RMIA 3QLUC 4XJTA 2V65A 3S55A 3CH6A 3ZOKA 4K9DA 521PA 2CB0A 5ESRA 5JS8A 4CT0A 4NCBA 3E22A 3CMMA 1HPLA 3BAZA 5A05A 2M6SA 1UMCB 3KVRA 5DOZA 3FFWA 4MS1A 3E15A 1L5QA 1Z6GA 2ORWA 1ZCBA 3K5HA 3K9CA 4H60A 4N39A 1JUDA 4ZDJA 4E7OA 5KDDA 4KV7A 3GNTA 3MQFA 4X20A 5LWQA 4B6RA 4OHOA 3U5ZB 5F76A 4FJ2A 3DZFA 3I1IA 3BK2A 3INTA 4KAJA 2AX4A 1IB0A 5KOHA 1A9QA 3HRHA 1GQRA 4P32A 3IOYA 2G9NA 4HWSA 4UUAA 3UJPA 3G0HA 4ZI7A 2FW8A 2PSJA 3OM9A 1S5PA 3KQTA 4DLUA 1KE1A 1T2NA 4YMVA 4D41A 2ZYHA 4JJAA 3QE9Y 3D02A 5T4BA 3VPCA 4X1KA 3GEGA 4EFMA 1UWVA 3L04A 1NJSA 4ZAZA 2QQFA 2FSVC 4EEKA 2QIPA 5EQJB 4BV3A 2ZCJA 1NAIA 2JCGA 4ZOAA 3VC1A 2HA5A 3EIHA 2XUGA 4JLVA 2F48A 3ET4A 5GPBA 7ABPA 2RHDA 3VKVA 1GGNA 3G0CA 1P45A 4B71A 5BURA 3RAJA 2AFHE 2AS0A 3VOBA 5L7YA 3VPAA 5KDOA 1Z0KA 2JKZA 3LWDA 1NBAA 2BAGA 4IHQA 3WB2A 3BTUA 5C7YA 3FOZA 3VC2A 5SZJA 1VC2A 5LP6B 4QQNA 4C4OA 5IXYA 3MGKA 4UAVA 1EVJA 5JD5A 3B53X 1VIDA 4HB0A 2ZM5A 1AY0A 1U4SA 3NGLA 4MI6A 1C30B 1GEEA 4N0EA 3F5DA 3SFTA 1ISSA 2PAAA 1QP4A 1L7NA 2FW0A 2QVGA 3K9GA 5CLFA 3N86A 1M1NA 5JATA 2ZSBA 2JK1A 4LVNA 5GMOA 1YAHA 2IEAA 3WWYA 4LHXA 3RARA 4N6GA 4MP8A 1W93A 5H70A 1A7UA 2IHKA 3GIDA 3NNDA 5ECDA 2BFEB 5FLEX 1Z4LA 1V41E 4BVEA 1XRSB 2DPHA 3CGGA 8GPBA 3VR5A 2NO0A 2ZZMA 1Y4DE 1Z28A 1FEZA 3QMVA 2GK6A 1NUQA 2BFWA 3T54A 4LOAA 1UWCA 2HJWA 4Q39A 4G24A 4XD7D 1HZZC 2BTEA 3VYWA 2ZU6A 1EGMB 2D4AA 3G85A 4YCSA 4KGVA 4DNFA 1E77A 3NDRA 2QMZA 5H82A 1NW7A 2MIIA 4U6SA 2OCAA 2ZSAA 2J3EA 4I99A 2OO7A 3PE6A 4RVGA 3LBAA 3U0BA 5J5VA 4RTQA 4OXRA 1QLHA 5CFPA 5JAIA 1WSDA 1HQDA 4BAZA 1J07A 5DM4A 4Y0AA 5F1OA 1J4AA 2CDBA 2CLFB 4R31A 2HK6A 3VPFA 3T0IA 4ZZ0A 1XDUA 1R6VA 3UHAA 2I5PO 3IUQA 3EA5A 1R88A 4PRKA 3RRBA 5JS2A 1Y8QB 3Q7TA 1Z25A 3ZHSA 3U40A 1GPUA 2BL4A 1KI2A 5AHKA 5K0GA 1I3OA 4N0QA 3W05A 2JG3A 4AS1A 3NBUA 3RNLA 2PWYA 3A04A 1SC9A 3DHEA 2BOVA 1UZAA 4GU5A 1MB9A 2IU3A 2PKCA 2ZW9A 4NZ9A 3S44A 2ZXUA 5KJ6A 2WPNA 5CPFA 2YVLA 2JIMA 1WBDA 2L69A 5AK4A 5CBPA 1SOVA 2YVQA 1F14A 4OXNA 1VIMA 4GM0A 4R68A 4N5IX 2YHSA 3CZRA 2R66A 2XQIA 4UBNA 1JHPA 3ZI7A 3MRXA 1RKUA 4FCVA 1E0DA 2I2XB 2BEWA 2OC4A 3ADBA 4B3FX 4L0QA 5KX5F 3RI3A 4Q24A 3WGNA 2ZVDA 2XZPA 1TPYA 2YY5A 3K0FA 1OT5A 4INJA 2RAPA 4LOHA 3U3ZA 1XVUA 1BAPA 4TX1A 3EQ9A 4XE5A 2B82A 1IVSA 1AHHA 4JGGA 3U80A 1UJ5A 1IOVA 1ACMA 1EFCA 1FPQA 3NALA 2WG2A 4C4PA 4OIMA 4OI2A 5U1PA 3M3DA 4TT3D 1KZ6A 1VKZA 3GRUA 2CSXA 1FFAA 3T7TA 4G1VA 4INZA 4LTNA 5JXHA 3LUHA 4CKCA 3BRQA 3LSYA 3TTSA 4F12A 3GCWA 1T3LA 2W6PA 4JNKA 5I9NA 3ZLVA 3B6JA 4C6TA 5MN5A 4RD3A 1H93A 4JBXA 3N58A 2NQ2C 2CYCA 4MS4B 3PEYA 2VAWA 3RK4A 3V34A 5DKFA 4RJLA 1GYRA 3NTQA 4UJ5A 3N2ZB 3Q10A 4O59O 4DS3A 4EGAA 2B35A 1VL8A 1FP4B 3AHIA 4H6XA 4HQKA 4HTAA 4MCAA 2N42A 4UXJA 4E5UA 1RXWA 4MRAA 3TRKA 3HCWA 1QHGA 4ZO4A 1YVUA 4WKGA 5J58A 1W8IA 1P7YA 2YICA 4E2XA 4R2WA 4TV8A 5FUVA 4A5OA 3ZU2A 4WX2B 3WMRA 3WA7A 1RD4A 2R65A 2QDXA 2BFDA 4GP6A 3QEKA 2GZRA 2E37A 3NEAA 1CQIB 4FJ0A 4Z99A 1D8TA 4TQAA 5HW0A 1B74A 3INNA 3VZCA 5DPMA 4NV1A 3MTAA 4Y6LA 2SBTA 4U7HA 4UZSA 3HWX1 5I48A 3OX3A 3H5IA 3TQHA 1YZLA 2QI9C 3K5IA 4GSKA 4YAJA 4GR4A 3TI7A 4Q9AA 2ORVA 2FUCA 4ENWA 2UYYA 2BR3A 4NOLA 4J75A 4RPIA 4FGZA 3VTAA 2COKA 1R4NB 1G21E 2B21A 2GXSA 1QHIA 1JR3D 4UEJA 2QMQA 2SKCA 1SKYE 3AGPA 3R4VA 3V3KA 3HJHA 5CDFE 1RYEA 2PWPA 2WU3A 3B7PA 3OX2A 4ZARA 1E58A 4ALLA 3HVIA 4MWGA 3SY8A 2HF9A 2G09A 5GP1A 3OMLA 3LQKA 2X19A 2DAPA 2QVBA 2WJGA 3KJGA 2PUAA 1RQ2A 1HFEL 3O94A 2HAEA 3F73A 3DMNA 2ACEA 1TQ8A 1SXJB 2I6UA 3O8NA 1Q5PA 3QH4A 4I7EA 4Q4LA 5ALKA 3N6RA 5CTAA 1TM5E 1MT0A 2VPPA 5K3DA 3VPHA 3JWEA 1Z4KA 2PZGA 1N2ZA 1QO0A 1FK8A 2R5FA 1L7BA 1SBTA 1GLGA 2B4YA 4Q48A 4YAEA 3FZGA 2IT1A 3GHHA 3PJDA 3EBLA 4IPTA 1J7KA 2YYAA 2IH4A 1L6RA 1AGPA 1N1EA 2I7DA 3ODPA 1UM8A 1VQ1A 1ZCZA 3GR6A 3PF9A 4S05A 4ZEXA 1XZHA 1YH3A 2ZYRA 1M8PA 1K0UA 1N7HA 1E92A 3BH7A 4TKVB 1P17A 3AZQA 3CE9A 4RFSB 2C5GA 4TMYA 4LIPD 2UUOA 4BBPA 4DT1B 4C0BA 1YXMA 4CLEA 4XB6B 4HKTA 3VDQA 2I1WA 1KI6A 5K0LA 4AMBA 1R9JA 4Z1MA 2IX3A 3ZR4B 1QHNA 3JQEA 4HYQA 2R6HA 5AIBA 4DLSA 1L6IA 2GQ0A 4KE9A 3FFTA 3OIVA 4YRCA 3X1YA 4A1FA 3E81A 4N54A 3TAXA 3ICWA 1P1HA 1RLOA 1ICIA 1FPMA 4D96A 4F3TA 3GPIA 5K3AA 3H05A 1PYGA 1GA6A 1JIVA 2UZ3A 4NQZA 4PSAA 3AP1A 4C0XA 1Q7TA 5AI4A 2I8AA 3IRVA 4X65B 1QH1B 3F7TA 2HFKA 2DHQA 5F7ZA 2YX1A 3A6FA 1JJBA 5A5EA 4AKTA 2JGEA 5CTJA 1Q7EA 2JHGA 1OX5A 2E1RA 2PT9A 1FYEA 2PVCA 2YBDA 2O6HA 1UBHS 3AEXA 3OVMA 4MVJE 4NEHB 1XMXA 5D3ZA 4XFDA 1YQWA 1DDGA 1IIBA 2R8BA 3H1AA 1G291 2Y67A 4JLJA 5DW0A 3RS3A 3CBGA 3T3HA 4BB6A 4Z7JA 2UXDB 2ASVA 2QXUA 4UMEA 4W82A 1AKMA 3WGOA 5FOXA 2AMVA 3FSJX 3T4UA 3EHDA 6YASA 1QIGA 2MHCA 4XTRA 5DNAA 2Q2WA 1NT4A 5IZCC 2QNRA 3BRWD 2JNWA 1XT6A 3MG9A 4MR9A 5KQRA 2IUEA 1NYQA 2ZJOA 4KGXA 5LQJA 3NHKA 2NU8A 4P4LA 1AXRA 1RSZA 1ABFA 3GLVA 3QF4A 4NBNA 2V7XA 3HYCA 2OO3A 3KAKA 4BTLA 1EUDA 1YMUA 4B4DA 1G8FA 4MQ5A 4D9KA 4OXKA 2WMOB 4BJ6A 1N3IA 4PSKA 4QXPA 2AVNA 5EZ6B 2P6MA 4CF5A 4KFSA 4EJ0A 2ENWA 3V80A 4B7ZA 1AIPA 2HNAA 1GL9B 1Z4IA 1XDGA 2QNIA 4OV6B 4RIHA 3VV2A 5DGXA 2W0MA 2XHEA 1XQ1A 3QJ5A 5HFNA 4TLDA 4WA8A 1FC0A 3SCZA 1MG0A 1OU4A 2WFAA 4EELA 2DUUA 4J07A 3IQHX 4YROA 4K81B 4TV9A 4GL2A 1VGRA 2HIAA 3EXAA 2ZAYA 2FUG6 4O1IA 1MZPA 1SCQA 3EVNA 3TZLA 1P7CA 2YS7A 2PZ8A 3TZ6A 5HCIA 2OEPA 4YDQA 1UAAA 4CF3A 4Z7QB 1VE5A 2ZKLA 5HQ3A 1KYZA 1ZIOA 2RHCA 4Q4HB 4QUIA 2VOJA 2EV9A 3MWEA 1G8GA 2X0EA 2XW6A 4IEEA 3MUOA 4ZZ2A 3G2OA 2O50A 2UZ0A 1KXJA 5DTIA 3UG7A 3O4HA 1JJVA 3C41J 4FK8A 2EGUA 1FLNA 1JYSA 1OC4A 2B69A 2BTOA 3HL4A 2Z9DA 3C48A 2IKSA 4LDJA 4U6NA 3EXFB 5T6MA 3RSGA 4CIYA 1AKRA 5BMVA 4BFWA 1UC8A 4V38A 5IYZF 1AG9A 4NRDA 1KMHB 1NF9A 2BZSA 4QU8A 2P5TB 5G4LA 4ZWNA 2QIOA 3GA7A 2R1TA 1ZN2A 4CM3A 3OUTA 1PDWA 1UBTS 4X66B 3QLVC 4RA9A 3NDBB 2H1FA 4QASA 4RCZA 3QTTA 1Y3DE 1HV8A 5EMMA 1NSFA 3SHQA 4FWTA 2HRCA 2HBQA 1BX0A 4KODA 1TNDA 2VKTA 5TS2A 2ONJA 4N5LA 1L1FA 3UV3A 1OA0A 1PJ4A 1R66A 4LMAA 4LX8A 1RW4A 4WKNA 5ALEA 1U0LA 4OUDB 5GJCA 5LDGA 2OM2A 2QKYA 4Q1FA 2J6HA 1DXHA 3KSDO 3VR1A 3W34A 4IWYA 3PGA1 1EBUA 3HN2A 3RUDA 3W5IA 1C9YA 1RTTA 3H1GA 5AHRA 1LBSA 3KU4A 1D7AA 4B3DA 3OPYA 3KLOA 4JMLA 4E08A 1U7HA 1OGJA 1RAIA 1DIBA 1TLLA 4I1OA 5DJ5A 5F21A 3RYCB 3P45A 3NHZA 4AT1A 2P69A 1VHLA 2V7QA 3VVLA 1DKOA 4ML3A 5F1KA 3HCNA 5NULA 4UTNA 1FDTA 2R8ZA 4XVQA 5G3YA 3HCAA 5LQAA 4ID3A 2BJVA 1JB1A 2QJFA 5KVQA 1RAHA 3IXLA 5KYUA 4IJUA 1SCIA 3DCIA 3AM5A 2EERA 2WSLA 2EYUA 3ZBUA 4F71A 1QIEA 3WNBA 2P30A 3DEJA 4B4WA 1L7XA 3DVAB 3QBVA 1EP1B 4I50A 1JHMA 1Q1NA 5BPFA 4KXVA 2OESA 1JU4A 2RHOA 1NBMD 4PZLA 1T3GA 3L2OB 4L75A 5C7IO 5KTMA 4Y2TA 4JR0A 4MVYA 2KLBA 3P9IA 1Z0DA 4P08A 4PHGA 5IKXA 4WA7A 1BHSA 3N0TA 1L5ZA 3VRHA 3BIWA 4GMDA 4O1HA 4OSOA 1BVHA 1HOXA 4L4XA 5I7VA 3WJ1A 2N1BA 1LH0A 5TY0A 5KNCA 4YBZA 5AM4A 4MWOA 3CKMA 1E61A 5FNZA 4Q1VA 2R47A 4MQBA 3GP3A 4DMHA 4WZBA 4PZ0A 3PVCA 2YQ4A 3X1JA 1ZMRA 3G9XA 4MVXA 1VFPA 4IO1A 1P5ZB 3VQTA 2UXCB 3D4LA 3IAM6 5EA2A 3X44A 1H05A 4KSBA 3ZHXA 4UOZA 1Q92A 3O8OA 2EF0A 1NUAA 1FQOA 3HUTA 3JAWB 4GRAA 2AN4A 4I8IA 4W9NC 2IYRA 3WGJA 1TCBA 3HNRA 3HCOA 1D09A 2QA5A 5FF9A 3W7BA 1WSWA 1FDOA 1MEJA 4ZMBA 2ZRMA 1WXFA 2G0NA 3VR2D 4XA8A 3AW9A 1HFKA 2N9UA 2XKBA 1AGRA 3QKWA 4LWZA 5LQDA 3D6TB 1N5RA 2WF9A 4OGWA 2IH5A 4WECA 4MEJA 5F1PA 4P82A 5JPCA 4FFLA 1Y37A 3JQ8B 4EY3A 4BUZA 4XOUA 4BV2A 4GD3Q 4PG5A 4AO7A 4RK5A 4EHFA 4GPD1 1QIKA 1RAGA 2B36A 3ABQB 4GXNA 4J0IA 5JXJA 3RDPA 1DAIA 4EMBA 1RMQA 4ABYA 2GAIA 3HU2A 3AOEC 3BWDD 1XA3A 3ESRA 1AUPA 4REQB 2FGJA 1ZMOA 2VJMA 4KB5A 1DS6A 1Y1KE 3NVDA 4PWYA 4WERA 2MMGA 2GUGA 4WV3A 5K7SA 1K7YA 5CLHA 2F59A 1CP3A 4G6ZA 5E0OA 1ZY2A 4JT4A 1K6XA 2XF2A 1E3SA 4R1OA 4YRQA 1Z8FA 5LQKA 3KZXA 2BV3A 3FI9A 1NWCA 4GI1A 2N46A 1UEIA 2GM3A 3ZQ6A 3MELA 2HA3A 1T2FA 3A1NA 3OLYA 2LCQA 4RE5A 5CNJA 1D6SA 1O95C 2Z8YA 4FEGA 3EFOA 1DQNA 3PUJA 5IUKC 4JKYA 3FTEA 5JSYA 1QGUA 4P86A 3UCEA 2AZXA 5ESWA 1Q1EA 4X95A 4RTKA 1RQ7A 4CMAA 1RQLA 1HQYE 3STHA 2XTAA 4V3CA 3FNFA 1SOMA 3D59A 5FFFA 3I5XA 2RD2A 3DDCA 3SI7A 5TE9A 2IH2A 3PE4A 1FRQA 3NBQA 2Z57A 4UNPA 1E5TA 1KY2A 1Q20A 1G6OA 3U7JA 3HRKA 1P3DA 4F9TA 3MAGA 1V47A 3DZDA 1KEUA 3DPIA 1E79A 3LOQA 4PQGA 1ISHA 3CUKA