2AZPA

Crystal structure of pa1268 solved by sulfur sad
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
318
structure length
318
Chain Sequence
b'GHMQRIRIIDSHTGGEPTRLVIGGFPDLGQGDMAERRRLLGERHDAWRAACILEPRGSDVLVGALLCAPVDPEACAGVIFFNNSGYLGMCGHGTIGLVASLAHLGRIGPGVHRIETPVGEVEATLHEDGSVSVRNVPAYRYRRQVSVEVPGIGRVSGDIAWGGNWFFLVAGHGQRLAGDNLDALTAYTVAVQQALDDQDIRGEDGGAIDHIELFADDPHADSRNFVLCPGKAYDRSPCGTGTSAKLACLAADGKLLPGQPWRQASVIGSQFEGRYEWLDGQPGGPIVPTIRGRAHVSAEATLLLADDDPFAWGIRRGS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein PA1268
publication title Crystal Structure of PA1268 Solved by Sulfur SAD
rcsb
source organism Pseudomonas aeruginosa
molecule tags Structural genomics, unknown function
total genus 88
structure length 318
sequence length 318
ec nomenclature ec 5.1.1.8: 4-hydroxyproline epimerase.
pdb deposition date 2005-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05544 Pro_racemase Proline racemase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.310.10 Alpha Beta Roll Diaminopimelate Epimerase; Chain A, domain 1 Diaminopimelate Epimerase; Chain A, domain 1 2azpA02
3.10.310.10 Alpha Beta Roll Diaminopimelate Epimerase; Chain A, domain 1 Diaminopimelate Epimerase; Chain A, domain 1 2azpA01
3EJXA 4JBDA 2Q9JA 3EDNA 1XUAA 2PW0A 1TM0A 1YM5A 1S7JA 5H2YA 1GQZA 5M47A 4IK0A 1BWZA 4DUNA 5IWEA 4J9XA 4JUUA 4Q60A 5HA4A 4K8LA 3EKMA 2H9FA 1U0KA 4JD7A 4J9WA 2GKEA 1QY9A 1U1XA 1XUBA 4K7XA 2AZPA 4Q2HA 2OTNA 5H2GA 3FVEA 4IJZA 2Q9HA 3G7KA 1T6KA 1U1WA 1W61A 4JCIA 2PVZA 4K7GB 1W62A 4LB0A 2GKJA 1QYAA 1SDJA 1U1VA
chains in the Genus database with same CATH superfamily
3EJXA 1XUAA 2PW0A 1K20A 2KW7A 1WPPA 1GQZA 1BWZA 1I74A 3EKMA 1IR6A 4JD7A 2MPBA 4RPAA 2IW4A 1XUBA 4Q2HA 2Q9HA 3G7KA 1T6KA 4K7GB 4LB0A 2GKJA 1QYAA 4JBDA 3EDNA 3IGHX 1YM5A 2ZVFA 5H2YA 4PY9A 2H9FA 4J9WA 2GKEA 2ZXRA 4IJZA 2ZXPA 2PVZA 3ICJA 4LS9A 1SDJA 3WQZA 2HAWA 2Q9JA 3PVHA 1TM0A 1S7JA 3W5WA 3PW9A 5M47A 4J9XA 4JUUA 4Q60A 5HA4A 1K23A 2EB0A 4K7XA 5H2GA 3FVEA 2QB8A 3DEVA 1W61A 2ENXA 1W62A 4LG3A 2LT2A 3PTJA 4IK0A 4GL6A 5IWEA 2YMAA 4K8LA 2QB6A 1WPMA 1U0KA 5ANPA 2KPTA 1QY9A 1U1XA 2AZPA 2OTNA 2ZXOA 3G98A 2QB7A 1U1WA 4JCIA 4OA3A 4DUNA 1U1VA
chains in the Genus database with same CATH topology
3EJXA 1XUAA 2PW0A 1K20A 2KW7A 1WPPA 1GQZA 1BWZA 1I74A 3EKMA 1IR6A 4JD7A 2MPBA 4RPAA 2IW4A 1XUBA 4Q2HA 2Q9HA 3G7KA 1T6KA 4K7GB 4LB0A 2GKJA 1QYAA 4JBDA 3EDNA 3IGHX 1YM5A 2ZVFA 5H2YA 4PY9A 2H9FA 4J9WA 2GKEA 2ZXRA 4IJZA 2ZXPA 2PVZA 3ICJA 4LS9A 1SDJA 3WQZA 2HAWA 2Q9JA 3PVHA 1TM0A 1S7JA 3W5WA 3PW9A 5M47A 4J9XA 4JUUA 4Q60A 5HA4A 1K23A 2EB0A 4K7XA 5H2GA 3FVEA 2QB8A 3DEVA 1W61A 2ENXA 1W62A 4LG3A 2LT2A 3PTJA 4IK0A 4GL6A 5IWEA 2YMAA 4K8LA 2QB6A 1WPMA 1U0KA 5ANPA 2KPTA 1QY9A 1U1XA 2AZPA 2OTNA 2ZXOA 3G98A 2QB7A 1U1WA 4JCIA 4OA3A 4DUNA 1U1VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EJX A;  4JBD A;  2Q9J A;  3EDN A;  1XUA A;  2PW0 A;  1TM0 A;  1YM5 A;  1S7J A;  5H2Y A;  1GQZ A;  5M47 A;  4IK0 A;  1BWZ A;  4DUN A;  5IWE A;  4J9X A;  4JUU A;  4Q60 A;  5HA4 A;  4K8L A;  3EKM A;  2H9F A;  1U0K A;  4JD7 A;  4J9W A;  2GKE A;  1QY9 A;  1U1X A;  1XUB A;  4K7X A;  2AZP A;  4Q2H A;  2OTN A;  5H2G A;  3FVE A;  4IJZ A;  2Q9H A;  3G7K A;  1T6K A;  1U1W A;  1W61 A;  4JCI A;  2PVZ A;  4K7G B;  1W62 A;  4LB0 A;  2GKJ A;  1QYA A;  1SDJ A;  1U1V A; 
#chains in the Genus database with same CATH topology
 3EJX A;  1XUA A;  2PW0 A;  1K20 A;  2KW7 A;  1WPP A;  1GQZ A;  1BWZ A;  1I74 A;  3EKM A;  1IR6 A;  4JD7 A;  2MPB A;  4RPA A;  2IW4 A;  1XUB A;  4Q2H A;  2Q9H A;  3G7K A;  1T6K A;  4K7G B;  4LB0 A;  2GKJ A;  1QYA A;  4JBD A;  3EDN A;  3IGH X;  1YM5 A;  2ZVF A;  5H2Y A;  4PY9 A;  2H9F A;  4J9W A;  2GKE A;  2ZXR A;  4IJZ A;  2ZXP A;  2PVZ A;  3ICJ A;  4LS9 A;  1SDJ A;  3WQZ A;  2HAW A;  2Q9J A;  3PVH A;  1TM0 A;  1S7J A;  3W5W A;  3PW9 A;  5M47 A;  4J9X A;  4JUU A;  4Q60 A;  5HA4 A;  1K23 A;  2EB0 A;  4K7X A;  5H2G A;  3FVE A;  2QB8 A;  3DEV A;  1W61 A;  2ENX A;  1W62 A;  4LG3 A;  2LT2 A;  3PTJ A;  4IK0 A;  4GL6 A;  5IWE A;  2YMA A;  4K8L A;  2QB6 A;  1WPM A;  1U0K A;  5ANP A;  2KPT A;  1QY9 A;  1U1X A;  2AZP A;  2OTN A;  2ZXO A;  3G98 A;  2QB7 A;  1U1W A;  4JCI A;  4OA3 A;  4DUN A;  1U1V A; 
#chains in the Genus database with same CATH homology
 3EJX A;  1XUA A;  2PW0 A;  1K20 A;  2KW7 A;  1WPP A;  1GQZ A;  1BWZ A;  1I74 A;  3EKM A;  1IR6 A;  4JD7 A;  2MPB A;  4RPA A;  2IW4 A;  1XUB A;  4Q2H A;  2Q9H A;  3G7K A;  1T6K A;  4K7G B;  4LB0 A;  2GKJ A;  1QYA A;  4JBD A;  3EDN A;  3IGH X;  1YM5 A;  2ZVF A;  5H2Y A;  4PY9 A;  2H9F A;  4J9W A;  2GKE A;  2ZXR A;  4IJZ A;  2ZXP A;  2PVZ A;  3ICJ A;  4LS9 A;  1SDJ A;  3WQZ A;  2HAW A;  2Q9J A;  3PVH A;  1TM0 A;  1S7J A;  3W5W A;  3PW9 A;  5M47 A;  4J9X A;  4JUU A;  4Q60 A;  5HA4 A;  1K23 A;  2EB0 A;  4K7X A;  5H2G A;  3FVE A;  2QB8 A;  3DEV A;  1W61 A;  2ENX A;  1W62 A;  4LG3 A;  2LT2 A;  3PTJ A;  4IK0 A;  4GL6 A;  5IWE A;  2YMA A;  4K8L A;  2QB6 A;  1WPM A;  1U0K A;  5ANP A;  2KPT A;  1QY9 A;  1U1X A;  2AZP A;  2OTN A;  2ZXO A;  3G98 A;  2QB7 A;  1U1W A;  4JCI A;  4OA3 A;  4DUN A;  1U1V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...